F429651

General Info

Members Datasets Scaffolds Average Seq Length
383 158 766 154

Family's Representative Sequence

Representative Sequence 3300037312|Ga0395899_0035751|Ga0395899_0035751_2431_2934
Length 167
Sequence MILDSRWTRAESHAMTTGPDALIEDLDRAVTEVLAYFAGPGRTSAARVDRWQARDVLQHFIYFHDATAWGIQSVALGGPPWPVPGDADTVNEVCRRLHEHESFDDLLAQVRLAHARLLRAARGSPDLDRPCFRRANGETMTGRQRLELLARHWREHVQELQAAEARG

Samples

Sample ID Description Type Environment
1 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
15 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
16 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
29 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
30 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
31 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
32 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
41 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
42 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
43 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
44 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
45 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
46 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
47 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
48 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
49 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
50 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
53 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
54 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
57 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
58 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
59 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
60 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
61 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
62 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
63 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
64 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
94 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
97 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
98 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
99 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
100 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
101 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
102 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
103 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
104 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
105 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
106 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
107 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
108 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
109 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
110 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
111 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
112 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
113 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
114 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
115 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
116 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
117 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
118 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
119 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
120 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
121 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
122 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
123 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
124 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
125 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
126 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
127 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
128 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
129 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
130 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
133 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
136 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
137 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
138 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
139 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
140 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
141 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
142 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
143 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
144 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
145 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
146 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
147 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
148 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
149 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
150 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
151 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
152 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
153 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
154 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
155 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
156 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
157 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
158 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.78
Rhizosphere 99.22
Stem 0
Stem Tuber 0
Unclassified 17.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395899_0035751 3300037312 Bacteria 3728
2 Ga0065707_10186561 3300005295 Bacteria 1382
3 Ga0070676_10289090 3300005328 Bacteria 1107
4 Ga0070690_100134939 3300005330 Unclassified 1670
5 Ga0070670_101051365 3300005331 Bacteria 741
6 Ga0070666_10486930 3300005335 Unclassified 893
7 Ga0070680_100084980 3300005336 Bacteria 2614
8 Ga0070689_100576707 3300005340 Bacteria 972
9 Ga0070692_10337528 3300005345 Bacteria 932
10 Ga0070668_100133328 3300005347 Bacteria 1995
11 Ga0070668_101440512 3300005347 Unclassified 629
12 Ga0070669_100413887 3300005353 Unclassified 1105
13 Ga0070659_101837260 3300005366 Bacteria 543
14 Ga0070667_100539720 3300005367 Unclassified 1071
15 Ga0070703_10093030 3300005406 Unclassified 1049
16 Ga0070701_10019891 3300005438 Bacteria 3177
17 Ga0070705_100037563 3300005440 Bacteria 2733
18 Ga0070705_100751622 3300005440 Bacteria 771
19 Ga0070700_100180476 3300005441 Unclassified 1469
20 Ga0070694_100069633 3300005444 Bacteria 2421
21 Ga0070694_100392598 3300005444 Bacteria 1084
22 Ga0070694_100491154 3300005444 Bacteria 975
23 Ga0070694_100716522 3300005444 Bacteria 815
24 Ga0070708_100023231 3300005445 Bacteria 5270
25 Ga0070708_100171848 3300005445 Unclassified 2024
26 Ga0070708_100575087 3300005445 Bacteria 1062
27 Ga0070708_100838026 3300005445 Bacteria 864
28 Ga0070662_100104923 3300005457 Bacteria 2145
29 Ga0070681_10021724 3300005458 Bacteria 6436
30 Ga0068867_101047634 3300005459 Bacteria 742
31 Ga0070706_100021292 3300005467 Bacteria 5972
32 Ga0070706_101125210 3300005467 Bacteria 723
33 Ga0070706_101282222 3300005467 Unclassified 672
34 Ga0070707_100011004 3300005468 Bacteria 8427
35 Ga0070707_100341306 3300005468 Unclassified 1455
36 Ga0070707_100352185 3300005468 Bacteria 1430
37 Ga0070707_100595048 3300005468 Bacteria 1068
38 Ga0070707_101898999 3300005468 Bacteria 563
39 Ga0070698_100012861 3300005471 Bacteria 8863
40 Ga0070698_100065311 3300005471 Bacteria 3664
41 Ga0070698_101464602 3300005471 Unclassified 634
42 Ga0070699_100015587 3300005518 Bacteria 6529
43 Ga0070699_100091617 3300005518 Bacteria 2658
44 Ga0070699_100117227 3300005518 Bacteria 2340
45 Ga0070699_100483572 3300005518 Bacteria 1124
46 Ga0070699_100597045 3300005518 Bacteria 1006
47 Ga0070697_100011502 3300005536 Bacteria 6918
48 Ga0070697_100174453 3300005536 Bacteria 1820
49 Ga0070697_100292216 3300005536 Bacteria 1400
50 Ga0070686_100700877 3300005544 Archaea 807
51 Ga0070695_100023595 3300005545 Bacteria 3783
52 Ga0070695_100072445 3300005545 Bacteria 2259
53 Ga0070695_100824885 3300005545 Unclassified 745
54 Ga0070696_100109048 3300005546 Bacteria 1992
55 Ga0070696_100121824 3300005546 Bacteria 1888
56 Ga0070696_100574417 3300005546 Unclassified 906
57 Ga0070693_100101821 3300005547 Bacteria 1751
58 Ga0070704_100159100 3300005549 Bacteria 1784
59 Ga0070704_100174227 3300005549 Bacteria 1714
60 Ga0070704_100269145 3300005549 Bacteria 1407
61 Ga0070704_100619638 3300005549 Bacteria 953
62 Ga0068857_100156479 3300005577 Bacteria 2067
63 Ga0070702_100177133 3300005615 Bacteria 1392
64 Ga0068864_101307219 3300005618 Bacteria 725
65 Ga0068866_10112797 3300005718 Bacteria 1520
66 Ga0068866_10506022 3300005718 Bacteria 800
67 Ga0068866_10784815 3300005718 Bacteria 661
68 Ga0068861_100375707 3300005719 Unclassified 1254
69 Ga0068861_100998849 3300005719 Bacteria 799
70 Ga0068863_100480461 3300005841 Unclassified 1222
71 Ga0068860_100017980 3300005843 Bacteria 6886
72 Ga0068860_100214531 3300005843 Bacteria 1867
73 Ga0068860_100375441 3300005843 Bacteria 1403
74 Ga0068862_100006587 3300005844 Bacteria 9629
75 Ga0068862_100188203 3300005844 Bacteria 1856
76 Ga0075428_100033360 3300006844 Bacteria 5685
77 Ga0075428_100051586 3300006844 Bacteria 4511
78 Ga0075428_100127397 3300006844 Bacteria 2770
79 Ga0075428_100473600 3300006844 Bacteria 1340
80 Ga0075428_100731876 3300006844 Unclassified 1053
81 Ga0075428_101001310 3300006844 Bacteria 885
82 Ga0075430_100001918 3300006846 Bacteria 17059
83 Ga0075430_100004256 3300006846 Bacteria 12089
84 Ga0075430_100013668 3300006846 Bacteria 6921
85 Ga0075431_100006917 3300006847 Bacteria 11276
86 Ga0075431_100043086 3300006847 Bacteria 4657
87 Ga0075431_100373470 3300006847 Bacteria 1431
88 Ga0075431_100395234 3300006847 Bacteria 1384
89 Ga0075431_101311914 3300006847 Unclassified 684
90 Ga0075433_10037077 3300006852 Bacteria 4203
91 Ga0075433_10039969 3300006852 Bacteria 4058
92 Ga0075433_10182577 3300006852 Bacteria 1867
93 Ga0075433_10182813 3300006852 Bacteria 1865
94 Ga0075433_10190670 3300006852 Bacteria 1823
95 Ga0075433_10227763 3300006852 Unclassified 1655
96 Ga0075433_10308156 3300006852 Bacteria 1402
97 Ga0075433_10400041 3300006852 Bacteria 1212
98 Ga0075433_10556903 3300006852 Unclassified 1008
99 Ga0075433_10630098 3300006852 Bacteria 941
100 Ga0075434_100014039 3300006871 Bacteria 7647
101 Ga0075434_100016007 3300006871 Bacteria 7206
102 Ga0075434_100055750 3300006871 Bacteria 3927
103 Ga0075434_100106007 3300006871 Bacteria 2820
104 Ga0075434_100109283 3300006871 Bacteria 2775
105 Ga0075434_100196158 3300006871 Bacteria 2039
106 Ga0075434_100343768 3300006871 Bacteria 1513
107 Ga0075434_100411311 3300006871 Bacteria 1374
108 Ga0075434_100645811 3300006871 Bacteria 1076
109 Ga0075434_101280734 3300006871 Bacteria 744
110 Ga0075434_101872052 3300006871 Unclassified 606
111 Ga0075429_100000257 3300006880 Bacteria 36802
112 Ga0075429_100010180 3300006880 Bacteria 8140
113 Ga0075429_100013909 3300006880 Bacteria 6977
114 Ga0075429_100032230 3300006880 Bacteria 4554
115 Ga0075429_100133824 3300006880 Bacteria 2169
116 Ga0075429_100163146 3300006880 Bacteria 1952
117 Ga0075429_100429588 3300006880 Bacteria 1157
118 Ga0075429_101469984 3300006880 Unclassified 593
119 Ga0075436_100016363 3300006914 Bacteria 5076
120 Ga0075436_100564241 3300006914 Bacteria 836
121 Ga0075436_100708877 3300006914 Unclassified 746
122 Ga0075435_100010928 3300007076 Bacteria 6653
123 Ga0075435_100010998 3300007076 Bacteria 6635
124 Ga0075435_100023698 3300007076 Bacteria 4751
125 Ga0075435_100076292 3300007076 Bacteria 2746
126 Ga0075435_100215454 3300007076 Bacteria 1630
127 Ga0075435_100362679 3300007076 Bacteria 1243
128 Ga0099794_10073175 3300007265 Bacteria 1681
129 Ga0111539_10004543 3300009094 Bacteria 18148
130 Ga0111539_10009180 3300009094 Bacteria 12502
131 Ga0111539_10138744 3300009094 Bacteria 2847
132 Ga0111539_10527558 3300009094 Bacteria 1376
133 Ga0111539_10874730 3300009094 Bacteria 1045
134 Ga0111539_11150357 3300009094 Bacteria 902
135 Ga0114129_10014072 3300009147 Bacteria 11399
136 Ga0114129_10021396 3300009147 Bacteria 9181
137 Ga0114129_10045839 3300009147 Bacteria 6145
138 Ga0114129_10062821 3300009147 Bacteria 5187
139 Ga0114129_10067729 3300009147 Bacteria 4978
140 Ga0114129_10087313 3300009147 Bacteria 4325
141 Ga0114129_10192858 3300009147 Bacteria 2765
142 Ga0114129_10347514 3300009147 Bacteria 1966
143 Ga0114129_10591212 3300009147 Bacteria 1439
144 Ga0105243_10128376 3300009148 Unclassified 2148
145 Ga0105241_10011529 3300009174 Bacteria 6480
146 Ga0105242_10303878 3300009176 Bacteria 1457
147 Ga0105242_10517126 3300009176 Unclassified 1138
148 Ga0105248_10255403 3300009177 Bacteria 1973
149 Ga0105249_10369042 3300009553 Unclassified 1458
150 Ga0105249_10415236 3300009553 Bacteria 1378
151 Ga0105249_13047753 3300009553 Unclassified 538
152 Ga0105239_11799998 3300010375 Bacteria 710
153 Ga0157378_10267062 3300013297 Unclassified 1644
154 Ga0157378_10560914 3300013297 Bacteria 1149
155 Ga0163162_10025404 3300013306 Bacteria 5852
156 Ga0163162_10395030 3300013306 Bacteria 1515
157 Ga0163162_11086685 3300013306 Bacteria 906
158 Ga0157375_10052640 3300013308 Bacteria 4003
159 Ga0157375_11099692 3300013308 Bacteria 930
160 Ga0163163_10285099 3300014325 Bacteria 1703
161 Ga0157380_10532443 3300014326 Unclassified 1148
162 Ga0157380_10870206 3300014326 Unclassified 925
163 Ga0157379_11422134 3300014968 Bacteria 673
164 Ga0207653_10086855 3300025885 Bacteria 1091
165 Ga0207642_10327108 3300025899 Bacteria 897
166 Ga0207680_10780253 3300025903 Unclassified 685
167 Ga0207645_10366427 3300025907 Bacteria 966
168 Ga0207684_10016657 3300025910 Bacteria 6311
169 Ga0207684_10033066 3300025910 Bacteria 4398
170 Ga0207684_10090777 3300025910 Bacteria 2603
171 Ga0207684_10320432 3300025910 Bacteria 1336
172 Ga0207654_10059617 3300025911 Unclassified 2227
173 Ga0207707_10027568 3300025912 Bacteria 4967
174 Ga0207660_10010207 3300025917 Bacteria 6086
175 Ga0207662_10317058 3300025918 Bacteria 1040
176 Ga0207657_10515591 3300025919 Bacteria 936
177 Ga0207646_10025603 3300025922 Bacteria 5396
178 Ga0207646_10029456 3300025922 Bacteria 4989
179 Ga0207646_10042850 3300025922 Bacteria 4066
180 Ga0207646_10545301 3300025922 Unclassified 1043
181 Ga0207681_10062694 3300025923 Bacteria 2561
182 Ga0207681_10402381 3300025923 Bacteria 1106
183 Ga0207706_10157280 3300025933 Bacteria 1998
184 Ga0207709_10345860 3300025935 Unclassified 1121
185 Ga0207709_10485222 3300025935 Bacteria 962
186 Ga0207670_10234212 3300025936 Bacteria 1412
187 Ga0207670_10956349 3300025936 Bacteria 719
188 Ga0207704_10617554 3300025938 Bacteria 889
189 Ga0207691_10038922 3300025940 Bacteria 4400
190 Ga0207712_10098066 3300025961 Bacteria 2173
191 Ga0207712_10552828 3300025961 Bacteria 990
192 Ga0207668_10155459 3300025972 Bacteria 1776
193 Ga0207668_10180671 3300025972 Bacteria 1664
194 Ga0207668_10919673 3300025972 Bacteria 779
195 Ga0207640_10456238 3300025981 Bacteria 1054
196 Ga0207703_10179161 3300026035 Bacteria 1869
197 Ga0207639_11824788 3300026041 Bacteria 569
198 Ga0207708_10520232 3300026075 Unclassified 1000
199 Ga0207641_10079666 3300026088 Bacteria 2840
200 Ga0207648_10373337 3300026089 Bacteria 1289
201 Ga0207648_10533435 3300026089 Bacteria 1076
202 Ga0207676_10050798 3300026095 Bacteria 3235
203 Ga0207674_10144483 3300026116 Bacteria 2338
204 Ga0207675_100361528 3300026118 Bacteria 1424
205 Ga0207675_100378140 3300026118 Bacteria 1392
206 Ga0207675_100844718 3300026118 Bacteria 930
207 Ga0207698_11473351 3300026142 Unclassified 696
208 Ga0207428_10000036 3300027907 Bacteria 223539
209 Ga0207428_10050232 3300027907 Bacteria 3338
210 Ga0207428_10074536 3300027907 Bacteria 2661
211 Ga0268265_10352519 3300028380 Bacteria 1344
212 Ga0268264_10045529 3300028381 Bacteria 3642
213 Ga0268264_10267857 3300028381 Bacteria 1595
214 Ga0268264_10478824 3300028381 Bacteria 1210
215 Ga0268264_10739493 3300028381 Unclassified 979
216 Ga0307408_100537428 3300031548 Bacteria 1029
217 Ga0307410_10200170 3300031852 Bacteria 1524
218 Ga0307406_10555104 3300031901 Bacteria 940
219 Ga0307412_10191380 3300031911 Bacteria 1547
220 Ga0307409_100067873 3300031995 Bacteria 2818
221 Ga0307416_100065186 3300032002 Bacteria 2992
222 Ga0307411_10531278 3300032005 Bacteria 1000
223 Ga0307411_10623833 3300032005 Bacteria 930
224 Ga0373959_0010762 3300034820 Bacteria 1605
225 Ga0373940_0191260 3300035088 Bacteria 669
226 Ga0373952_0036866 3300035092 Bacteria 1113
227 Ga0373932_0065126 3300035112 Bacteria 1117
228 Ga0373932_0146009 3300035112 Unclassified 808
229 Ga0373962_0054590 3300035242 Bacteria 1159
230 Ga0373931_0049695 3300035691 Bacteria 2229
231 Ga0373931_0054222 3300035691 Bacteria 2142
232 Ga0373931_0143329 3300035691 Bacteria 1386
233 Ga0395900_0058111 3300037418 Bacteria 3982
234 Ga0395900_0493127 3300037418 Bacteria 1176
235 Ga0395898_0010686 3300037466 Bacteria 9590
236 Ga0395898_0192089 3300037466 Bacteria 1951
237 Ga0395901_0206358 3300038443 Bacteria 2058
238 Ga0439460_0102511 3300042461 Unclassified 921
239 Ga0451577_0385563 3300042876 Bacteria 1272
240 Ga0451577_0875154 3300042876 Unclassified 810
241 Ga0451577_1258291 3300042876 Bacteria 659
242 Ga0451577_1647792 3300042876 Bacteria 565
243 Ga0453683_0109087 3300044673 Bacteria 1740
244 Ga0453683_0233549 3300044673 Bacteria 1171
245 Ga0453684_0907956 3300044712 Bacteria 943
246 Ga0451576_0141766 3300045051 Bacteria 2506
247 Ga0451576_0471362 3300045051 Bacteria 1318
248 Ga0451576_0900143 3300045051 Bacteria 928
249 Ga0451576_1169628 3300045051 Bacteria 804
250 Ga0495580_0001044 3300046472 Bacteria 24333
251 Ga0495585_0259279 3300046492 Bacteria 865
252 Ga0495642_0022493 3300046528 Bacteria 2485
253 Ga0495642_0033773 3300046528 Bacteria 2058
254 Ga0495609_0449669 3300046538 Unclassified 512
255 Ga0495633_0086073 3300046558 Unclassified 1462
256 Ga0495659_0071834 3300046664 Bacteria 1298
257 Ga0495659_0210927 3300046664 Bacteria 799
258 Ga0495659_0322268 3300046664 Unclassified 656
259 Ga0495669_0119108 3300046684 Bacteria 1236
260 Ga0495669_0260772 3300046684 Bacteria 833
261 Ga0495636_0113263 3300047318 Bacteria 1195
262 Ga0496102_0072524 3300048905 Bacteria 3164
263 Ga0496106_0286987 3300048909 Bacteria 1319
264 Ga0496106_0509706 3300048909 Bacteria 966
265 Ga0501036_0269954 3300049572 Unclassified 1424
266 Ga0501036_0735769 3300049572 Unclassified 814
267 Ga0501038_0481844 3300049574 Bacteria 951
268 Ga0501038_0766528 3300049574 Bacteria 719
269 Ga0501039_0065246 3300049575 Bacteria 2824
270 Ga0501039_0103913 3300049575 Bacteria 2218
271 Ga0501040_0121504 3300049576 Bacteria 1833
272 Ga0501040_0197481 3300049576 Bacteria 1428
273 Ga0501041_0189497 3300049577 Bacteria 1288
274 Ga0501041_0241933 3300049577 Bacteria 1134
275 Ga0501042_0192445 3300049578 Bacteria 1471
276 Ga0501043_0581693 3300049579 Bacteria 829
277 Ga0501048_0087573 3300049582 Bacteria 2197
278 Ga0501048_0550024 3300049582 Unclassified 828
279 Ga0501068_0424059 3300049584 Bacteria 859
280 Ga0501068_0771168 3300049584 Bacteria 630
281 Ga0501071_0029229 3300049587 Bacteria 3889
282 Ga0501071_0083797 3300049587 Bacteria 2336
283 Ga0501072_0022676 3300049588 Bacteria 4871
284 Ga0501072_0107235 3300049588 Unclassified 2222
285 Ga0501072_0178707 3300049588 Bacteria 1693
286 Ga0501072_1036447 3300049588 Bacteria 639
287 Ga0501074_0316633 3300049590 Bacteria 1108
288 Ga0501074_0572751 3300049590 Bacteria 799
289 Ga0501074_1257271 3300049590 Unclassified 519
290 Ga0501075_0017644 3300049591 Bacteria 5154
291 Ga0501075_0113328 3300049591 Bacteria 2062
292 Ga0501075_0325975 3300049591 Bacteria 1170
293 Ga0501075_0375316 3300049591 Unclassified 1084
294 Ga0501075_0822900 3300049591 Unclassified 706
295 Ga0501076_0047323 3300049592 Bacteria 3400
296 Ga0501076_0278804 3300049592 Bacteria 1369
297 Ga0501076_0661986 3300049592 Bacteria 862
298 Ga0501077_0117006 3300049593 Bacteria 1689
299 Ga0501077_0584549 3300049593 Unclassified 717
300 Ga0501079_0222043 3300049741 Bacteria 1476
301 Ga0501079_0289636 3300049741 Bacteria 1280
302 Ga0501079_0425643 3300049741 Unclassified 1042
303 Ga0501079_0469369 3300049741 Unclassified 989
304 Ga0501080_0371649 3300049742 Bacteria 1289
305 Ga0501080_0553499 3300049742 Bacteria 1024
306 Ga0501080_1133785 3300049742 Bacteria 674
307 Ga0501081_0049212 3300049743 Bacteria 2902
308 Ga0501081_0121404 3300049743 Bacteria 1862
309 Ga0501081_0218741 3300049743 Unclassified 1385
310 Ga0501081_0290286 3300049743 Unclassified 1198
311 Ga0501083_0179233 3300049744 Unclassified 1384
312 Ga0501083_0285805 3300049744 Bacteria 1073
313 Ga0501045_0030588 3300049824 Bacteria 3898
314 Ga0501045_0140435 3300049824 Bacteria 1796
315 Ga0501045_0511517 3300049824 Bacteria 892
316 nmdc:mga05p37_176721_c1 3300050507 Bacteria 2601
317 nmdc:mga05p37_1804546_c1 3300050507 Bacteria 590
318 nmdc:mga05p37_33387_c1 3300050507 Bacteria 6303
319 nmdc:mga05p37_3477_c1 3300050507 Bacteria 18407
320 nmdc:mga05p37_43717_c1 3300050507 Bacteria 5512
321 nmdc:mga05p37_476464_c1 3300050507 Bacteria 1439
322 nmdc:mga05p37_55143_c1 3300050507 Bacteria 4890
323 nmdc:mga05p37_69445_c1 3300050507 Bacteria 4334
324 nmdc:mga05p37_783_c1 3300050507 Bacteria 35363
325 nmdc:mga09592_1030630_c1 3300050508 Bacteria 687
326 nmdc:mga09592_38369_c1 3300050508 Bacteria 4021
327 nmdc:mga09592_48117_c1 3300050508 Bacteria 3595
328 nmdc:mga09592_5697_c1 3300050508 Bacteria 10163
329 nmdc:mga09592_73095_c1 3300050508 Bacteria 2913
330 nmdc:mga09592_926282_c1 3300050508 Unclassified 731
331 nmdc:mga0qj67_101839_c1 3300050509 Bacteria 2316
332 nmdc:mga0qj67_11550_c1 3300050509 Bacteria 6621
333 nmdc:mga0qj67_280055_c1 3300050509 Unclassified 1352
334 nmdc:mga0qj67_873804_c1 3300050509 Unclassified 709
335 nmdc:mga06r32_1261654_c1 3300050510 Bacteria 684
336 nmdc:mga06r32_149267_c1 3300050510 Bacteria 1877
337 nmdc:mga06r32_1728_c1 3300050510 Bacteria 19662
338 nmdc:mga06r32_413916_c1 3300050510 Unclassified 1330
339 nmdc:mga06r32_501116_c1 3300050510 Bacteria 1191
340 nmdc:mga08y16_174100_c1 3300050511 Bacteria 2235
341 nmdc:mga08y16_234214_c1 3300050511 Unclassified 1899
342 nmdc:mga08y16_487012_c1 3300050511 Bacteria 1254
343 nmdc:mga08y16_8391_c1 3300050511 Bacteria 10811
344 nmdc:mga0n895_124864_c1 3300050512 Bacteria 2597
345 nmdc:mga0n895_1453407_c1 3300050512 Unclassified 653
346 nmdc:mga0n895_162940_c1 3300050512 Bacteria 2261
347 nmdc:mga0n895_187780_c2 3300050512 Bacteria 1247
348 nmdc:mga0n895_198879_c1 3300050512 Bacteria 2036
349 nmdc:mga0n895_33246_c1 3300050512 Bacteria 4955
350 nmdc:mga0n895_407232_c1 3300050512 Bacteria 1375
351 nmdc:mga0n895_478575_c1 3300050512 Unclassified 1256
352 nmdc:mga0n895_67471_c1 3300050512 Bacteria 3543
353 nmdc:mga0n895_776040_c1 3300050512 Bacteria 950
354 nmdc:mga0n895_78012_c1 3300050512 Bacteria 3296
355 nmdc:mga0rr50_104097_c1 3300050513 Bacteria 2235
356 nmdc:mga0rr50_1046851_c1 3300050513 Bacteria 695
357 nmdc:mga0rr50_193740_c1 3300050513 Bacteria 1667
358 nmdc:mga0rr50_214587_c1 3300050513 Bacteria 1587
359 nmdc:mga0rr50_36764_c1 3300050513 Bacteria 3529
360 nmdc:mga0rr50_443119_c1 3300050513 Bacteria 1100
361 nmdc:mga0rr50_5427_c1 3300050513 Bacteria 7602
362 nmdc:mga08x19_154723_c1 3300050514 Bacteria 1554
363 nmdc:mga0a205_110809_c1 3300050515 Bacteria 2643
364 nmdc:mga0a205_119150_c1 3300050515 Bacteria 2538
365 nmdc:mga0a205_14767_c1 3300050515 Bacteria 6873
366 nmdc:mga0a205_167523_c1 3300050515 Bacteria 2093
367 nmdc:mga0a205_18844_c1 3300050515 Bacteria 1959
368 nmdc:mga0a205_19809_c1 3300050515 Bacteria 6348
369 nmdc:mga0a205_259376_c1 3300050515 Unclassified 1616
370 nmdc:mga0a205_28525_c1 3300050515 Bacteria 5338
371 nmdc:mga0a205_310815_c1 3300050515 Unclassified 1448
372 nmdc:mga0a205_647342_c1 3300050515 Bacteria 908
373 nmdc:mga0a205_830481_c1 3300050515 Bacteria 771
374 Ga0501084_0491531 3300054114 Bacteria 1037
375 Ga0501082_0515301 3300060353 Bacteria 1045
376 Ga0501082_0721472 3300060353 Bacteria 872
377 Ga0501082_0896935 3300060353 Unclassified 775
378 Ga0501082_1465206 3300060353 Bacteria 596
379 Ga0530510_0011785 3300061734 Bacteria 6134
380 Ga0530510_0013225 3300061734 Bacteria 5803
381 Ga0530510_0015262 3300061734 Bacteria 5425
382 Ga0530510_0496998 3300061734 Unclassified 924
383 Ga0530510_0740355 3300061734 Bacteria 750
384 Ga0395899_0035751
385 Ga0065707_10186561
386 Ga0070676_10289090
387 Ga0070690_100134939
388 Ga0070670_101051365
389 Ga0070666_10486930
390 Ga0070680_100084980
391 Ga0070689_100576707
392 Ga0070692_10337528
393 Ga0070668_100133328
394 Ga0070668_101440512
395 Ga0070669_100413887
396 Ga0070659_101837260
397 Ga0070667_100539720
398 Ga0070703_10093030
399 Ga0070701_10019891
400 Ga0070705_100037563
401 Ga0070705_100751622
402 Ga0070700_100180476
403 Ga0070694_100069633
404 Ga0070694_100392598
405 Ga0070694_100491154
406 Ga0070694_100716522
407 Ga0070708_100023231
408 Ga0070708_100171848
409 Ga0070708_100575087
410 Ga0070708_100838026
411 Ga0070662_100104923
412 Ga0070681_10021724
413 Ga0068867_101047634
414 Ga0070706_100021292
415 Ga0070706_101125210
416 Ga0070706_101282222
417 Ga0070707_100011004
418 Ga0070707_100341306
419 Ga0070707_100352185
420 Ga0070707_100595048
421 Ga0070707_101898999
422 Ga0070698_100012861
423 Ga0070698_100065311
424 Ga0070698_101464602
425 Ga0070699_100015587
426 Ga0070699_100091617
427 Ga0070699_100117227
428 Ga0070699_100483572
429 Ga0070699_100597045
430 Ga0070697_100011502
431 Ga0070697_100174453
432 Ga0070697_100292216
433 Ga0070686_100700877
434 Ga0070695_100023595
435 Ga0070695_100072445
436 Ga0070695_100824885
437 Ga0070696_100109048
438 Ga0070696_100121824
439 Ga0070696_100574417
440 Ga0070693_100101821
441 Ga0070704_100159100
442 Ga0070704_100174227
443 Ga0070704_100269145
444 Ga0070704_100619638
445 Ga0068857_100156479
446 Ga0070702_100177133
447 Ga0068864_101307219
448 Ga0068866_10112797
449 Ga0068866_10506022
450 Ga0068866_10784815
451 Ga0068861_100375707
452 Ga0068861_100998849
453 Ga0068863_100480461
454 Ga0068860_100017980
455 Ga0068860_100214531
456 Ga0068860_100375441
457 Ga0068862_100006587
458 Ga0068862_100188203
459 Ga0075428_100033360
460 Ga0075428_100051586
461 Ga0075428_100127397
462 Ga0075428_100473600
463 Ga0075428_100731876
464 Ga0075428_101001310
465 Ga0075430_100001918
466 Ga0075430_100004256
467 Ga0075430_100013668
468 Ga0075431_100006917
469 Ga0075431_100043086
470 Ga0075431_100373470
471 Ga0075431_100395234
472 Ga0075431_101311914
473 Ga0075433_10037077
474 Ga0075433_10039969
475 Ga0075433_10182577
476 Ga0075433_10182813
477 Ga0075433_10190670
478 Ga0075433_10227763
479 Ga0075433_10308156
480 Ga0075433_10400041
481 Ga0075433_10556903
482 Ga0075433_10630098
483 Ga0075434_100014039
484 Ga0075434_100016007
485 Ga0075434_100055750
486 Ga0075434_100106007
487 Ga0075434_100109283
488 Ga0075434_100196158
489 Ga0075434_100343768
490 Ga0075434_100411311
491 Ga0075434_100645811
492 Ga0075434_101280734
493 Ga0075434_101872052
494 Ga0075429_100000257
495 Ga0075429_100010180
496 Ga0075429_100013909
497 Ga0075429_100032230
498 Ga0075429_100133824
499 Ga0075429_100163146
500 Ga0075429_100429588
501 Ga0075429_101469984
502 Ga0075436_100016363
503 Ga0075436_100564241
504 Ga0075436_100708877
505 Ga0075435_100010928
506 Ga0075435_100010998
507 Ga0075435_100023698
508 Ga0075435_100076292
509 Ga0075435_100215454
510 Ga0075435_100362679
511 Ga0099794_10073175
512 Ga0111539_10004543
513 Ga0111539_10009180
514 Ga0111539_10138744
515 Ga0111539_10527558
516 Ga0111539_10874730
517 Ga0111539_11150357
518 Ga0114129_10014072
519 Ga0114129_10021396
520 Ga0114129_10045839
521 Ga0114129_10062821
522 Ga0114129_10067729
523 Ga0114129_10087313
524 Ga0114129_10192858
525 Ga0114129_10347514
526 Ga0114129_10591212
527 Ga0105243_10128376
528 Ga0105241_10011529
529 Ga0105242_10303878
530 Ga0105242_10517126
531 Ga0105248_10255403
532 Ga0105249_10369042
533 Ga0105249_10415236
534 Ga0105249_13047753
535 Ga0105239_11799998
536 Ga0157378_10267062
537 Ga0157378_10560914
538 Ga0163162_10025404
539 Ga0163162_10395030
540 Ga0163162_11086685
541 Ga0157375_10052640
542 Ga0157375_11099692
543 Ga0163163_10285099
544 Ga0157380_10532443
545 Ga0157380_10870206
546 Ga0157379_11422134
547 Ga0207653_10086855
548 Ga0207642_10327108
549 Ga0207680_10780253
550 Ga0207645_10366427
551 Ga0207684_10016657
552 Ga0207684_10033066
553 Ga0207684_10090777
554 Ga0207684_10320432
555 Ga0207654_10059617
556 Ga0207707_10027568
557 Ga0207660_10010207
558 Ga0207662_10317058
559 Ga0207657_10515591
560 Ga0207646_10025603
561 Ga0207646_10029456
562 Ga0207646_10042850
563 Ga0207646_10545301
564 Ga0207681_10062694
565 Ga0207681_10402381
566 Ga0207706_10157280
567 Ga0207709_10345860
568 Ga0207709_10485222
569 Ga0207670_10234212
570 Ga0207670_10956349
571 Ga0207704_10617554
572 Ga0207691_10038922
573 Ga0207712_10098066
574 Ga0207712_10552828
575 Ga0207668_10155459
576 Ga0207668_10180671
577 Ga0207668_10919673
578 Ga0207640_10456238
579 Ga0207703_10179161
580 Ga0207639_11824788
581 Ga0207708_10520232
582 Ga0207641_10079666
583 Ga0207648_10373337
584 Ga0207648_10533435
585 Ga0207676_10050798
586 Ga0207674_10144483
587 Ga0207675_100361528
588 Ga0207675_100378140
589 Ga0207675_100844718
590 Ga0207698_11473351
591 Ga0207428_10000036
592 Ga0207428_10050232
593 Ga0207428_10074536
594 Ga0268265_10352519
595 Ga0268264_10045529
596 Ga0268264_10267857
597 Ga0268264_10478824
598 Ga0268264_10739493
599 Ga0307408_100537428
600 Ga0307410_10200170
601 Ga0307406_10555104
602 Ga0307412_10191380
603 Ga0307409_100067873
604 Ga0307416_100065186
605 Ga0307411_10531278
606 Ga0307411_10623833
607 Ga0373959_0010762
608 Ga0373940_0191260
609 Ga0373952_0036866
610 Ga0373932_0065126
611 Ga0373932_0146009
612 Ga0373962_0054590
613 Ga0373931_0049695
614 Ga0373931_0054222
615 Ga0373931_0143329
616 Ga0395900_0058111
617 Ga0395900_0493127
618 Ga0395898_0010686
619 Ga0395898_0192089
620 Ga0395901_0206358
621 Ga0439460_0102511
622 Ga0451577_0385563
623 Ga0451577_0875154
624 Ga0451577_1258291
625 Ga0451577_1647792
626 Ga0453683_0109087
627 Ga0453683_0233549
628 Ga0453684_0907956
629 Ga0451576_0141766
630 Ga0451576_0471362
631 Ga0451576_0900143
632 Ga0451576_1169628
633 Ga0495580_0001044
634 Ga0495585_0259279
635 Ga0495642_0022493
636 Ga0495642_0033773
637 Ga0495609_0449669
638 Ga0495633_0086073
639 Ga0495659_0071834
640 Ga0495659_0210927
641 Ga0495659_0322268
642 Ga0495669_0119108
643 Ga0495669_0260772
644 Ga0495636_0113263
645 Ga0496102_0072524
646 Ga0496106_0286987
647 Ga0496106_0509706
648 Ga0501036_0269954
649 Ga0501036_0735769
650 Ga0501038_0481844
651 Ga0501038_0766528
652 Ga0501039_0065246
653 Ga0501039_0103913
654 Ga0501040_0121504
655 Ga0501040_0197481
656 Ga0501041_0189497
657 Ga0501041_0241933
658 Ga0501042_0192445
659 Ga0501043_0581693
660 Ga0501048_0087573
661 Ga0501048_0550024
662 Ga0501068_0424059
663 Ga0501068_0771168
664 Ga0501071_0029229
665 Ga0501071_0083797
666 Ga0501072_0022676
667 Ga0501072_0107235
668 Ga0501072_0178707
669 Ga0501072_1036447
670 Ga0501074_0316633
671 Ga0501074_0572751
672 Ga0501074_1257271
673 Ga0501075_0017644
674 Ga0501075_0113328
675 Ga0501075_0325975
676 Ga0501075_0375316
677 Ga0501075_0822900
678 Ga0501076_0047323
679 Ga0501076_0278804
680 Ga0501076_0661986
681 Ga0501077_0117006
682 Ga0501077_0584549
683 Ga0501079_0222043
684 Ga0501079_0289636
685 Ga0501079_0425643
686 Ga0501079_0469369
687 Ga0501080_0371649
688 Ga0501080_0553499
689 Ga0501080_1133785
690 Ga0501081_0049212
691 Ga0501081_0121404
692 Ga0501081_0218741
693 Ga0501081_0290286
694 Ga0501083_0179233
695 Ga0501083_0285805
696 Ga0501045_0030588
697 Ga0501045_0140435
698 Ga0501045_0511517
699 nmdc:mga05p37_176721_c1
700 nmdc:mga05p37_1804546_c1
701 nmdc:mga05p37_33387_c1
702 nmdc:mga05p37_3477_c1
703 nmdc:mga05p37_43717_c1
704 nmdc:mga05p37_476464_c1
705 nmdc:mga05p37_55143_c1
706 nmdc:mga05p37_69445_c1
707 nmdc:mga05p37_783_c1
708 nmdc:mga09592_1030630_c1
709 nmdc:mga09592_38369_c1
710 nmdc:mga09592_48117_c1
711 nmdc:mga09592_5697_c1
712 nmdc:mga09592_73095_c1
713 nmdc:mga09592_926282_c1
714 nmdc:mga0qj67_101839_c1
715 nmdc:mga0qj67_11550_c1
716 nmdc:mga0qj67_280055_c1
717 nmdc:mga0qj67_873804_c1
718 nmdc:mga06r32_1261654_c1
719 nmdc:mga06r32_149267_c1
720 nmdc:mga06r32_1728_c1
721 nmdc:mga06r32_413916_c1
722 nmdc:mga06r32_501116_c1
723 nmdc:mga08y16_174100_c1
724 nmdc:mga08y16_234214_c1
725 nmdc:mga08y16_487012_c1
726 nmdc:mga08y16_8391_c1
727 nmdc:mga0n895_124864_c1
728 nmdc:mga0n895_1453407_c1
729 nmdc:mga0n895_162940_c1
730 nmdc:mga0n895_187780_c2
731 nmdc:mga0n895_198879_c1
732 nmdc:mga0n895_33246_c1
733 nmdc:mga0n895_407232_c1
734 nmdc:mga0n895_478575_c1
735 nmdc:mga0n895_67471_c1
736 nmdc:mga0n895_776040_c1
737 nmdc:mga0n895_78012_c1
738 nmdc:mga0rr50_104097_c1
739 nmdc:mga0rr50_1046851_c1
740 nmdc:mga0rr50_193740_c1
741 nmdc:mga0rr50_214587_c1
742 nmdc:mga0rr50_36764_c1
743 nmdc:mga0rr50_443119_c1
744 nmdc:mga0rr50_5427_c1
745 nmdc:mga08x19_154723_c1
746 nmdc:mga0a205_110809_c1
747 nmdc:mga0a205_119150_c1
748 nmdc:mga0a205_14767_c1
749 nmdc:mga0a205_167523_c1
750 nmdc:mga0a205_18844_c1
751 nmdc:mga0a205_19809_c1
752 nmdc:mga0a205_259376_c1
753 nmdc:mga0a205_28525_c1
754 nmdc:mga0a205_310815_c1
755 nmdc:mga0a205_647342_c1
756 nmdc:mga0a205_830481_c1
757 Ga0501084_0491531
758 Ga0501082_0515301
759 Ga0501082_0721472
760 Ga0501082_0896935
761 Ga0501082_1465206
762 Ga0530510_0011785
763 Ga0530510_0013225
764 Ga0530510_0015262
765 Ga0530510_0496998
766 Ga0530510_0740355

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
2yqy-assembly2.cif.gz_B crystal structure of tt2238, a four-helix bundle protein 0.8323 8 149
2yqy-assembly1.cif.gz_A crystal structure of tt2238, a four-helix bundle protein 0.8044 7 150
2nsg-assembly1.cif.gz_A crystal structure of the mycothiol-dependent maleylpyruvate isomerase h52a mutant 0.804 7 148
2yqy-assembly2.cif.gz_B crystal structure of tt2238, a four-helix bundle protein 0.7958 8 149
1rxq-assembly1.cif.gz_B yfit from bacillus subtilis is a probable metal-dependent hydrolase with an unusual four-helix bundle topology 0.7907 7 155
ID Description Score Start End Superfamily
2yqyB00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.8323 8 149 1.20.120.450
2nsgA01 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.804 7 148 1.20.120.450
2yqyB00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7958 8 149 1.20.120.450
1rxqD00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7874 5 154 1.20.120.450
5cogA00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.77 7 150 1.20.120.450
ID Description Score Start End GO Terms
AF-A0A2V6RAG3-F1-model_v4 DinB-like domain-containing protein 0.9914 18 152
AF-A0A2V6RAG3-F1-model_v4 DinB-like domain-containing protein 0.9562 18 152
AF-A0A2V7CA89-F1-model_v4 DinB-like domain-containing protein 0.9515 10 153
AF-A0A1Q7Y5R9-F1-model_v4 DinB-like domain-containing protein 0.9384 45 153
AF-A0A2V6PUK3-F1-model_v4 Mycothiol-dependent maleylpyruvate isomerase metal-binding domain-containing protein 0.9377 8 112

Map