F429642

General Info

Members Datasets Scaffolds Average Seq Length
383 215 766 368

Family's Representative Sequence

Representative Sequence 3300031901|Ga0307406_10113195|Ga0307406_101131952
Length 397
Sequence MSTTLTTTPAADGFRMPGEFEQHSGCWLLWPERPTNWRNGAKPAQAAFAAVATAIATGEPVTVGASRAQFVHARSMLPDAIRVVEMSSDDSWMRDVGPTFVVDEQRAVRGVDWMFNAWGGLNDGLYFPWDQDDLVARKVLEIEGRDRYRAPFVLEGGAIHVDGEGTLITTEECLLNPNRNPHMDTGQLEIMLHEYLGISSVIWLGKGVIDDETDGHVDNLCCFARPGEVVLTWTDNKRDPQYRVSHDAYERLMGARDAKGRRLKVHKLQQPGPLYRTREEAQDIDTVDGRTPRPAGERLAGSYVNFYIANSTVVVPLLDSRHDRQALRTLTRIFPDRRVIGVQAREILLGGGNIHCITQQVPVGGAVGRPLQRILRPRHSRIRAQQASARQSPRKRK

Samples

Sample ID Description Type Environment
1 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
31 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
32 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
45 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
46 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
47 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
50 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
51 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
52 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
53 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
60 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
61 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
65 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
66 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
67 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
70 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
71 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
78 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
79 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
120 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
124 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
125 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
126 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
127 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
128 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
129 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
130 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
131 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
132 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
133 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
134 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
135 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
136 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
137 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
138 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
139 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
140 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
141 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
142 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
143 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
144 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
145 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
146 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
147 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
148 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
149 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
150 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
151 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
152 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
153 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
154 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
155 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
156 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
157 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
158 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
159 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
160 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
161 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
162 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
163 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
164 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
165 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
166 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
167 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
168 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
169 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
170 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
171 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
172 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
173 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
174 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
175 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
176 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
177 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
178 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
179 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
180 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
181 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
182 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
183 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
184 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
185 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
186 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
187 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
188 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
189 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
190 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
191 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
192 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
193 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
194 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
195 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
198 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
199 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
200 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
201 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
202 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
203 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
204 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
205 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
206 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
207 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
208 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
209 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
210 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
211 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
212 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
213 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
214 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
215 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.09
Nodule 0
Rhizoplane 4.44
Rhizosphere 90.34
Stem 0
Stem Tuber 0
Unclassified 0.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307406_10113195 3300031901 Bacteria 1872
2 Ga0070683_100015317 3300005329 Bacteria 6731
3 Ga0070670_100080806 3300005331 Bacteria 2794
4 Ga0068869_100319698 3300005334 Bacteria 1258
5 Ga0070680_100006601 3300005336 Bacteria 8824
6 Ga0070680_100122577 3300005336 Unclassified 2171
7 Ga0070682_100080652 3300005337 Bacteria 2105
8 Ga0070682_100095617 3300005337 Bacteria 1951
9 Ga0070689_100026289 3300005340 Bacteria 4381
10 Ga0070687_100117050 3300005343 Bacteria 1518
11 Ga0070661_100038019 3300005344 Bacteria 3503
12 Ga0070668_100002653 3300005347 Bacteria 13144
13 Ga0070669_100004285 3300005353 Bacteria 10306
14 Ga0070675_100005946 3300005354 Bacteria 9348
15 Ga0070675_100014786 3300005354 Bacteria 6159
16 Ga0070674_100004156 3300005356 Bacteria 8224
17 Ga0070674_100126043 3300005356 Bacteria 1902
18 Ga0070673_100016489 3300005364 Bacteria 5226
19 Ga0070673_100037319 3300005364 Bacteria 3701
20 Ga0070673_100285544 3300005364 Bacteria 1449
21 Ga0070688_100069636 3300005365 Bacteria 2247
22 Ga0070688_100115955 3300005365 Bacteria 1788
23 Ga0070667_100011914 3300005367 Bacteria 7194
24 Ga0070709_10001515 3300005434 Bacteria 12560
25 Ga0070713_100002396 3300005436 Bacteria 12225
26 Ga0070713_100114743 3300005436 Bacteria 2354
27 Ga0070701_10019543 3300005438 Bacteria 3200
28 Ga0070701_10054949 3300005438 Bacteria 2078
29 Ga0070711_100001509 3300005439 Bacteria 12810
30 Ga0070705_100003374 3300005440 Bacteria 7836
31 Ga0070700_100010744 3300005441 Bacteria 5058
32 Ga0070700_100075908 3300005441 Bacteria 2157
33 Ga0070700_100119940 3300005441 Bacteria 1761
34 Ga0070662_100005349 3300005457 Bacteria 8202
35 Ga0070681_10004146 3300005458 Bacteria 13709
36 Ga0070681_10011407 3300005458 Bacteria 8795
37 Ga0070681_10012124 3300005458 Bacteria 8550
38 Ga0070681_10052414 3300005458 Bacteria 4069
39 Ga0070681_10235822 3300005458 Bacteria 1743
40 Ga0068867_100005928 3300005459 Bacteria 8667
41 Ga0070685_10019600 3300005466 Bacteria 3652
42 Ga0070685_10039372 3300005466 Bacteria 2685
43 Ga0070699_100019215 3300005518 Bacteria 5880
44 Ga0070679_100000469 3300005530 Bacteria 34407
45 Ga0070679_100173233 3300005530 Bacteria 2130
46 Ga0070679_100203854 3300005530 Bacteria 1943
47 Ga0070672_100025188 3300005543 Bacteria 4410
48 Ga0070672_100050595 3300005543 Bacteria 3237
49 Ga0070686_100042380 3300005544 Bacteria 2851
50 Ga0070695_100006910 3300005545 Bacteria 6721
51 Ga0070695_100080765 3300005545 Bacteria 2150
52 Ga0070693_100123608 3300005547 Bacteria 1608
53 Ga0070665_100000543 3300005548 Bacteria 52995
54 Ga0070665_100002122 3300005548 Bacteria 22146
55 Ga0070665_100004302 3300005548 Bacteria 14969
56 Ga0070665_100068137 3300005548 Bacteria 3568
57 Ga0068855_100001265 3300005563 Bacteria 31339
58 Ga0068855_100001482 3300005563 Bacteria 29366
59 Ga0068855_100046836 3300005563 Bacteria 5110
60 Ga0068857_100209595 3300005577 Bacteria 1778
61 Ga0068856_100278557 3300005614 Bacteria 1689
62 Ga0068859_100033918 3300005617 Bacteria 5124
63 Ga0068864_100034786 3300005618 Bacteria 4287
64 Ga0068864_100035431 3300005618 Bacteria 4249
65 Ga0068864_100069909 3300005618 Bacteria 3053
66 Ga0068861_100001900 3300005719 Bacteria 13448
67 Ga0068861_100018217 3300005719 Bacteria 4998
68 Ga0068861_100072599 3300005719 Bacteria 2671
69 Ga0068870_10049658 3300005840 Bacteria 2214
70 Ga0068870_10067047 3300005840 Bacteria 1946
71 Ga0068863_100003132 3300005841 Bacteria 16330
72 Ga0068863_100063307 3300005841 Bacteria 3498
73 Ga0068863_100072659 3300005841 Bacteria 3254
74 Ga0068860_100031928 3300005843 Bacteria 5062
75 Ga0068862_100001355 3300005844 Bacteria 22778
76 Ga0068862_100016909 3300005844 Bacteria 6071
77 Ga0068862_100092470 3300005844 Bacteria 2636
78 Ga0068862_100094067 3300005844 Bacteria 2614
79 Ga0068862_100374984 3300005844 Bacteria 1325
80 Ga0081455_10000505 3300005937 Bacteria 50605
81 Ga0081455_10016045 3300005937 Bacteria 7246
82 Ga0070715_10000427 3300006163 Bacteria 10763
83 Ga0070715_10073984 3300006163 Bacteria 1529
84 Ga0070715_10101536 3300006163 Bacteria 1342
85 Ga0070716_100005250 3300006173 Bacteria 6261
86 Ga0070716_100009916 3300006173 Bacteria 4763
87 Ga0070712_100051841 3300006175 Bacteria 2859
88 Ga0097621_100021367 3300006237 Bacteria 5005
89 Ga0068871_100022932 3300006358 Bacteria 4819
90 Ga0068871_100095572 3300006358 Bacteria 2481
91 Ga0075428_100003329 3300006844 Bacteria 17579
92 Ga0075428_100051848 3300006844 Bacteria 4500
93 Ga0075430_100103132 3300006846 Bacteria 2381
94 Ga0075430_100198317 3300006846 Bacteria 1667
95 Ga0075430_100209129 3300006846 Bacteria 1619
96 Ga0075431_100000034 3300006847 Bacteria 71256
97 Ga0075431_100000229 3300006847 Bacteria 41916
98 Ga0075431_100082739 3300006847 Bacteria 3314
99 Ga0075429_100000568 3300006880 Bacteria 28317
100 Ga0075429_100011274 3300006880 Bacteria 7738
101 Ga0075429_100061795 3300006880 Bacteria 3263
102 Ga0068865_100022573 3300006881 Bacteria 4107
103 Ga0068865_100036049 3300006881 Bacteria 3332
104 Ga0068865_100302160 3300006881 Bacteria 1281
105 Ga0075436_100059020 3300006914 Bacteria 2650
106 Ga0097620_100033918 3300006931 Bacteria 5124
107 Ga0105240_10002705 3300009093 Bacteria 28172
108 Ga0105240_10003826 3300009093 Bacteria 23268
109 Ga0105240_10010161 3300009093 Bacteria 13252
110 Ga0105240_10015135 3300009093 Bacteria 10497
111 Ga0105240_10037149 3300009093 Bacteria 6260
112 Ga0105240_10052537 3300009093 Bacteria 5122
113 Ga0105240_10077876 3300009093 Bacteria 4084
114 Ga0105240_10103435 3300009093 Bacteria 3460
115 Ga0111539_10003802 3300009094 Bacteria 19857
116 Ga0111539_10033443 3300009094 Bacteria 6241
117 Ga0111539_10075525 3300009094 Bacteria 3970
118 Ga0111539_10119951 3300009094 Bacteria 3081
119 Ga0105245_10050385 3300009098 Bacteria 3732
120 Ga0105247_10001703 3300009101 Bacteria 15517
121 Ga0105247_10141567 3300009101 Bacteria 1576
122 Ga0114129_10001159 3300009147 Bacteria 34920
123 Ga0114129_10038881 3300009147 Bacteria 6707
124 Ga0105242_10004535 3300009176 Bacteria 10778
125 Ga0105248_10104320 3300009177 Bacteria 3196
126 Ga0105237_10047387 3300009545 Bacteria 4321
127 Ga0105237_10168733 3300009545 Bacteria 2188
128 Ga0105237_10454487 3300009545 Unclassified 1287
129 Ga0105237_10551980 3300009545 Bacteria 1159
130 Ga0105238_10004689 3300009551 Bacteria 13522
131 Ga0105238_10008320 3300009551 Bacteria 10374
132 Ga0105238_10049908 3300009551 Bacteria 4213
133 Ga0105249_10005519 3300009553 Bacteria 10923
134 Ga0099796_10002205 3300010159 Bacteria 4218
135 Ga0105239_10028955 3300010375 Bacteria 6088
136 Ga0105239_10091988 3300010375 Bacteria 3347
137 Ga0157370_10001472 3300013104 Bacteria 29117
138 Ga0157369_10123287 3300013105 Bacteria 2749
139 Ga0157369_10182187 3300013105 Bacteria 2210
140 Ga0157374_10232382 3300013296 Bacteria 1812
141 Ga0157378_10002553 3300013297 Bacteria 16198
142 Ga0163162_10055198 3300013306 Bacteria 3998
143 Ga0157372_10164749 3300013307 Unclassified 2563
144 Ga0157372_10240366 3300013307 Bacteria 2101
145 Ga0157375_10381270 3300013308 Bacteria 1577
146 Ga0163163_10038150 3300014325 Bacteria 4679
147 Ga0163163_10130464 3300014325 Bacteria 2553
148 Ga0163163_10228312 3300014325 Bacteria 1910
149 Ga0157380_10007167 3300014326 Bacteria 7902
150 Ga0157380_10140666 3300014326 Bacteria 2073
151 Ga0157376_10485288 3300014969 Bacteria 1212
152 Ga0207642_10074772 3300025899 Bacteria 1625
153 Ga0207710_10088388 3300025900 Bacteria 1447
154 Ga0207680_10040372 3300025903 Bacteria 2715
155 Ga0207645_10001809 3300025907 Bacteria 17262
156 Ga0207645_10038178 3300025907 Bacteria 3080
157 Ga0207643_10055398 3300025908 Bacteria 2255
158 Ga0207643_10075135 3300025908 Bacteria 1950
159 Ga0207643_10177032 3300025908 Bacteria 1289
160 Ga0207654_10023535 3300025911 Bacteria 3301
161 Ga0207707_10000122 3300025912 Bacteria 80159
162 Ga0207707_10007353 3300025912 Bacteria 9593
163 Ga0207707_10023503 3300025912 Bacteria 5391
164 Ga0207707_10101927 3300025912 Bacteria 2509
165 Ga0207695_10007798 3300025913 Bacteria 13552
166 Ga0207695_10015705 3300025913 Bacteria 8903
167 Ga0207695_10027453 3300025913 Bacteria 6338
168 Ga0207695_10043384 3300025913 Bacteria 4793
169 Ga0207695_10049172 3300025913 Bacteria 4447
170 Ga0207695_10061567 3300025913 Bacteria 3878
171 Ga0207695_10074948 3300025913 Bacteria 3444
172 Ga0207695_10079086 3300025913 Bacteria 3334
173 Ga0207671_10076421 3300025914 Bacteria 2506
174 Ga0207693_10000083 3300025915 Bacteria 84611
175 Ga0207693_10078718 3300025915 Bacteria 2580
176 Ga0207663_10044804 3300025916 Bacteria 2717
177 Ga0207660_10003018 3300025917 Bacteria 11014
178 Ga0207660_10015021 3300025917 Bacteria 5104
179 Ga0207660_10024488 3300025917 Bacteria 4088
180 Ga0207649_10135438 3300025920 Bacteria 1679
181 Ga0207652_10001479 3300025921 Bacteria 20778
182 Ga0207652_10159879 3300025921 Bacteria 2019
183 Ga0207652_10183524 3300025921 Bacteria 1881
184 Ga0207681_10007576 3300025923 Bacteria 6651
185 Ga0207681_10117044 3300025923 Bacteria 1948
186 Ga0207694_10189692 3300025924 Bacteria 1669
187 Ga0207694_10235816 3300025924 Bacteria 1494
188 Ga0207659_10076541 3300025926 Bacteria 2460
189 Ga0207659_10172222 3300025926 Bacteria 1708
190 Ga0207700_10008992 3300025928 Bacteria 6218
191 Ga0207706_10002686 3300025933 Bacteria 17342
192 Ga0207706_10006328 3300025933 Bacteria 10997
193 Ga0207670_10020258 3300025936 Bacteria 4083
194 Ga0207670_10152713 3300025936 Bacteria 1715
195 Ga0207669_10027831 3300025937 Bacteria 3101
196 Ga0207669_10028204 3300025937 Bacteria 3085
197 Ga0207669_10073830 3300025937 Bacteria 2154
198 Ga0207665_10003213 3300025939 Bacteria 10954
199 Ga0207665_10017571 3300025939 Bacteria 4701
200 Ga0207691_10017327 3300025940 Bacteria 6832
201 Ga0207691_10066007 3300025940 Bacteria 3274
202 Ga0207691_10134248 3300025940 Bacteria 2185
203 Ga0207711_10147510 3300025941 Bacteria 2120
204 Ga0207661_10172223 3300025944 Bacteria 1885
205 Ga0207679_10074625 3300025945 Bacteria 2570
206 Ga0207679_10078862 3300025945 Bacteria 2510
207 Ga0207667_10000798 3300025949 Bacteria 40876
208 Ga0207667_10003882 3300025949 Bacteria 18383
209 Ga0207667_10031650 3300025949 Bacteria 5709
210 Ga0207712_10008038 3300025961 Bacteria 6672
211 Ga0207712_10026140 3300025961 Bacteria 3886
212 Ga0207668_10033325 3300025972 Bacteria 3411
213 Ga0207668_10161134 3300025972 Bacteria 1748
214 Ga0207677_10040379 3300026023 Bacteria 3075
215 Ga0207708_10012325 3300026075 Bacteria 6371
216 Ga0207708_10071432 3300026075 Bacteria 2659
217 Ga0207708_10141917 3300026075 Bacteria 1885
218 Ga0207702_10026935 3300026078 Bacteria 4774
219 Ga0207702_10176556 3300026078 Bacteria 1963
220 Ga0207641_10020047 3300026088 Bacteria 5491
221 Ga0207641_10414208 3300026088 Bacteria 1296
222 Ga0207648_10046667 3300026089 Bacteria 3798
223 Ga0207648_10115301 3300026089 Bacteria 2361
224 Ga0207648_10158667 3300026089 Bacteria 1997
225 Ga0207676_10017726 3300026095 Bacteria 5166
226 Ga0207676_10022537 3300026095 Bacteria 4632
227 Ga0207676_10264895 3300026095 Bacteria 1553
228 Ga0207674_10088484 3300026116 Bacteria 3090
229 Ga0207674_10276339 3300026116 Bacteria 1628
230 Ga0207675_100000283 3300026118 Bacteria 48835
231 Ga0207675_100015006 3300026118 Bacteria 7230
232 Ga0207675_100030670 3300026118 Bacteria 5008
233 Ga0207675_100050977 3300026118 Bacteria 3862
234 Ga0207675_100151112 3300026118 Bacteria 2210
235 Ga0207683_10013626 3300026121 Bacteria 6935
236 Ga0209971_1000182 3300027682 Bacteria 18762
237 Ga0209998_10003364 3300027717 Bacteria 3509
238 Ga0207428_10059346 3300027907 Bacteria 3034
239 Ga0207428_10086605 3300027907 Bacteria 2438
240 Ga0268266_10001602 3300028379 Bacteria 26388
241 Ga0268266_10014064 3300028379 Bacteria 6888
242 Ga0268266_10114422 3300028379 Bacteria 2394
243 Ga0268265_10000265 3300028380 Bacteria 59618
244 Ga0268265_10022202 3300028380 Bacteria 4456
245 Ga0268265_10111600 3300028380 Bacteria 2233
246 Ga0268265_10229722 3300028380 Bacteria 1630
247 Ga0268264_10024412 3300028381 Bacteria 4935
248 Ga0268264_10101811 3300028381 Bacteria 2498
249 Ga0268264_10136884 3300028381 Bacteria 2178
250 Ga0307515_10035112 3300028794 Bacteria 8172
251 Ga0265338_10093225 3300028800 Bacteria 2482
252 Ga0307513_10058515 3300031456 Bacteria 4095
253 Ga0307513_10196180 3300031456 Bacteria 1865
254 Ga0316577_10061588 3300031733 Bacteria 2094
255 Ga0307413_10005026 3300031824 Bacteria 5840
256 Ga0307413_10275512 3300031824 Bacteria 1262
257 Ga0307410_10001328 3300031852 Bacteria 11063
258 Ga0307407_10001760 3300031903 Bacteria 8079
259 Ga0307407_10027846 3300031903 Bacteria 3013
260 Ga0307407_10158404 3300031903 Bacteria 1479
261 Ga0307412_10060349 3300031911 Bacteria 2545
262 Ga0307409_100001730 3300031995 Bacteria 11010
263 Ga0307409_100016876 3300031995 Bacteria 4847
264 Ga0307409_100325976 3300031995 Bacteria 1439
265 Ga0307416_100004548 3300032002 Bacteria 8380
266 Ga0307416_100064814 3300032002 Bacteria 2999
267 Ga0307411_10080965 3300032005 Bacteria 2234
268 Ga0307415_100338095 3300032126 Bacteria 1262
269 Ga0307510_10101713 3300033180 Bacteria 2660
270 Ga0373943_0038632 3300035170 Bacteria 2296
271 Ga0373946_0080915 3300035171 Bacteria 1422
272 Ga0373955_0015936 3300035172 Bacteria 3690
273 Ga0373962_0054121 3300035242 Bacteria 1163
274 Ga0316574_0000598 3300035398 Bacteria 15003
275 Ga0316574_0053630 3300035398 Bacteria 2517
276 Ga0373937_0058268 3300036401 Bacteria 3548
277 Ga0373937_0058470 3300036401 Bacteria 3542
278 Ga0316582_0023190 3300036647 Bacteria 3696
279 Ga0316584_0030085 3300036712 Bacteria 4011
280 Ga0316584_0074156 3300036712 Bacteria 2551
281 Ga0436364_0079449 3300037853 Bacteria 1239
282 Ga0436365_0220002 3300039437 Bacteria 2275
283 Ga0436360_0961219 3300039438 Bacteria 5424
284 Ga0436360_1291082 3300039438 Bacteria 5039
285 Ga0436361_0536861 3300039447 Bacteria 1499
286 Ga0436363_0743834 3300039450 Bacteria 5110
287 Ga0436362_0548232 3300039453 Bacteria 2021
288 Ga0451791_1853239 3300041451 Bacteria 2355
289 Ga0451807_2044689 3300041486 Bacteria 3908
290 Ga0451837_0521820 3300041494 Bacteria 1459
291 Ga0451577_0036635 3300042876 Bacteria 4415
292 Ga0451577_0096919 3300042876 Bacteria 2633
293 Ga0451577_0207683 3300042876 Bacteria 1768
294 Ga0466969_0001468 3300044656 Bacteria 12664
295 Ga0466969_0003877 3300044656 Bacteria 7939
296 Ga0453683_0131530 3300044673 Bacteria 1577
297 Ga0466961_0001824 3300044693 Bacteria 13211
298 Ga0466964_0000263 3300044706 Bacteria 15191
299 Ga0466957_0008375 3300044842 Bacteria 5881
300 Ga0466959_0005731 3300045049 Bacteria 8544
301 Ga0466959_0017225 3300045049 Bacteria 5292
302 Ga0451576_0448154 3300045051 Bacteria 1355
303 Ga0466958_0051555 3300045836 Bacteria 2492
304 Ga0495590_0055713 3300046457 Bacteria 1381
305 Ga0495580_0082946 3300046472 Bacteria 2234
306 Ga0495580_0121112 3300046472 Bacteria 1816
307 Ga0495584_0107159 3300046491 Bacteria 1413
308 Ga0495585_0161853 3300046492 Bacteria 1161
309 Ga0495618_0149830 3300046514 Bacteria 1490
310 Ga0495632_0077143 3300046519 Bacteria 1593
311 Ga0495644_0042359 3300046523 Bacteria 1714
312 Ga0495640_0036993 3300046533 Bacteria 3446
313 Ga0495621_0012462 3300046539 Bacteria 2651
314 Ga0495668_0057903 3300046616 Bacteria 2139
315 Ga0495625_0000405 3300046660 Bacteria 65434
316 Ga0495625_0006350 3300046660 Bacteria 10559
317 Ga0495625_0216812 3300046660 Bacteria 1256
318 Ga0495647_0029441 3300046681 Bacteria 2030
319 Ga0495658_0140854 3300046683 Bacteria 1475
320 Ga0495658_0187912 3300046683 Bacteria 1283
321 Ga0495613_0093482 3300046689 Bacteria 2177
322 Ga0495674_0000010 3300047319 Bacteria 285794
323 Ga0495674_0033597 3300047319 Bacteria 4645
324 Ga0495687_045653 3300047443 Bacteria 1896
325 Ga0495681_0113047 3300047470 Bacteria 1173
326 Ga0496100_0002271 3300048903 Bacteria 9711
327 Ga0496102_0340066 3300048905 Bacteria 1413
328 Ga0496103_0008618 3300048906 Bacteria 6057
329 Ga0496105_0000995 3300048908 Bacteria 19561
330 Ga0496106_0023023 3300048909 Bacteria 4627
331 Ga0496107_0005815 3300048910 Bacteria 8443
332 Ga0496108_0005792 3300048911 Bacteria 10014
333 Ga0496110_0113887 3300048913 Bacteria 2433
334 Ga0496111_0197640 3300048914 Bacteria 1495
335 Ga0496112_0101233 3300048915 Bacteria 2851
336 Ga0496113_0043987 3300048916 Bacteria 3307
337 Ga0496114_0003743 3300048917 Bacteria 11717
338 Ga0496114_0010728 3300048917 Bacteria 7292
339 Ga0496115_0090385 3300048918 Bacteria 2501
340 Ga0496115_0118860 3300048918 Bacteria 2174
341 Ga0496118_0041661 3300048921 Bacteria 3632
342 Ga0496125_0000283 3300048928 Bacteria 100594
343 Ga0496126_0002263 3300048929 Bacteria 26552
344 Ga0496126_0023793 3300048929 Bacteria 5930
345 Ga0501040_0128495 3300049576 Bacteria 1781
346 Ga0501042_0108373 3300049578 Bacteria 2000
347 Ga0501072_0336581 3300049588 Bacteria 1199
348 Ga0501073_0012225 3300049589 Bacteria 6267
349 Ga0501073_0041374 3300049589 Bacteria 3256
350 Ga0501077_0171774 3300049593 Bacteria 1377
351 Ga0501079_0027241 3300049741 Bacteria 4381
352 Ga0501080_0086958 3300049742 Bacteria 2904
353 Ga0501080_0089654 3300049742 Bacteria 2857
354 nmdc:mga05p37_181172_c1 3300050507 Bacteria 2563
355 nmdc:mga05p37_26862_c2 3300050507 Bacteria 6673
356 nmdc:mga09592_100839_c1 3300050508 Bacteria 2473
357 nmdc:mga09592_1314_c1 3300050508 Bacteria 19941
358 nmdc:mga09592_957_c1 3300050508 Bacteria 22740
359 nmdc:mga0qj67_10823_c1 3300050509 Bacteria 6824
360 nmdc:mga0qj67_188549_c1 3300050509 Bacteria 1676
361 nmdc:mga0qj67_48138_c1 3300050509 Bacteria 3368
362 nmdc:mga0qj67_976_c1 3300050509 Bacteria 19694
363 nmdc:mga06r32_113384_c1 3300050510 Bacteria 2668
364 nmdc:mga06r32_214_c1 3300050510 Bacteria 47006
365 nmdc:mga06r32_422_c1 3300050510 Bacteria 35614
366 nmdc:mga06r32_6955_c1 3300050510 Bacteria 10176
367 nmdc:mga06r32_86486_c1 3300050510 Bacteria 3057
368 nmdc:mga08y16_13120_c1 3300050511 Bacteria 8717
369 nmdc:mga08y16_161495_c1 3300050511 Bacteria 2328
370 nmdc:mga08y16_3843_c1 3300050511 Bacteria 15627
371 nmdc:mga08y16_599627_c1 3300050511 Bacteria 1110
372 nmdc:mga08y16_79370_c1 3300050511 Bacteria 3421
373 nmdc:mga0n895_377321_c1 3300050512 Bacteria 1435
374 Ga0500583_0097388 3300053092 Bacteria 1437
375 Ga0500594_0015741 3300053118 Bacteria 1829
376 Ga0500617_063608 3300053124 Bacteria 1629
377 Ga0500568_0067073 3300053139 Bacteria 1379
378 Ga0500588_0012381 3300053146 Bacteria 2114
379 Ga0500616_0000073 3300053153 Bacteria 231290
380 Ga0500622_0001563 3300053156 Bacteria 18102
381 Ga0500622_0032368 3300053156 Bacteria 2741
382 Ga0466962_0000991 3300061719 Bacteria 12952
383 Ga0466962_0082353 3300061719 Bacteria 1539
384 Ga0307406_10113195
385 Ga0070683_100015317
386 Ga0070670_100080806
387 Ga0068869_100319698
388 Ga0070680_100006601
389 Ga0070680_100122577
390 Ga0070682_100080652
391 Ga0070682_100095617
392 Ga0070689_100026289
393 Ga0070687_100117050
394 Ga0070661_100038019
395 Ga0070668_100002653
396 Ga0070669_100004285
397 Ga0070675_100005946
398 Ga0070675_100014786
399 Ga0070674_100004156
400 Ga0070674_100126043
401 Ga0070673_100016489
402 Ga0070673_100037319
403 Ga0070673_100285544
404 Ga0070688_100069636
405 Ga0070688_100115955
406 Ga0070667_100011914
407 Ga0070709_10001515
408 Ga0070713_100002396
409 Ga0070713_100114743
410 Ga0070701_10019543
411 Ga0070701_10054949
412 Ga0070711_100001509
413 Ga0070705_100003374
414 Ga0070700_100010744
415 Ga0070700_100075908
416 Ga0070700_100119940
417 Ga0070662_100005349
418 Ga0070681_10004146
419 Ga0070681_10011407
420 Ga0070681_10012124
421 Ga0070681_10052414
422 Ga0070681_10235822
423 Ga0068867_100005928
424 Ga0070685_10019600
425 Ga0070685_10039372
426 Ga0070699_100019215
427 Ga0070679_100000469
428 Ga0070679_100173233
429 Ga0070679_100203854
430 Ga0070672_100025188
431 Ga0070672_100050595
432 Ga0070686_100042380
433 Ga0070695_100006910
434 Ga0070695_100080765
435 Ga0070693_100123608
436 Ga0070665_100000543
437 Ga0070665_100002122
438 Ga0070665_100004302
439 Ga0070665_100068137
440 Ga0068855_100001265
441 Ga0068855_100001482
442 Ga0068855_100046836
443 Ga0068857_100209595
444 Ga0068856_100278557
445 Ga0068859_100033918
446 Ga0068864_100034786
447 Ga0068864_100035431
448 Ga0068864_100069909
449 Ga0068861_100001900
450 Ga0068861_100018217
451 Ga0068861_100072599
452 Ga0068870_10049658
453 Ga0068870_10067047
454 Ga0068863_100003132
455 Ga0068863_100063307
456 Ga0068863_100072659
457 Ga0068860_100031928
458 Ga0068862_100001355
459 Ga0068862_100016909
460 Ga0068862_100092470
461 Ga0068862_100094067
462 Ga0068862_100374984
463 Ga0081455_10000505
464 Ga0081455_10016045
465 Ga0070715_10000427
466 Ga0070715_10073984
467 Ga0070715_10101536
468 Ga0070716_100005250
469 Ga0070716_100009916
470 Ga0070712_100051841
471 Ga0097621_100021367
472 Ga0068871_100022932
473 Ga0068871_100095572
474 Ga0075428_100003329
475 Ga0075428_100051848
476 Ga0075430_100103132
477 Ga0075430_100198317
478 Ga0075430_100209129
479 Ga0075431_100000034
480 Ga0075431_100000229
481 Ga0075431_100082739
482 Ga0075429_100000568
483 Ga0075429_100011274
484 Ga0075429_100061795
485 Ga0068865_100022573
486 Ga0068865_100036049
487 Ga0068865_100302160
488 Ga0075436_100059020
489 Ga0097620_100033918
490 Ga0105240_10002705
491 Ga0105240_10003826
492 Ga0105240_10010161
493 Ga0105240_10015135
494 Ga0105240_10037149
495 Ga0105240_10052537
496 Ga0105240_10077876
497 Ga0105240_10103435
498 Ga0111539_10003802
499 Ga0111539_10033443
500 Ga0111539_10075525
501 Ga0111539_10119951
502 Ga0105245_10050385
503 Ga0105247_10001703
504 Ga0105247_10141567
505 Ga0114129_10001159
506 Ga0114129_10038881
507 Ga0105242_10004535
508 Ga0105248_10104320
509 Ga0105237_10047387
510 Ga0105237_10168733
511 Ga0105237_10454487
512 Ga0105237_10551980
513 Ga0105238_10004689
514 Ga0105238_10008320
515 Ga0105238_10049908
516 Ga0105249_10005519
517 Ga0099796_10002205
518 Ga0105239_10028955
519 Ga0105239_10091988
520 Ga0157370_10001472
521 Ga0157369_10123287
522 Ga0157369_10182187
523 Ga0157374_10232382
524 Ga0157378_10002553
525 Ga0163162_10055198
526 Ga0157372_10164749
527 Ga0157372_10240366
528 Ga0157375_10381270
529 Ga0163163_10038150
530 Ga0163163_10130464
531 Ga0163163_10228312
532 Ga0157380_10007167
533 Ga0157380_10140666
534 Ga0157376_10485288
535 Ga0207642_10074772
536 Ga0207710_10088388
537 Ga0207680_10040372
538 Ga0207645_10001809
539 Ga0207645_10038178
540 Ga0207643_10055398
541 Ga0207643_10075135
542 Ga0207643_10177032
543 Ga0207654_10023535
544 Ga0207707_10000122
545 Ga0207707_10007353
546 Ga0207707_10023503
547 Ga0207707_10101927
548 Ga0207695_10007798
549 Ga0207695_10015705
550 Ga0207695_10027453
551 Ga0207695_10043384
552 Ga0207695_10049172
553 Ga0207695_10061567
554 Ga0207695_10074948
555 Ga0207695_10079086
556 Ga0207671_10076421
557 Ga0207693_10000083
558 Ga0207693_10078718
559 Ga0207663_10044804
560 Ga0207660_10003018
561 Ga0207660_10015021
562 Ga0207660_10024488
563 Ga0207649_10135438
564 Ga0207652_10001479
565 Ga0207652_10159879
566 Ga0207652_10183524
567 Ga0207681_10007576
568 Ga0207681_10117044
569 Ga0207694_10189692
570 Ga0207694_10235816
571 Ga0207659_10076541
572 Ga0207659_10172222
573 Ga0207700_10008992
574 Ga0207706_10002686
575 Ga0207706_10006328
576 Ga0207670_10020258
577 Ga0207670_10152713
578 Ga0207669_10027831
579 Ga0207669_10028204
580 Ga0207669_10073830
581 Ga0207665_10003213
582 Ga0207665_10017571
583 Ga0207691_10017327
584 Ga0207691_10066007
585 Ga0207691_10134248
586 Ga0207711_10147510
587 Ga0207661_10172223
588 Ga0207679_10074625
589 Ga0207679_10078862
590 Ga0207667_10000798
591 Ga0207667_10003882
592 Ga0207667_10031650
593 Ga0207712_10008038
594 Ga0207712_10026140
595 Ga0207668_10033325
596 Ga0207668_10161134
597 Ga0207677_10040379
598 Ga0207708_10012325
599 Ga0207708_10071432
600 Ga0207708_10141917
601 Ga0207702_10026935
602 Ga0207702_10176556
603 Ga0207641_10020047
604 Ga0207641_10414208
605 Ga0207648_10046667
606 Ga0207648_10115301
607 Ga0207648_10158667
608 Ga0207676_10017726
609 Ga0207676_10022537
610 Ga0207676_10264895
611 Ga0207674_10088484
612 Ga0207674_10276339
613 Ga0207675_100000283
614 Ga0207675_100015006
615 Ga0207675_100030670
616 Ga0207675_100050977
617 Ga0207675_100151112
618 Ga0207683_10013626
619 Ga0209971_1000182
620 Ga0209998_10003364
621 Ga0207428_10059346
622 Ga0207428_10086605
623 Ga0268266_10001602
624 Ga0268266_10014064
625 Ga0268266_10114422
626 Ga0268265_10000265
627 Ga0268265_10022202
628 Ga0268265_10111600
629 Ga0268265_10229722
630 Ga0268264_10024412
631 Ga0268264_10101811
632 Ga0268264_10136884
633 Ga0307515_10035112
634 Ga0265338_10093225
635 Ga0307513_10058515
636 Ga0307513_10196180
637 Ga0316577_10061588
638 Ga0307413_10005026
639 Ga0307413_10275512
640 Ga0307410_10001328
641 Ga0307407_10001760
642 Ga0307407_10027846
643 Ga0307407_10158404
644 Ga0307412_10060349
645 Ga0307409_100001730
646 Ga0307409_100016876
647 Ga0307409_100325976
648 Ga0307416_100004548
649 Ga0307416_100064814
650 Ga0307411_10080965
651 Ga0307415_100338095
652 Ga0307510_10101713
653 Ga0373943_0038632
654 Ga0373946_0080915
655 Ga0373955_0015936
656 Ga0373962_0054121
657 Ga0316574_0000598
658 Ga0316574_0053630
659 Ga0373937_0058268
660 Ga0373937_0058470
661 Ga0316582_0023190
662 Ga0316584_0030085
663 Ga0316584_0074156
664 Ga0436364_0079449
665 Ga0436365_0220002
666 Ga0436360_0961219
667 Ga0436360_1291082
668 Ga0436361_0536861
669 Ga0436363_0743834
670 Ga0436362_0548232
671 Ga0451791_1853239
672 Ga0451807_2044689
673 Ga0451837_0521820
674 Ga0451577_0036635
675 Ga0451577_0096919
676 Ga0451577_0207683
677 Ga0466969_0001468
678 Ga0466969_0003877
679 Ga0453683_0131530
680 Ga0466961_0001824
681 Ga0466964_0000263
682 Ga0466957_0008375
683 Ga0466959_0005731
684 Ga0466959_0017225
685 Ga0451576_0448154
686 Ga0466958_0051555
687 Ga0495590_0055713
688 Ga0495580_0082946
689 Ga0495580_0121112
690 Ga0495584_0107159
691 Ga0495585_0161853
692 Ga0495618_0149830
693 Ga0495632_0077143
694 Ga0495644_0042359
695 Ga0495640_0036993
696 Ga0495621_0012462
697 Ga0495668_0057903
698 Ga0495625_0000405
699 Ga0495625_0006350
700 Ga0495625_0216812
701 Ga0495647_0029441
702 Ga0495658_0140854
703 Ga0495658_0187912
704 Ga0495613_0093482
705 Ga0495674_0000010
706 Ga0495674_0033597
707 Ga0495687_045653
708 Ga0495681_0113047
709 Ga0496100_0002271
710 Ga0496102_0340066
711 Ga0496103_0008618
712 Ga0496105_0000995
713 Ga0496106_0023023
714 Ga0496107_0005815
715 Ga0496108_0005792
716 Ga0496110_0113887
717 Ga0496111_0197640
718 Ga0496112_0101233
719 Ga0496113_0043987
720 Ga0496114_0003743
721 Ga0496114_0010728
722 Ga0496115_0090385
723 Ga0496115_0118860
724 Ga0496118_0041661
725 Ga0496125_0000283
726 Ga0496126_0002263
727 Ga0496126_0023793
728 Ga0501040_0128495
729 Ga0501042_0108373
730 Ga0501072_0336581
731 Ga0501073_0012225
732 Ga0501073_0041374
733 Ga0501077_0171774
734 Ga0501079_0027241
735 Ga0501080_0086958
736 Ga0501080_0089654
737 nmdc:mga05p37_181172_c1
738 nmdc:mga05p37_26862_c2
739 nmdc:mga09592_100839_c1
740 nmdc:mga09592_1314_c1
741 nmdc:mga09592_957_c1
742 nmdc:mga0qj67_10823_c1
743 nmdc:mga0qj67_188549_c1
744 nmdc:mga0qj67_48138_c1
745 nmdc:mga0qj67_976_c1
746 nmdc:mga06r32_113384_c1
747 nmdc:mga06r32_214_c1
748 nmdc:mga06r32_422_c1
749 nmdc:mga06r32_6955_c1
750 nmdc:mga06r32_86486_c1
751 nmdc:mga08y16_13120_c1
752 nmdc:mga08y16_161495_c1
753 nmdc:mga08y16_3843_c1
754 nmdc:mga08y16_599627_c1
755 nmdc:mga08y16_79370_c1
756 nmdc:mga0n895_377321_c1
757 Ga0500583_0097388
758 Ga0500594_0015741
759 Ga0500617_063608
760 Ga0500568_0067073
761 Ga0500588_0012381
762 Ga0500616_0000073
763 Ga0500622_0001563
764 Ga0500622_0032368
765 Ga0466962_0000991
766 Ga0466962_0082353

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04371

PAD_porph

Porphyromonas-type peptidyl-arginine deiminase

15

362

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
6nic-assembly1.cif.gz_B crystal structure of medicago truncatula agmatine iminohydrolase (deiminase) in complex with 6-aminohexanamide 0.9921 13 363
6nic-assembly2.cif.gz_C crystal structure of medicago truncatula agmatine iminohydrolase (deiminase) in complex with 6-aminohexanamide 0.9916 13 363
6nic-assembly2.cif.gz_D crystal structure of medicago truncatula agmatine iminohydrolase (deiminase) in complex with 6-aminohexanamide 0.9909 13 363
2q3u-assembly2.cif.gz_B ensemble refinement of the protein crystal structure of gene product from arabidopsis thaliana at5g08170, agmatine iminohydrolase 0.9876 8 366
6nib-assembly1.cif.gz_A-2 crystal structure of medicago truncatula agmatine iminohydrolase (deiminase) 0.9823 13 363
ID Description Score Start End Superfamily
3h7kA00 Alpha Beta;5-stranded Propeller;L-arginine/glycine Amidinotransferase; Chain A;L-arginine/glycine Amidinotransferase; Chain A 0.9739 2 364 3.75.10.10
3h7kA00 Alpha Beta;5-stranded Propeller;L-arginine/glycine Amidinotransferase; Chain A;L-arginine/glycine Amidinotransferase; Chain A 0.9659 2 364 3.75.10.10
2ewoA00 Alpha Beta;5-stranded Propeller;L-arginine/glycine Amidinotransferase; Chain A;L-arginine/glycine Amidinotransferase; Chain A 0.9568 1 364 3.75.10.10
2ewoA00 Alpha Beta;5-stranded Propeller;L-arginine/glycine Amidinotransferase; Chain A;L-arginine/glycine Amidinotransferase; Chain A 0.9515 1 364 3.75.10.10
3hvmA00 Alpha Beta;5-stranded Propeller;L-arginine/glycine Amidinotransferase; Chain A;L-arginine/glycine Amidinotransferase; Chain A 0.9231 14 361 3.75.10.10
ID Description Score Start End GO Terms
AF-A0A0P6Y7T8-F1-model_v4 Putative agmatine deiminase (EC 3.5.3.12) (Agmatine iminohydrolase) 0.9974 1 363 GO:0004668
GO:0009446
GO:0047632
AF-A0A7X5ATK8-F1-model_v4 Agmatine deiminase (EC 3.5.3.12) 0.9969 3 251 GO:0004668
GO:0009446
GO:0047632
AF-A0A363T504-F1-model_v4 Putative agmatine deiminase (EC 3.5.3.12) (Agmatine iminohydrolase) 0.9968 1 363 GO:0004668
GO:0009446
GO:0047632
AF-A0A436JNY0-F1-model_v4 deleted 0.9968 1 271
AF-A0A7X1GXN6-F1-model_v4 Putative agmatine deiminase (EC 3.5.3.12) (Agmatine iminohydrolase) 0.9966 1 364 GO:0004668
GO:0009446
GO:0047632

Map