F429667

General Info

Members Datasets Scaffolds Average Seq Length
383 234 367 493

Family's Representative Sequence

Representative Sequence 3300041443|Ga0451789_1109880|Ga0451789_1109880_101_1576
Length 476
Sequence MNARDPNLPLQPDEATAIAEFANRTWDEEIVPALTDYIAIPAKSPMFDADWQKNGHLERVVRDAASWVESKKVAGLKLEVVRLEGRTPVIFFEVPATKAGSTDTICLYGHLDKQPEFNGWRSDLGPWTPKYENGLLYGRGAADDGYAVYASLTAIMALDRQGIPRPRCVGIIEACEESGSFDLPAYLDVLRERLGNVSLVVCLDSGAGNYDQLWLTTSLRGMVSGVLKVEILTEGIHSGDSSGLVPSSFRILRQVLDRLEDSKTGRLLPESFHCEVPGDRLAQARTTAQILGDEVWKRFPWACGADGGPTLPTTTDPTEALLNRTLKNAGNVLRPYTAFKLSLRLPPLVDGNEAAMRLKTLLEDNAPYNARVTFAADGRAGAYGASGWNAPSLAPWLEDALNSASQAQFGAPCGYVGQGGTIPLMSLLQKGFPKAQMMVCGVLGPKSNAHGPNEFLHVPYGKKLTAAVAQVMAACP

Samples

Sample ID Description Type Environment
1 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
2 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
3 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
4 2643221585 Pelomonas sp. Root662 Isolate Unclassified
5 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
6 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
7 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
8 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
9 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
10 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
11 2643221656 Pelomonas sp. Root405 Isolate Unclassified
12 2643221660 Methylibium sp. Root1272 Isolate Unclassified
13 2738541337 Pelomonas sp. BT06 Isolate Unclassified
14 2831864461 Roseateles noduli HZ7 Isolate Nodule
15 2886848708 Mitsuaria sp. TWR114 Isolate Rhizosphere
16 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
17 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
18 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
19 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
20 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
21 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
22 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
23 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
24 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
25 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
26 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
27 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
28 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
29 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
30 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
31 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
32 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
33 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
34 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
35 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
36 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
37 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
38 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
39 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
40 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
41 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
42 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
43 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
44 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
45 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
46 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
47 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
48 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
49 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
50 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
51 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
52 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
53 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
54 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
55 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
59 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
60 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
61 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
62 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
63 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
64 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
65 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
70 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
71 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
73 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
77 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
78 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
84 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
85 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
93 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
94 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
95 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
96 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
99 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
101 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
102 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
103 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
105 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
106 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
107 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
109 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
110 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
111 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
113 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
150 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
151 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
157 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
158 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
159 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
160 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
161 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
162 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
163 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
164 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
165 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
166 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
167 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
168 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
169 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
170 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
171 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
172 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
173 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
174 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
175 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
176 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
177 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
178 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
179 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
180 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
181 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
182 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
183 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
184 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
185 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
186 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
187 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
188 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
189 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
190 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
191 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
192 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
193 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
194 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
195 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
196 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
197 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
198 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
199 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
200 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
201 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
202 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
203 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
204 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
205 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
206 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
207 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
208 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
209 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
210 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
211 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
212 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
213 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
214 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
215 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
216 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
217 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
218 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
219 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
220 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
221 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
222 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
223 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
224 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
225 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
226 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
227 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
228 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
229 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
230 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
231 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
232 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
233 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
234 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.56
Metatranscriptomes 0.26
Isolates 4.18

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.02
Nodule 1.57
Rhizoplane 2.09
Rhizosphere 65.01
Stem 0
Stem Tuber 0
Unclassified 13.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25156J39149_1000880 3300002705 Bacteria 14916
2 JGI25154J39366_1001463 3300002738 Bacteria 8362
3 JGI25157J39369_1000069 3300002741 Bacteria 93257
4 JGI25152J39213_1001988 3300002773 Bacteria 8071
5 JGI25153J46596_10002279 3300003215 Bacteria 11177
6 rootL2_10003559 3300003322 Bacteria 24543
7 rootH1_10046785 3300003323 Bacteria 3439
8 Ga0055539_1000500 3300003752 Bacteria 12279
9 Ga0055539_1002029 3300003752 Bacteria 3320
10 Ga0055533_1000026 3300003756 Bacteria 323407
11 Ga0055533_1000068 3300003756 Bacteria 155215
12 Ga0055525_1000056 3300003759 Bacteria 212321
13 Ga0055525_1001449 3300003759 Bacteria 4280
14 Ga0055535_1000252 3300003761 Bacteria 56714
15 Ga0055529_1000150 3300003763 Bacteria 99993
16 Ga0055526_1001773 3300003771 Bacteria 14994
17 Ga0055526_1003866 3300003771 Bacteria 9284
18 Ga0055524_1000033 3300003775 Bacteria 180833
19 Ga0055524_1003264 3300003775 Bacteria 7939
20 Ga0055540_1000184 3300003792 Bacteria 60646
21 Ga0055531_10000655 3300003794 Bacteria 29766
22 Ga0055531_10005360 3300003794 Bacteria 7519
23 Ga0055531_10009349 3300003794 Bacteria 5019
24 Ga0055543_1002258 3300004625 Bacteria 6517
25 Ga0065165_1000063 3300005262 Bacteria 176477
26 Ga0065165_1000460 3300005262 Bacteria 63833
27 Ga0070658_10024813 3300005327 Bacteria 4808
28 Ga0070658_10033024 3300005327 Bacteria 4161
29 Ga0070676_10008653 3300005328 Bacteria 5489
30 Ga0070670_100002390 3300005331 Bacteria 15466
31 Ga0070670_100033475 3300005331 Bacteria 4426
32 Ga0070670_100066211 3300005331 Bacteria 3100
33 Ga0070677_10004368 3300005333 Bacteria 4609
34 Ga0070677_10007983 3300005333 Bacteria 3545
35 Ga0068869_100013371 3300005334 Bacteria 5459
36 Ga0068869_100022741 3300005334 Bacteria 4324
37 Ga0068868_100010354 3300005338 Bacteria 6746
38 Ga0068868_100026794 3300005338 Bacteria 4395
39 Ga0068868_100095534 3300005338 Bacteria 2399
40 Ga0070660_100168782 3300005339 Bacteria 1766
41 Ga0070669_100003438 3300005353 Bacteria 11408
42 Ga0070669_100037632 3300005353 Bacteria 3510
43 Ga0070675_100004907 3300005354 Bacteria 10203
44 Ga0070675_100011363 3300005354 Bacteria 6969
45 Ga0070675_100026325 3300005354 Bacteria 4668
46 Ga0070675_100042351 3300005354 Bacteria 3720
47 Ga0070671_100007484 3300005355 Bacteria 8727
48 Ga0070671_100064885 3300005355 Bacteria 3041
49 Ga0070674_100024763 3300005356 Bacteria 3898
50 Ga0070674_100039275 3300005356 Bacteria 3195
51 Ga0070673_100000881 3300005364 Bacteria 16929
52 Ga0070673_100004600 3300005364 Bacteria 8749
53 Ga0070673_100006967 3300005364 Bacteria 7401
54 Ga0070673_100064321 3300005364 Bacteria 2922
55 Ga0070673_100087124 3300005364 Bacteria 2545
56 Ga0070667_100051156 3300005367 Bacteria 3483
57 Ga0070667_100180138 3300005367 Bacteria 1868
58 Ga0070700_100023236 3300005441 Bacteria 3625
59 Ga0070694_100005289 3300005444 Bacteria 7806
60 Ga0070663_100000177 3300005455 Bacteria 32482
61 Ga0070678_100003058 3300005456 Bacteria 9273
62 Ga0070678_100024625 3300005456 Bacteria 4034
63 Ga0070678_100043127 3300005456 Bacteria 3211
64 Ga0068867_100000279 3300005459 Bacteria 33713
65 Ga0068867_100013387 3300005459 Bacteria 5811
66 Ga0068867_100022951 3300005459 Bacteria 4464
67 Ga0068867_100041847 3300005459 Bacteria 3348
68 Ga0068853_100013903 3300005539 Bacteria 6580
69 Ga0070672_100002066 3300005543 Bacteria 12636
70 Ga0070672_100018056 3300005543 Bacteria 5091
71 Ga0070672_100018915 3300005543 Bacteria 4990
72 Ga0070672_100031163 3300005543 Bacteria 4012
73 Ga0070693_100052337 3300005547 Bacteria 2340
74 Ga0068855_100198210 3300005563 Bacteria 2261
75 Ga0070664_100035293 3300005564 Bacteria 4197
76 Ga0070664_100190361 3300005564 Bacteria 1828
77 Ga0070664_100191689 3300005564 Bacteria 1821
78 Ga0068857_100100371 3300005577 Bacteria 2596
79 Ga0068854_100084816 3300005578 Bacteria 2344
80 Ga0068854_100105293 3300005578 Bacteria 2120
81 Ga0068856_100003535 3300005614 Bacteria 15759
82 Ga0068856_100065008 3300005614 Bacteria 3604
83 Ga0070702_100030909 3300005615 Bacteria 2924
84 Ga0068852_100028808 3300005616 Bacteria 4550
85 Ga0068859_100001692 3300005617 Bacteria 22475
86 Ga0068859_100196699 3300005617 Bacteria 2100
87 Ga0068864_100001174 3300005618 Bacteria 21813
88 Ga0068864_100003663 3300005618 Bacteria 12706
89 Ga0068864_100015152 3300005618 Bacteria 6411
90 Ga0068861_100001573 3300005719 Bacteria 14520
91 Ga0068861_100026911 3300005719 Bacteria 4185
92 Ga0068863_100019041 3300005841 Bacteria 6571
93 Ga0068863_100117072 3300005841 Bacteria 2539
94 Ga0068858_100003671 3300005842 Bacteria 15203
95 Ga0068860_100025793 3300005843 Bacteria 5669
96 Ga0068860_100044216 3300005843 Bacteria 4246
97 Ga0068860_100158709 3300005843 Bacteria 2180
98 Ga0068862_100020956 3300005844 Bacteria 5462
99 Ga0068862_100025277 3300005844 Bacteria 4986
100 Ga0075366_10045204 3300006195 Bacteria 2610
101 Ga0075366_10053664 3300006195 Bacteria 2394
102 Ga0097621_100077351 3300006237 Bacteria 2762
103 Ga0075370_10000225 3300006353 Bacteria 20118
104 Ga0075370_10004591 3300006353 Bacteria 6735
105 Ga0068871_100024334 3300006358 Bacteria 4694
106 Ga0068865_100002021 3300006881 Bacteria 11969
107 Ga0097620_100001692 3300006931 Bacteria 22475
108 Ga0097620_100196681 3300006931 Bacteria 2100
109 Ga0099823_1000033 3300006944 Bacteria 68228
110 Ga0079104_1000009 3300006946 Bacteria 367015
111 Ga0105240_10223165 3300009093 Bacteria 2194
112 Ga0105243_10004453 3300009148 Bacteria 11081
113 Ga0105243_10052189 3300009148 Bacteria 3238
114 Ga0105242_10058105 3300009176 Bacteria 3170
115 Ga0105248_10020910 3300009177 Bacteria 7253
116 Ga0105248_10158437 3300009177 Bacteria 2554
117 Ga0105238_10020929 3300009551 Bacteria 6664
118 Ga0105239_10023168 3300010375 Bacteria 6844
119 Ga0157319_1000007 3300012497 Bacteria 318528
120 Ga0157369_10199845 3300013105 Bacteria 2098
121 Ga0157374_10084684 3300013296 Bacteria 3014
122 Ga0157378_10008040 3300013297 Bacteria 9206
123 Ga0163162_10006818 3300013306 Bacteria 11080
124 Ga0163162_10016099 3300013306 Bacteria 7309
125 Ga0163162_10016986 3300013306 Bacteria 7120
126 Ga0157372_10045051 3300013307 Bacteria 4891
127 Ga0157375_10034877 3300013308 Bacteria 4797
128 Ga0163163_10000524 3300014325 Bacteria 34246
129 Ga0157380_10037383 3300014326 Bacteria 3762
130 Ga0157377_10000006 3300014745 Bacteria 419853
131 Ga0157377_10050177 3300014745 Bacteria 2349
132 Ga0157379_10002725 3300014968 Bacteria 14911
133 Ga0157379_10010646 3300014968 Bacteria 8015
134 Ga0157379_10049564 3300014968 Bacteria 3750
135 Ga0157379_10062713 3300014968 Bacteria 3324
136 Ga0213872_10000009 3300021361 Bacteria 221470
137 Ga0213872_10000066 3300021361 Bacteria 93052
138 Ga0213872_10000208 3300021361 Bacteria 52289
139 Ga0213872_10000226 3300021361 Bacteria 49354
140 Ga0213872_10014723 3300021361 Bacteria 3645
141 Ga0213872_10041208 3300021361 Bacteria 2107
142 Ga0209674_100024 3300025226 Bacteria 535481
143 Ga0209563_100014 3300025230 Bacteria 940582
144 Ga0209563_100101 3300025230 Bacteria 152297
145 Ga0207427_101408 3300025231 Bacteria 8786
146 Ga0209258_100080 3300025242 Bacteria 255287
147 Ga0209258_100912 3300025242 Bacteria 14962
148 Ga0207425_1000681 3300025245 Bacteria 18553
149 Ga0209646_1000012 3300025246 Bacteria 573300
150 Ga0209026_1000004 3300025250 Bacteria 949012
151 Ga0209677_100091 3300025253 Bacteria 106743
152 Ga0209677_100150 3300025253 Bacteria 64346
153 Ga0209677_101979 3300025253 Bacteria 8140
154 Ga0209759_1000003 3300025256 Bacteria 792130
155 Ga0209759_1000067 3300025256 Bacteria 183764
156 Ga0209759_1000827 3300025256 Bacteria 24481
157 Ga0209759_1000945 3300025256 Bacteria 20847
158 Ga0209759_1011547 3300025256 Bacteria 2503
159 Ga0209129_1000038 3300025258 Bacteria 322778
160 Ga0209565_1010557 3300025263 Bacteria 2284
161 Ga0209455_1000030 3300025272 Bacteria 533479
162 Ga0209673_1006116 3300025273 Bacteria 5902
163 Ga0209564_1000030 3300025295 Bacteria 503296
164 Ga0209564_1000162 3300025295 Bacteria 162265
165 Ga0209758_1000152 3300025297 Bacteria 162418
166 Ga0209050_1001318 3300025298 Bacteria 27770
167 Ga0209050_1005806 3300025298 Bacteria 7582
168 Ga0209256_1000019 3300025299 Bacteria 558627
169 Ga0209256_1000154 3300025299 Bacteria 144509
170 Ga0209256_1001630 3300025299 Bacteria 21865
171 Ga0209051_1000004 3300025303 Bacteria 1155596
172 Ga0209051_1001939 3300025303 Bacteria 15964
173 Ga0209051_1002219 3300025303 Bacteria 14333
174 Ga0209257_1000038 3300025304 Bacteria 609032
175 Ga0209257_1000044 3300025304 Bacteria 486709
176 Ga0209257_1001143 3300025304 Bacteria 33909
177 Ga0209257_1002818 3300025304 Bacteria 16333
178 Ga0207682_10004149 3300025893 Bacteria 6133
179 Ga0207682_10014925 3300025893 Bacteria 3025
180 Ga0207680_10003513 3300025903 Bacteria 7375
181 Ga0207645_10012170 3300025907 Bacteria 5843
182 Ga0207645_10021151 3300025907 Bacteria 4246
183 Ga0207695_10105531 3300025913 Bacteria 2805
184 Ga0207671_10075450 3300025914 Bacteria 2522
185 Ga0207657_10026574 3300025919 Bacteria 5316
186 Ga0207657_10068876 3300025919 Bacteria 3005
187 Ga0207649_10018750 3300025920 Bacteria 3942
188 Ga0207681_10021197 3300025923 Bacteria 4128
189 Ga0207681_10069642 3300025923 Bacteria 2447
190 Ga0207694_10012459 3300025924 Bacteria 6410
191 Ga0207650_10001509 3300025925 Bacteria 16629
192 Ga0207650_10007976 3300025925 Bacteria 7218
193 Ga0207659_10000693 3300025926 Bacteria 19984
194 Ga0207659_10001411 3300025926 Bacteria 14308
195 Ga0207644_10045695 3300025931 Bacteria 3116
196 Ga0207644_10055810 3300025931 Bacteria 2848
197 Ga0207706_10001423 3300025933 Bacteria 23955
198 Ga0207706_10002215 3300025933 Bacteria 18972
199 Ga0207686_10028087 3300025934 Bacteria 3303
200 Ga0207709_10002660 3300025935 Bacteria 11087
201 Ga0207709_10025543 3300025935 Bacteria 3383
202 Ga0207704_10030787 3300025938 Bacteria 3014
203 Ga0207691_10001450 3300025940 Bacteria 23610
204 Ga0207691_10004652 3300025940 Bacteria 13287
205 Ga0207691_10008046 3300025940 Bacteria 10136
206 Ga0207711_10050249 3300025941 Bacteria 3569
207 Ga0207689_10011085 3300025942 Bacteria 7746
208 Ga0207689_10015431 3300025942 Bacteria 6467
209 Ga0207689_10079389 3300025942 Bacteria 2697
210 Ga0207679_10018387 3300025945 Bacteria 4681
211 Ga0207667_10024814 3300025949 Bacteria 6575
212 Ga0207667_10030671 3300025949 Bacteria 5812
213 Ga0207651_10001652 3300025960 Bacteria 10230
214 Ga0207651_10012840 3300025960 Bacteria 4761
215 Ga0207651_10042158 3300025960 Bacteria 3035
216 Ga0207651_10066919 3300025960 Bacteria 2526
217 Ga0207651_10107555 3300025960 Bacteria 2085
218 Ga0207658_10010141 3300025986 Bacteria 6402
219 Ga0207658_10051643 3300025986 Bacteria 3031
220 Ga0207658_10084451 3300025986 Bacteria 2443
221 Ga0207677_10002495 3300026023 Bacteria 9657
222 Ga0207677_10012736 3300026023 Bacteria 4849
223 Ga0207703_10002312 3300026035 Bacteria 16637
224 Ga0207703_10056989 3300026035 Bacteria 3184
225 Ga0207678_10000060 3300026067 Bacteria 85708
226 Ga0207708_10005130 3300026075 Bacteria 9662
227 Ga0207702_10001911 3300026078 Bacteria 20342
228 Ga0207702_10108411 3300026078 Bacteria 2464
229 Ga0207641_10002061 3300026088 Bacteria 19091
230 Ga0207641_10057629 3300026088 Bacteria 3304
231 Ga0207648_10000873 3300026089 Bacteria 33984
232 Ga0207648_10026807 3300026089 Bacteria 5118
233 Ga0207648_10070328 3300026089 Bacteria 3051
234 Ga0207648_10078950 3300026089 Bacteria 2872
235 Ga0207676_10001594 3300026095 Bacteria 16708
236 Ga0207676_10079982 3300026095 Bacteria 2652
237 Ga0207676_10158442 3300026095 Bacteria 1958
238 Ga0207675_100001114 3300026118 Bacteria 26600
239 Ga0207675_100011882 3300026118 Bacteria 8138
240 Ga0207675_100039804 3300026118 Bacteria 4386
241 Ga0207675_100042676 3300026118 Bacteria 4235
242 Ga0207683_10014068 3300026121 Bacteria 6821
243 Ga0207698_10007748 3300026142 Bacteria 6743
244 Ga0207698_10086628 3300026142 Bacteria 2548
245 Ga0207698_10135325 3300026142 Bacteria 2113
246 Ga0209281_1000023 3300027111 Bacteria 519955
247 Ga0209389_1000236 3300027296 Bacteria 36611
248 Ga0209371_1007985 3300027312 Bacteria 3587
249 Ga0209968_1000828 3300027526 Bacteria 4792
250 Ga0209966_1000113 3300027695 Bacteria 35785
251 Ga0268265_10001580 3300028380 Bacteria 18852
252 Ga0268264_10000909 3300028381 Bacteria 31074
253 Ga0268264_10007785 3300028381 Bacteria 8921
254 Ga0268264_10111650 3300028381 Bacteria 2395
255 Ga0268264_10135333 3300028381 Bacteria 2190
256 Ga0265336_10000030 3300028666 Bacteria 169335
257 Ga0307517_10017742 3300028786 Bacteria 9252
258 Ga0307515_10001320 3300028794 Bacteria 56334
259 Ga0307515_10024658 3300028794 Bacteria 10463
260 Ga0307515_10051729 3300028794 Bacteria 6115
261 Ga0307515_10064784 3300028794 Bacteria 5103
262 Ga0307515_10121756 3300028794 Bacteria 2949
263 Ga0265324_10000234 3300029957 Bacteria 41958
264 Ga0307512_10007489 3300030522 Bacteria 10812
265 Ga0265327_10000020 3300031251 Bacteria 424552
266 Ga0307513_10004000 3300031456 Bacteria 19785
267 Ga0307513_10013278 3300031456 Bacteria 10114
268 Ga0307513_10121386 3300031456 Bacteria 2580
269 Ga0307509_10000139 3300031507 Bacteria 108589
270 Ga0307509_10001408 3300031507 Bacteria 40683
271 Ga0307509_10025683 3300031507 Bacteria 6576
272 Ga0307509_10143964 3300031507 Bacteria 2313
273 Ga0307509_10215734 3300031507 Bacteria 1738
274 Ga0307508_10000291 3300031616 Bacteria 61434
275 Ga0307514_10001154 3300031649 Bacteria 35951
276 Ga0307514_10032607 3300031649 Bacteria 4166
277 Ga0307516_10000942 3300031730 Bacteria 40129
278 Ga0307516_10009715 3300031730 Bacteria 10683
279 Ga0307516_10157874 3300031730 Bacteria 2021
280 Ga0307413_10098781 3300031824 Bacteria 1923
281 Ga0307406_10045406 3300031901 Bacteria 2758
282 Ga0307412_10043555 3300031911 Bacteria 2923
283 Ga0307416_100005998 3300032002 Bacteria 7555
284 Ga0307411_10023145 3300032005 Bacteria 3673
285 Ga0307415_100005075 3300032126 Bacteria 6934
286 Ga0307510_10019224 3300033180 Bacteria 8016
287 Ga0373931_0007490 3300035691 Bacteria 5140
288 Ga0373931_0010384 3300035691 Bacteria 4475
289 Ga0373931_0080961 3300035691 Bacteria 1792
290 Ga0373927_0014011 3300035695 Bacteria 5315
291 Ga0373933_0011079 3300035724 Bacteria 4957
292 Ga0373925_0010228 3300037068 Bacteria 6809
293 Ga0395898_0000990 3300037466 Bacteria 44660
294 Ga0395905_0000951 3300037471 Bacteria 37161
295 Ga0395905_0010013 3300037471 Bacteria 9240
296 Ga0395905_0022128 3300037471 Bacteria 6014
297 Ga0436365_0646122 3300039437 Bacteria 1920
298 Ga0436361_0052534 3300039447 Bacteria 27577
299 Ga0436361_0074986 3300039447 Bacteria 19532
300 Ga0436361_0096676 3300039447 Bacteria 32751
301 Ga0436361_0175408 3300039447 Bacteria 3418
302 Ga0436361_0572581 3300039447 Bacteria 116104
303 Ga0436361_0700101 3300039447 Bacteria 4175
304 Ga0451789_1109880 3300041443 Bacteria 2447
305 Ga0451839_1036224 3300041496 Bacteria 2105
306 Ga0451853_2259034 3300041512 Bacteria 1866
307 Ga0450919_001453 3300042121 Bacteria 3096
308 Ga0450890_001062 3300042127 Bacteria 3999
309 Ga0450891_000051 3300042129 Bacteria 9004
310 Ga0450889_000094 3300042144 Bacteria 8413
311 Ga0450918_000285 3300042531 Bacteria 11477
312 Ga0451577_0001207 3300042876 Bacteria 36165
313 Ga0451577_0002739 3300042876 Bacteria 20447
314 Ga0451577_0037499 3300042876 Bacteria 4362
315 Ga0466969_0000186 3300044656 Bacteria 33421
316 Ga0466972_0000314 3300044658 Bacteria 27904
317 Ga0466972_0018977 3300044658 Bacteria 3437
318 Ga0466965_0005778 3300044683 Bacteria 5585
319 Ga0466966_0013029 3300044684 Bacteria 5505
320 Ga0466963_0025412 3300044694 Bacteria 3777
321 Ga0466963_0058324 3300044694 Bacteria 2574
322 Ga0453684_0003748 3300044712 Bacteria 33606
323 Ga0453684_0076523 3300044712 Bacteria 4201
324 Ga0466970_0024276 3300044765 Bacteria 3170
325 Ga0466959_0085207 3300045049 Bacteria 2274
326 Ga0451576_0005858 3300045051 Bacteria 15264
327 Ga0495592_0000350 3300046454 Bacteria 37566
328 Ga0495650_0006168 3300046471 Bacteria 7534
329 Ga0495639_0019812 3300046475 Bacteria 2936
330 Ga0495585_0043007 3300046492 Bacteria 2528
331 Ga0495632_0005504 3300046519 Bacteria 8357
332 Ga0495586_0030058 3300046535 Bacteria 2908
333 Ga0495645_0109321 3300046543 Bacteria 1957
334 Ga0495625_0018743 3300046660 Bacteria 5391
335 Ga0495647_0056872 3300046681 Bacteria 1534
336 Ga0495670_0064679 3300046691 Bacteria 1843
337 Ga0495684_0020473 3300047471 Bacteria 5099
338 Ga0495686_0010295 3300047472 Bacteria 6661
339 Ga0496102_0129556 3300048905 Bacteria 2360
340 Ga0496106_0024789 3300048909 Bacteria 4460
341 Ga0496109_0023327 3300048912 Bacteria 5491
342 Ga0496109_0071335 3300048912 Bacteria 3189
343 Ga0496109_0171242 3300048912 Bacteria 2037
344 Ga0496111_0061718 3300048914 Bacteria 2717
345 Ga0496114_0004762 3300048917 Bacteria 10564
346 Ga0496124_0003437 3300048927 Bacteria 19388
347 Ga0496124_0014788 3300048927 Bacteria 7527
348 Ga0496125_0004680 3300048928 Bacteria 15593
349 Ga0501198_000033 3300049649 Bacteria 56683
350 Ga0501222_000016 3300049662 Bacteria 80046
351 nmdc:mga0k408_21546_c1 3300050493 Bacteria 3620
352 nmdc:mga07m45_18436_c2 3300050496 Bacteria 3424
353 nmdc:mga07m45_6492_c1 3300050496 Bacteria 5915
354 Ga0500635_0000047 3300053080 Bacteria 84059
355 Ga0495619_0024704 3300053085 Bacteria 3856
356 Ga0500578_0014097 3300053086 Bacteria 5144
357 Ga0500628_003028 3300053129 Bacteria 2761
358 Ga0500642_0015376 3300053130 Bacteria 2876
359 Ga0500559_0000252 3300053136 Bacteria 42525
360 Ga0500577_0015160 3300053142 Bacteria 2401
361 Ga0500619_000182 3300053154 Bacteria 15103
362 Ga0500622_0000300 3300053156 Bacteria 50701
363 Ga0500622_0002158 3300053156 Bacteria 14594
364 Ga0500622_0003941 3300053156 Bacteria 9591
365 Ga0500645_015383 3300053730 Bacteria 2424
366 Ga0500587_001862 3300053739 Bacteria 3006
367 Ga0587073_0008257 3300059492 Bacteria 1679

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009551 Ga0105238_10020929 Ga0105238_1002092910 426
2 3300031456 Ga0307513_10121386 Ga0307513_101213861 458
3 3300035691 Ga0373931_0010384 Ga0373931_0010384_1902_3404 469
4 3300031649 Ga0307514_10001154 Ga0307514_1000115411 471
5 3300041443 Ga0451789_1109880 Ga0451789_1109880_101_1576 475
6 3300041496 Ga0451839_1036224 Ga0451839_1036224_174_1649 475
7 3300046519 Ga0495632_0005504 Ga0495632_0005504_3545_5020 475
8 3300053129 Ga0500628_003028 Ga0500628_003028_207_1682 475
9 3300053130 Ga0500642_0015376 Ga0500642_0015376_185_1660 475
10 3300053142 Ga0500577_0015160 Ga0500577_0015160_654_2129 475
11 3300053156 Ga0500622_0000300 Ga0500622_0000300_48140_49615 475
12 3300042876 Ga0451577_0001207 Ga0451577_0001207_8292_9758 478
13 3300025256 Ga0209759_1011547 Ga0209759_10115472 480
14 3300027526 Ga0209968_1000828 Ga0209968_10008286 480
15 3300027695 Ga0209966_1000113 Ga0209966_100011310 480
16 3300046660 Ga0495625_0018743 Ga0495625_0018743_1491_2969 481
17 3300046681 Ga0495647_0056872 Ga0495647_0056872_29_1477 481
18 3300003323 rootH1_10046785 rootH1_100467851 482
19 3300003752 Ga0055539_1000500 Ga0055539_10005006 482
20 3300003756 Ga0055533_1000026 Ga0055533_10000262 482
21 3300003756 Ga0055533_1000068 Ga0055533_100006884 482
22 3300003759 Ga0055525_1001449 Ga0055525_10014496 482
23 3300005327 Ga0070658_10024813 Ga0070658_100248135 482
24 3300006195 Ga0075366_10053664 Ga0075366_100536642 482
25 3300006353 Ga0075370_10004591 Ga0075370_100045915 482
26 3300025226 Ga0209674_100024 Ga0209674_100024295 482
27 3300025230 Ga0209563_100101 Ga0209563_10010185 482
28 3300025253 Ga0209677_100091 Ga0209677_10009127 482
29 3300025949 Ga0207667_10030671 Ga0207667_100306715 482
30 3300028794 Ga0307515_10001320 Ga0307515_1000132030 482
31 3300031456 Ga0307513_10004000 Ga0307513_1000400011 482
32 3300035691 Ga0373931_0080961 Ga0373931_0080961_43_1527 482
33 3300044694 Ga0466963_0058324 Ga0466963_0058324_919_2403 482
34 3300050496 nmdc:mga07m45_6492_c1 nmdc:mga07m45_6492_c1_2424_3920 482
35 3300025242 Ga0209258_100912 Ga0209258_10091214 483
36 3300045051 Ga0451576_0005858 Ga0451576_0005858_479_1933 483
37 iso_pu_bacteria 2894023352 2894027659 483
38 3300025949 Ga0207667_10024814 Ga0207667_100248147 485
39 iso_pu_bacteria 2643221644 2644246642 485
40 iso_pu_bacteria 2585428058 2587732514 486
41 iso_pu_bacteria 2588253510 2588291881 486
42 iso_pu_bacteria 2643221544 2643741772 486
43 iso_pu_bacteria 2643221585 2643935042 486
44 iso_pu_bacteria 2643221592 2643971465 486
45 iso_pu_bacteria 2643221625 2644141000 486
46 iso_pu_bacteria 2643221646 2644259254 486
47 iso_pu_bacteria 2643221648 2644276792 486
48 iso_pu_bacteria 2643221654 2644303731 486
49 iso_pu_bacteria 2643221656 2644316529 486
50 iso_pu_bacteria 2738541337 2739053520 486
51 iso_pu_bacteria 2831864461 2831870143 486
52 iso_pu_bacteria 2886848708 2886849442 486
53 3300025231 Ga0207427_101408 Ga0207427_1014086 487
54 3300041512 Ga0451853_2259034 Ga0451853_2259034_182_1663 487
55 3300042876 Ga0451577_0002739 Ga0451577_0002739_6932_8398 487
56 iso_pu_bacteria 2643221660 2644339266 487
57 3300005331 Ga0070670_100066211 Ga0070670_1000662112 488
58 3300028794 Ga0307515_10024658 Ga0307515_100246585 488
59 3300031730 Ga0307516_10000942 Ga0307516_1000094222 488
60 3300037471 Ga0395905_0022128 Ga0395905_0022128_1340_2824 488
61 3300042876 Ga0451577_0037499 Ga0451577_0037499_2383_3867 488
62 3300005455 Ga0070663_100000177 Ga0070663_10000017721 489
63 3300005843 Ga0068860_100025793 Ga0068860_1000257933 489
64 3300014968 Ga0157379_10062713 Ga0157379_100627132 489
65 3300026067 Ga0207678_10000060 Ga0207678_1000006029 489
66 3300028381 Ga0268264_10111650 Ga0268264_101116502 489
67 3300042121 Ga0450919_001453 Ga0450919_001453_755_2227 489
68 3300042531 Ga0450918_000285 Ga0450918_000285_176_1648 489
69 3300003322 rootL2_10003559 rootL2_100035599 490
70 3300003759 Ga0055525_1000056 Ga0055525_100005668 490
71 3300003771 Ga0055526_1001773 Ga0055526_100177312 490
72 3300003775 Ga0055524_1000033 Ga0055524_100003385 490
73 3300003775 Ga0055524_1003264 Ga0055524_10032645 490
74 3300003792 Ga0055540_1000184 Ga0055540_100018420 490
75 3300003794 Ga0055531_10000655 Ga0055531_1000065520 490
76 3300003794 Ga0055531_10005360 Ga0055531_100053605 490
77 3300003794 Ga0055531_10009349 Ga0055531_100093492 490
78 3300004625 Ga0055543_1002258 Ga0055543_10022582 490
79 3300005262 Ga0065165_1000063 Ga0065165_100006348 490
80 3300005262 Ga0065165_1000460 Ga0065165_100046019 490
81 3300005331 Ga0070670_100033475 Ga0070670_1000334753 490
82 3300005333 Ga0070677_10004368 Ga0070677_100043683 490
83 3300005338 Ga0068868_100095534 Ga0068868_1000955342 490
84 3300005353 Ga0070669_100037632 Ga0070669_1000376322 490
85 3300005354 Ga0070675_100004907 Ga0070675_1000049075 490
86 3300005355 Ga0070671_100064885 Ga0070671_1000648852 490
87 3300005364 Ga0070673_100006967 Ga0070673_1000069674 490
88 3300005367 Ga0070667_100051156 Ga0070667_1000511563 490
89 3300005456 Ga0070678_100024625 Ga0070678_1000246252 490
90 3300005459 Ga0068867_100000279 Ga0068867_1000002798 490
91 3300005459 Ga0068867_100013387 Ga0068867_1000133873 490
92 3300005543 Ga0070672_100002066 Ga0070672_1000020665 490
93 3300005564 Ga0070664_100035293 Ga0070664_1000352932 490
94 3300005564 Ga0070664_100190361 Ga0070664_1001903612 490
95 3300005617 Ga0068859_100196699 Ga0068859_1001966991 490
96 3300005618 Ga0068864_100003663 Ga0068864_1000036632 490
97 3300005843 Ga0068860_100158709 Ga0068860_1001587091 490
98 3300006237 Ga0097621_100077351 Ga0097621_1000773512 490
99 3300006353 Ga0075370_10000225 Ga0075370_1000022512 490
100 3300006931 Ga0097620_100196681 Ga0097620_1001966811 490
101 3300006944 Ga0099823_1000033 Ga0099823_100003328 490
102 3300006946 Ga0079104_1000009 Ga0079104_1000009301 490
103 3300009148 Ga0105243_10004453 Ga0105243_100044535 490
104 3300012497 Ga0157319_1000007 Ga0157319_1000007215 490
105 3300014745 Ga0157377_10000006 Ga0157377_1000000670 490
106 3300014968 Ga0157379_10049564 Ga0157379_100495643 490
107 3300021361 Ga0213872_10000009 Ga0213872_10000009102 490
108 3300021361 Ga0213872_10000066 Ga0213872_1000006674 490
109 3300021361 Ga0213872_10000208 Ga0213872_1000020827 490
110 3300021361 Ga0213872_10000226 Ga0213872_1000022639 490
111 3300021361 Ga0213872_10014723 Ga0213872_100147233 490
112 3300021361 Ga0213872_10041208 Ga0213872_100412082 490
113 3300025230 Ga0209563_100014 Ga0209563_100014126 490
114 3300025273 Ga0209673_1006116 Ga0209673_10061165 490
115 3300025295 Ga0209564_1000030 Ga0209564_100003017 490
116 3300025298 Ga0209050_1001318 Ga0209050_100131811 490
117 3300025298 Ga0209050_1005806 Ga0209050_10058066 490
118 3300025299 Ga0209256_1000019 Ga0209256_1000019362 490
119 3300025299 Ga0209256_1000154 Ga0209256_1000154107 490
120 3300025299 Ga0209256_1001630 Ga0209256_10016309 490
121 3300025303 Ga0209051_1000004 Ga0209051_100000435 490
122 3300025303 Ga0209051_1002219 Ga0209051_10022197 490
123 3300025304 Ga0209257_1000038 Ga0209257_1000038169 490
124 3300025304 Ga0209257_1000044 Ga0209257_1000044391 490
125 3300025304 Ga0209257_1001143 Ga0209257_10011438 490
126 3300025304 Ga0209257_1002818 Ga0209257_10028188 490
127 3300025893 Ga0207682_10004149 Ga0207682_100041492 490
128 3300025923 Ga0207681_10021197 Ga0207681_100211971 490
129 3300025925 Ga0207650_10001509 Ga0207650_1000150911 490
130 3300025926 Ga0207659_10000693 Ga0207659_1000069317 490
131 3300025933 Ga0207706_10001423 Ga0207706_100014233 490
132 3300025935 Ga0207709_10002660 Ga0207709_100026607 490
133 3300025940 Ga0207691_10001450 Ga0207691_100014509 490
134 3300025960 Ga0207651_10042158 Ga0207651_100421581 490
135 3300025986 Ga0207658_10084451 Ga0207658_100844512 490
136 3300026089 Ga0207648_10000873 Ga0207648_100008738 490
137 3300026095 Ga0207676_10079982 Ga0207676_100799822 490
138 3300026095 Ga0207676_10158442 Ga0207676_101584421 490
139 3300026142 Ga0207698_10007748 Ga0207698_100077484 490
140 3300027111 Ga0209281_1000023 Ga0209281_100002386 490
141 3300027296 Ga0209389_1000236 Ga0209389_10002362 490
142 3300027312 Ga0209371_1007985 Ga0209371_10079851 490
143 3300028381 Ga0268264_10135333 Ga0268264_101353331 490
144 3300031251 Ga0265327_10000020 Ga0265327_10000020156 490
145 3300031507 Ga0307509_10215734 Ga0307509_102157342 490
146 3300031824 Ga0307413_10098781 Ga0307413_100987812 490
147 3300031901 Ga0307406_10045406 Ga0307406_100454062 490
148 3300031911 Ga0307412_10043555 Ga0307412_100435552 490
149 3300032005 Ga0307411_10023145 Ga0307411_100231452 490
150 3300037466 Ga0395898_0000990 Ga0395898_0000990_2670_4196 490
151 3300037471 Ga0395905_0000951 Ga0395905_0000951_29276_30751 490
152 3300037471 Ga0395905_0010013 Ga0395905_0010013_1025_2500 490
153 3300039447 Ga0436361_0052534 Ga0436361_0052534_3968_5443 490
154 3300039447 Ga0436361_0074986 Ga0436361_0074986_17305_18780 490
155 3300039447 Ga0436361_0096676 Ga0436361_0096676_30438_31913 490
156 3300039447 Ga0436361_0572581 Ga0436361_0572581_99569_101044 490
157 3300039447 Ga0436361_0700101 Ga0436361_0700101_766_2241 490
158 3300042127 Ga0450890_001062 Ga0450890_001062_2300_3796 490
159 3300042129 Ga0450891_000051 Ga0450891_000051_4797_6293 490
160 3300042144 Ga0450889_000094 Ga0450889_000094_5365_6861 490
161 3300044656 Ga0466969_0000186 Ga0466969_0000186_23167_24642 490
162 3300044658 Ga0466972_0000314 Ga0466972_0000314_16500_17975 490
163 3300044658 Ga0466972_0018977 Ga0466972_0018977_566_2041 490
164 3300044683 Ga0466965_0005778 Ga0466965_0005778_3223_4698 490
165 3300044684 Ga0466966_0013029 Ga0466966_0013029_2397_3872 490
166 3300044694 Ga0466963_0025412 Ga0466963_0025412_763_2238 490
167 3300044712 Ga0453684_0003748 Ga0453684_0003748_5163_6638 490
168 3300044712 Ga0453684_0076523 Ga0453684_0076523_1232_2707 490
169 3300044765 Ga0466970_0024276 Ga0466970_0024276_70_1545 490
170 3300045049 Ga0466959_0085207 Ga0466959_0085207_282_1757 490
171 3300046471 Ga0495650_0006168 Ga0495650_0006168_1452_2927 490
172 3300046691 Ga0495670_0064679 Ga0495670_0064679_121_1596 490
173 3300047472 Ga0495686_0010295 Ga0495686_0010295_2544_4019 490
174 3300048917 Ga0496114_0004762 Ga0496114_0004762_3975_5450 490
175 3300048927 Ga0496124_0003437 Ga0496124_0003437_6619_8094 490
176 3300048927 Ga0496124_0014788 Ga0496124_0014788_274_1749 490
177 3300048928 Ga0496125_0004680 Ga0496125_0004680_2717_4192 490
178 3300049649 Ga0501198_000033 Ga0501198_000033_38727_40202 490
179 3300049662 Ga0501222_000016 Ga0501222_000016_39855_41330 490
180 3300050493 nmdc:mga0k408_21546_c1 nmdc:mga0k408_21546_c1_81_1556 490
181 3300050496 nmdc:mga07m45_18436_c2 nmdc:mga07m45_18436_c2_1659_3134 490
182 3300053154 Ga0500619_000182 Ga0500619_000182_3760_5310 490
183 3300053156 Ga0500622_0002158 Ga0500622_0002158_1847_3322 490
184 3300005364 Ga0070673_100087124 Ga0070673_1000871242 491
185 3300005441 Ga0070700_100023236 Ga0070700_1000232362 491
186 3300005459 Ga0068867_100022951 Ga0068867_1000229512 491
187 3300005543 Ga0070672_100018915 Ga0070672_1000189153 491
188 3300005543 Ga0070672_100031163 Ga0070672_1000311632 491
189 3300005719 Ga0068861_100026911 Ga0068861_1000269112 491
190 3300005843 Ga0068860_100044216 Ga0068860_1000442162 491
191 3300005844 Ga0068862_100025277 Ga0068862_1000252772 491
192 3300006195 Ga0075366_10045204 Ga0075366_100452042 491
193 3300006881 Ga0068865_100002021 Ga0068865_1000020218 491
194 3300009148 Ga0105243_10052189 Ga0105243_100521892 491
195 3300013297 Ga0157378_10008040 Ga0157378_100080404 491
196 3300013306 Ga0163162_10006818 Ga0163162_100068188 491
197 3300025303 Ga0209051_1001939 Ga0209051_100193919 491
198 3300025893 Ga0207682_10014925 Ga0207682_100149252 491
199 3300025935 Ga0207709_10025543 Ga0207709_100255433 491
200 3300025938 Ga0207704_10030787 Ga0207704_100307872 491
201 3300025960 Ga0207651_10107555 Ga0207651_101075551 491
202 3300025986 Ga0207658_10051643 Ga0207658_100516432 491
203 3300026075 Ga0207708_10005130 Ga0207708_100051302 491
204 3300026089 Ga0207648_10026807 Ga0207648_100268072 491
205 3300026089 Ga0207648_10070328 Ga0207648_100703282 491
206 3300026118 Ga0207675_100042676 Ga0207675_1000426764 491
207 3300028380 Ga0268265_10001580 Ga0268265_100015806 491
208 3300028381 Ga0268264_10000909 Ga0268264_1000090913 491
209 3300035695 Ga0373927_0014011 Ga0373927_0014011_383_1876 491
210 3300037068 Ga0373925_0010228 Ga0373925_0010228_136_1629 491
211 3300046535 Ga0495586_0030058 Ga0495586_0030058_464_1957 491
212 3300035691 Ga0373931_0007490 Ga0373931_0007490_3213_4691 492
213 3300039447 Ga0436361_0175408 Ga0436361_0175408_518_1996 492
214 3300046492 Ga0495585_0043007 Ga0495585_0043007_213_1691 492
215 3300002773 JGI25152J39213_1001988 JGI25152J39213_10019884 493
216 3300003215 JGI25153J46596_10002279 JGI25153J46596_100022794 493
217 3300003771 Ga0055526_1003866 Ga0055526_10038664 493
218 3300005327 Ga0070658_10033024 Ga0070658_100330243 493
219 3300005328 Ga0070676_10008653 Ga0070676_100086532 493
220 3300005331 Ga0070670_100002390 Ga0070670_1000023909 493
221 3300005333 Ga0070677_10007983 Ga0070677_100079832 493
222 3300005334 Ga0068869_100022741 Ga0068869_1000227412 493
223 3300005338 Ga0068868_100010354 Ga0068868_1000103544 493
224 3300005338 Ga0068868_100026794 Ga0068868_1000267945 493
225 3300005339 Ga0070660_100168782 Ga0070660_1001687822 493
226 3300005353 Ga0070669_100003438 Ga0070669_1000034388 493
227 3300005354 Ga0070675_100011363 Ga0070675_1000113636 493
228 3300005354 Ga0070675_100026325 Ga0070675_1000263252 493
229 3300005354 Ga0070675_100042351 Ga0070675_1000423512 493
230 3300005355 Ga0070671_100007484 Ga0070671_1000074846 493
231 3300005356 Ga0070674_100024763 Ga0070674_1000247633 493
232 3300005356 Ga0070674_100039275 Ga0070674_1000392753 493
233 3300005364 Ga0070673_100004600 Ga0070673_1000046003 493
234 3300005364 Ga0070673_100064321 Ga0070673_1000643212 493
235 3300005367 Ga0070667_100180138 Ga0070667_1001801382 493
236 3300005444 Ga0070694_100005289 Ga0070694_1000052892 493
237 3300005456 Ga0070678_100003058 Ga0070678_1000030582 493
238 3300005456 Ga0070678_100043127 Ga0070678_1000431273 493
239 3300005459 Ga0068867_100041847 Ga0068867_1000418472 493
240 3300005543 Ga0070672_100018056 Ga0070672_1000180565 493
241 3300005547 Ga0070693_100052337 Ga0070693_1000523372 493
242 3300005564 Ga0070664_100191689 Ga0070664_1001916892 493
243 3300005578 Ga0068854_100084816 Ga0068854_1000848162 493
244 3300005578 Ga0068854_100105293 Ga0068854_1001052932 493
245 3300005614 Ga0068856_100065008 Ga0068856_1000650082 493
246 3300005615 Ga0070702_100030909 Ga0070702_1000309092 493
247 3300005616 Ga0068852_100028808 Ga0068852_1000288085 493
248 3300005617 Ga0068859_100001692 Ga0068859_10000169212 493
249 3300005618 Ga0068864_100001174 Ga0068864_10000117411 493
250 3300005618 Ga0068864_100015152 Ga0068864_1000151526 493
251 3300005719 Ga0068861_100001573 Ga0068861_10000157310 493
252 3300005841 Ga0068863_100019041 Ga0068863_1000190414 493
253 3300005841 Ga0068863_100117072 Ga0068863_1001170722 493
254 3300005842 Ga0068858_100003671 Ga0068858_10000367112 493
255 3300005844 Ga0068862_100020956 Ga0068862_1000209562 493
256 3300006358 Ga0068871_100024334 Ga0068871_1000243342 493
257 3300006931 Ga0097620_100001692 Ga0097620_1000016929 493
258 3300009176 Ga0105242_10058105 Ga0105242_100581052 493
259 3300009177 Ga0105248_10020910 Ga0105248_100209102 493
260 3300009177 Ga0105248_10158437 Ga0105248_101584372 493
261 3300013105 Ga0157369_10199845 Ga0157369_101998452 493
262 3300013296 Ga0157374_10084684 Ga0157374_100846842 493
263 3300013306 Ga0163162_10016099 Ga0163162_100160993 493
264 3300013306 Ga0163162_10016986 Ga0163162_100169866 493
265 3300013307 Ga0157372_10045051 Ga0157372_100450516 493
266 3300013308 Ga0157375_10034877 Ga0157375_100348774 493
267 3300014325 Ga0163163_10000524 Ga0163163_1000052411 493
268 3300014326 Ga0157380_10037383 Ga0157380_100373834 493
269 3300014745 Ga0157377_10050177 Ga0157377_100501772 493
270 3300014968 Ga0157379_10002725 Ga0157379_100027251 493
271 3300014968 Ga0157379_10010646 Ga0157379_100106462 493
272 3300025245 Ga0207425_1000681 Ga0207425_10006816 493
273 3300025258 Ga0209129_1000038 Ga0209129_1000038238 493
274 3300025263 Ga0209565_1010557 Ga0209565_10105572 493
275 3300025295 Ga0209564_1000162 Ga0209564_1000162114 493
276 3300025297 Ga0209758_1000152 Ga0209758_100015241 493
277 3300025903 Ga0207680_10003513 Ga0207680_100035134 493
278 3300025907 Ga0207645_10012170 Ga0207645_100121702 493
279 3300025907 Ga0207645_10021151 Ga0207645_100211513 493
280 3300025919 Ga0207657_10068876 Ga0207657_100688761 493
281 3300025920 Ga0207649_10018750 Ga0207649_100187504 493
282 3300025923 Ga0207681_10069642 Ga0207681_100696422 493
283 3300025925 Ga0207650_10007976 Ga0207650_100079766 493
284 3300025926 Ga0207659_10001411 Ga0207659_1000141110 493
285 3300025931 Ga0207644_10045695 Ga0207644_100456952 493
286 3300025931 Ga0207644_10055810 Ga0207644_100558102 493
287 3300025933 Ga0207706_10002215 Ga0207706_100022159 493
288 3300025940 Ga0207691_10004652 Ga0207691_1000465213 493
289 3300025940 Ga0207691_10008046 Ga0207691_100080465 493
290 3300025941 Ga0207711_10050249 Ga0207711_100502492 493
291 3300025942 Ga0207689_10015431 Ga0207689_100154313 493
292 3300025942 Ga0207689_10079389 Ga0207689_100793892 493
293 3300025945 Ga0207679_10018387 Ga0207679_100183874 493
294 3300025960 Ga0207651_10012840 Ga0207651_100128404 493
295 3300025960 Ga0207651_10066919 Ga0207651_100669192 493
296 3300025986 Ga0207658_10010141 Ga0207658_100101416 493
297 3300026023 Ga0207677_10002495 Ga0207677_100024952 493
298 3300026023 Ga0207677_10012736 Ga0207677_100127364 493
299 3300026035 Ga0207703_10002312 Ga0207703_100023126 493
300 3300026035 Ga0207703_10056989 Ga0207703_100569891 493
301 3300026078 Ga0207702_10108411 Ga0207702_101084111 493
302 3300026088 Ga0207641_10002061 Ga0207641_100020616 493
303 3300026088 Ga0207641_10057629 Ga0207641_100576292 493
304 3300026089 Ga0207648_10078950 Ga0207648_100789502 493
305 3300026095 Ga0207676_10001594 Ga0207676_100015942 493
306 3300026118 Ga0207675_100001114 Ga0207675_10000111414 493
307 3300026118 Ga0207675_100039804 Ga0207675_1000398044 493
308 3300026121 Ga0207683_10014068 Ga0207683_100140682 493
309 3300026142 Ga0207698_10086628 Ga0207698_100866282 493
310 3300026142 Ga0207698_10135325 Ga0207698_101353252 493
311 3300028381 Ga0268264_10007785 Ga0268264_100077858 493
312 3300028786 Ga0307517_10017742 Ga0307517_100177428 493
313 3300028794 Ga0307515_10051729 Ga0307515_100517293 493
314 3300028794 Ga0307515_10064784 Ga0307515_100647846 493
315 3300028794 Ga0307515_10121756 Ga0307515_101217562 493
316 3300030522 Ga0307512_10007489 Ga0307512_100074898 493
317 3300031456 Ga0307513_10013278 Ga0307513_100132788 493
318 3300031507 Ga0307509_10000139 Ga0307509_1000013983 493
319 3300031507 Ga0307509_10001408 Ga0307509_1000140833 493
320 3300031507 Ga0307509_10025683 Ga0307509_100256832 493
321 3300031507 Ga0307509_10143964 Ga0307509_101439642 493
322 3300031616 Ga0307508_10000291 Ga0307508_1000029131 493
323 3300031649 Ga0307514_10032607 Ga0307514_100326072 493
324 3300031730 Ga0307516_10157874 Ga0307516_101578742 493
325 3300032002 Ga0307416_100005998 Ga0307416_1000059989 493
326 3300032126 Ga0307415_100005075 Ga0307415_1000050757 493
327 3300033180 Ga0307510_10019224 Ga0307510_100192243 493
328 3300035724 Ga0373933_0011079 Ga0373933_0011079_2035_3528 493
329 3300039437 Ga0436365_0646122 Ga0436365_0646122_351_1850 493
330 3300046454 Ga0495592_0000350 Ga0495592_0000350_34445_35932 493
331 3300046543 Ga0495645_0109321 Ga0495645_0109321_234_1727 493
332 3300047471 Ga0495684_0020473 Ga0495684_0020473_2285_3778 493
333 3300048905 Ga0496102_0129556 Ga0496102_0129556_229_1770 493
334 3300048909 Ga0496106_0024789 Ga0496106_0024789_1965_3464 493
335 3300048912 Ga0496109_0023327 Ga0496109_0023327_694_2187 493
336 3300048912 Ga0496109_0071335 Ga0496109_0071335_365_1852 493
337 3300048912 Ga0496109_0171242 Ga0496109_0171242_285_1784 493
338 3300048914 Ga0496111_0061718 Ga0496111_0061718_979_2520 493
339 3300053085 Ga0495619_0024704 Ga0495619_0024704_1872_3365 493
340 3300053086 Ga0500578_0014097 Ga0500578_0014097_2886_4373 493
341 3300053136 Ga0500559_0000252 Ga0500559_0000252_16609_18096 493
342 3300053156 Ga0500622_0003941 Ga0500622_0003941_400_1887 493
343 3300053730 Ga0500645_015383 Ga0500645_015383_190_1677 493
344 3300053739 Ga0500587_001862 Ga0500587_001862_1166_2653 493
345 3300002705 JGI25156J39149_1000880 JGI25156J39149_100088010 494
346 3300002738 JGI25154J39366_1001463 JGI25154J39366_10014634 494
347 3300002741 JGI25157J39369_1000069 JGI25157J39369_100006984 494
348 3300003752 Ga0055539_1002029 Ga0055539_10020291 494
349 3300003761 Ga0055535_1000252 Ga0055535_100025222 494
350 3300003763 Ga0055529_1000150 Ga0055529_100015066 494
351 3300005334 Ga0068869_100013371 Ga0068869_1000133712 494
352 3300005364 Ga0070673_100000881 Ga0070673_10000088115 494
353 3300005539 Ga0068853_100013903 Ga0068853_1000139032 494
354 3300005563 Ga0068855_100198210 Ga0068855_1001982102 494
355 3300005577 Ga0068857_100100371 Ga0068857_1001003713 494
356 3300005614 Ga0068856_100003535 Ga0068856_1000035351 494
357 3300009093 Ga0105240_10223165 Ga0105240_102231651 494
358 3300010375 Ga0105239_10023168 Ga0105239_1002316811 494
359 3300025242 Ga0209258_100080 Ga0209258_10008034 494
360 3300025246 Ga0209646_1000012 Ga0209646_1000012209 494
361 3300025250 Ga0209026_1000004 Ga0209026_1000004409 494
362 3300025253 Ga0209677_100150 Ga0209677_10015040 494
363 3300025253 Ga0209677_101979 Ga0209677_1019793 494
364 3300025256 Ga0209759_1000003 Ga0209759_1000003317 494
365 3300025256 Ga0209759_1000067 Ga0209759_100006798 494
366 3300025256 Ga0209759_1000827 Ga0209759_100082721 494
367 3300025256 Ga0209759_1000945 Ga0209759_10009458 494
368 3300025272 Ga0209455_1000030 Ga0209455_1000030465 494
369 3300025913 Ga0207695_10105531 Ga0207695_101055312 494
370 3300025914 Ga0207671_10075450 Ga0207671_100754501 494
371 3300025919 Ga0207657_10026574 Ga0207657_100265744 494
372 3300025924 Ga0207694_10012459 Ga0207694_100124599 494
373 3300025934 Ga0207686_10028087 Ga0207686_100280874 494
374 3300025942 Ga0207689_10011085 Ga0207689_100110856 494
375 3300025960 Ga0207651_10001652 Ga0207651_100016528 494
376 3300026078 Ga0207702_10001911 Ga0207702_1000191119 494
377 3300026118 Ga0207675_100011882 Ga0207675_10001188210 494
378 3300028666 Ga0265336_10000030 Ga0265336_1000003068 494
379 3300029957 Ga0265324_10000234 Ga0265324_1000023413 494
380 3300031730 Ga0307516_10009715 Ga0307516_1000971510 494
381 3300046475 Ga0495639_0019812 Ga0495639_0019812_116_1603 494
382 3300053080 Ga0500635_0000047 Ga0500635_0000047_33070_34557 494
383 3300059492 Ga0587073_0008257 Ga0587073_0008257_76_1560 494

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01546

Peptidase_M20

Peptidase family M20/M25/M40

106

474

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
3pfe-assembly1.cif.gz_A-2 crystal structure of a m20a metallo peptidase (dape, lpg0809) from legionella pneumophila subsp. pneumophila str. philadelphia 1 at 1.50 a resolution 0.9343 14 489
3pfe-assembly1.cif.gz_A-2 crystal structure of a m20a metallo peptidase (dape, lpg0809) from legionella pneumophila subsp. pneumophila str. philadelphia 1 at 1.50 a resolution 0.9191 14 489
2pok-assembly1.cif.gz_B crystal structure of a m20 family metallo peptidase from streptococcus pneumoniae 0.7895 12 490
2pok-assembly1.cif.gz_B crystal structure of a m20 family metallo peptidase from streptococcus pneumoniae 0.7865 12 490
5vo3-assembly1.cif.gz_A-2 crystal structure of dape in complex with the products (succinic acid and diaminopimelic acid) 0.7745 14 489
ID Description Score Start End Superfamily
3pfeA01 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.9426 14 489 3.40.630.10
af_Q54X02_3_472_3.40.630.10 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.9288 13 490 3.40.630.10
af_Q54X02_3_472_3.40.630.10 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.9213 13 490 3.40.630.10
3pfeA01 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.9203 14 489 3.40.630.10
af_Q4DBK5_22_457_3.40.630.10 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.9179 32 481 3.40.630.10
ID Description Score Start End GO Terms
AF-A0A2W6TVC0-F1-model_v4 Peptidase M20 0.9462 13 221 GO:0006508
GO:0008233
AF-A0A432FL51-F1-model_v4 Peptidase M20 0.9444 13 214 GO:0006508
GO:0008233
AF-A0A2H9SMK8-F1-model_v4 Peptidase M20 0.9425 14 489 GO:0006508
GO:0008233
AF-A0A2D5BN82-F1-model_v4 Peptidase M20 0.9403 13 490 GO:0006508
GO:0008233
AF-A0A1R2C2F4-F1-model_v4 Uncharacterized protein 0.9402 13 489 GO:0006508
GO:0008233

Feature Viewer

pLDDT pTM Quality
84.39 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map