F429572

General Info

Members Datasets Scaffolds Average Seq Length
383 233 766 140

Family's Representative Sequence

Representative Sequence 3300009098|Ga0105245_10590509|Ga0105245_105905092
Length 164
Sequence MFMTVLVPECRWILNQAVSGGILCAAVIRLSRTIHFNAGRSLWRPGWSAEKNREVYGEESPHGYGHNYELEVSVAGDADPQTGMVVNLTDLDRVLREEVDRPLDHQNLNRDVPEFAQTPPTAENLAVWIWRRVVARIAAEKWPCRVVFLRLRLAPDFAVEIEEP

Samples

Sample ID Description Type Environment
1 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
2 3300003371 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM Metagenome Rhizosphere
3 3300003504 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
56 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
57 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
58 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
59 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
63 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
64 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
71 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
81 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
82 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
83 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
84 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
85 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
86 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
144 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
145 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
146 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
147 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
148 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
149 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
150 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
151 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
152 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
153 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
154 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
155 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
156 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
157 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
158 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
159 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
160 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
161 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
162 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
163 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
164 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
165 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
166 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
167 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
168 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
169 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
170 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
171 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
172 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
173 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
174 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
175 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
176 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
177 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
178 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
179 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
180 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
181 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
182 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
183 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
184 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
185 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
186 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
187 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
188 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
189 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
190 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
191 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
192 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
193 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
194 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
195 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
196 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
197 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
198 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
199 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
200 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
201 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
202 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
203 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
204 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
205 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
206 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
207 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
208 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
209 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
214 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
215 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
216 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
217 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
218 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
219 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
220 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
221 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
222 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
223 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
224 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
225 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
226 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
227 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
228 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
229 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
230 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
231 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
232 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
233 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.74
Rhizosphere 94.26
Stem 0
Stem Tuber 0
Unclassified 16.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105245_10590509 3300009098 Bacteria 1136
2 JGI26145J50221_1012776 3300003371 Bacteria 757
3 JGI26138J51218_105477 3300003504 Bacteria 576
4 Ga0065707_10813917 3300005295 Bacteria 594
5 Ga0070690_100000155 3300005330 Bacteria 35019
6 Ga0070670_100053833 3300005331 Bacteria 3455
7 Ga0070677_10002820 3300005333 Bacteria 5567
8 Ga0068869_100032374 3300005334 Bacteria 3683
9 Ga0070666_10001188 3300005335 Bacteria 15759
10 Ga0070666_10244876 3300005335 Unclassified 1268
11 Ga0070660_100236159 3300005339 Bacteria 1488
12 Ga0070689_100039379 3300005340 Bacteria 3619
13 Ga0070689_100778474 3300005340 Bacteria 840
14 Ga0070661_100377455 3300005344 Bacteria 1117
15 Ga0070692_10008929 3300005345 Bacteria 4493
16 Ga0070675_100029062 3300005354 Bacteria 4455
17 Ga0070673_100071090 3300005364 Bacteria 2795
18 Ga0070673_100636315 3300005364 Bacteria 975
19 Ga0070688_100274780 3300005365 Unclassified 1208
20 Ga0070659_100542721 3300005366 Bacteria 995
21 Ga0070667_100003267 3300005367 Bacteria 13857
22 Ga0070667_100592131 3300005367 Unclassified 1021
23 Ga0070667_101059945 3300005367 Bacteria 757
24 Ga0070709_10219133 3300005434 Bacteria 1356
25 Ga0070710_10761872 3300005437 Bacteria 688
26 Ga0070701_10074975 3300005438 Unclassified 1818
27 Ga0070705_100040797 3300005440 Bacteria 2642
28 Ga0070700_100039644 3300005441 Bacteria 2878
29 Ga0070694_100005856 3300005444 Bacteria 7457
30 Ga0070694_100127833 3300005444 Bacteria 1832
31 Ga0070708_100008266 3300005445 Bacteria 8356
32 Ga0070708_100028321 3300005445 Bacteria 4820
33 Ga0070708_101982579 3300005445 Bacteria 539
34 Ga0070663_100007770 3300005455 Bacteria 6551
35 Ga0070663_100068791 3300005455 Bacteria 2571
36 Ga0070678_100243325 3300005456 Bacteria 1505
37 Ga0070678_102136026 3300005456 Unclassified 531
38 Ga0070662_100030093 3300005457 Bacteria 3795
39 Ga0068867_100047826 3300005459 Bacteria 3146
40 Ga0068867_100444433 3300005459 Bacteria 1103
41 Ga0070706_100008167 3300005467 Bacteria 9767
42 Ga0070706_100014175 3300005467 Bacteria 7365
43 Ga0070706_100048950 3300005467 Bacteria 3900
44 Ga0070706_100593650 3300005467 Bacteria 1029
45 Ga0070706_100994190 3300005467 Bacteria 774
46 Ga0070706_101982615 3300005467 Unclassified 527
47 Ga0070706_102110009 3300005467 Unclassified 509
48 Ga0070707_100010653 3300005468 Bacteria 8563
49 Ga0070707_100265332 3300005468 Bacteria 1670
50 Ga0070707_100962444 3300005468 Unclassified 819
51 Ga0070707_100966840 3300005468 Unclassified 817
52 Ga0070698_100001309 3300005471 Bacteria 27709
53 Ga0070698_100207700 3300005471 Unclassified 1893
54 Ga0070698_100207788 3300005471 Bacteria 1893
55 Ga0070699_100251847 3300005518 Bacteria 1578
56 Ga0070699_100443320 3300005518 Bacteria 1177
57 Ga0070699_100790807 3300005518 Bacteria 868
58 Ga0070699_100953984 3300005518 Bacteria 786
59 Ga0070699_101342757 3300005518 Unclassified 656
60 Ga0070697_100000744 3300005536 Bacteria 24306
61 Ga0070697_100013990 3300005536 Bacteria 6300
62 Ga0070697_100071041 3300005536 Bacteria 2855
63 Ga0070697_101975532 3300005536 Unclassified 522
64 Ga0068853_100180345 3300005539 Bacteria 1915
65 Ga0068853_100827875 3300005539 Archaea 887
66 Ga0070672_100004384 3300005543 Bacteria 9245
67 Ga0070672_100055548 3300005543 Bacteria 3102
68 Ga0070672_100139333 3300005543 Bacteria 2000
69 Ga0070686_100027557 3300005544 Bacteria 3439
70 Ga0070695_100084394 3300005545 Bacteria 2107
71 Ga0070695_100507562 3300005545 Bacteria 934
72 Ga0070696_100036681 3300005546 Unclassified 3381
73 Ga0070696_100156545 3300005546 Bacteria 1676
74 Ga0070693_100045687 3300005547 Bacteria 2484
75 Ga0070665_100040501 3300005548 Bacteria 4683
76 Ga0070665_101631739 3300005548 Unclassified 652
77 Ga0070704_100058778 3300005549 Unclassified 2740
78 Ga0070704_100080893 3300005549 Bacteria 2391
79 Ga0070704_100145373 3300005549 Bacteria 1857
80 Ga0070704_100347039 3300005549 Bacteria 1252
81 Ga0068854_100240662 3300005578 Bacteria 1441
82 Ga0068856_100087387 3300005614 Bacteria 3099
83 Ga0068856_101102376 3300005614 Bacteria 811
84 Ga0070702_100054424 3300005615 Bacteria 2302
85 Ga0068859_100000011 3300005617 Bacteria 309687
86 Ga0068859_100001665 3300005617 Bacteria 22626
87 Ga0068859_100036997 3300005617 Bacteria 4899
88 Ga0068859_101001489 3300005617 Bacteria 918
89 Ga0068864_100013150 3300005618 Bacteria 6852
90 Ga0068864_101404122 3300005618 Bacteria 700
91 Ga0068866_10011159 3300005718 Bacteria 3876
92 Ga0068861_100025235 3300005719 Bacteria 4308
93 Ga0068870_10001866 3300005840 Bacteria 8671
94 Ga0068863_100009318 3300005841 Bacteria 9581
95 Ga0068863_100074462 3300005841 Bacteria 3212
96 Ga0068863_100099978 3300005841 Bacteria 2756
97 Ga0068858_100003180 3300005842 Bacteria 16411
98 Ga0068860_100010251 3300005843 Bacteria 9276
99 Ga0068860_100015495 3300005843 Bacteria 7444
100 Ga0068860_100338122 3300005843 Bacteria 1480
101 Ga0068860_100716329 3300005843 Bacteria 1011
102 Ga0068862_100115816 3300005844 Bacteria 2357
103 Ga0068862_100286496 3300005844 Bacteria 1511
104 Ga0068862_101681377 3300005844 Unclassified 643
105 Ga0081455_10104127 3300005937 Bacteria 2271
106 Ga0070717_11821065 3300006028 Bacteria 550
107 Ga0070715_10194599 3300006163 Unclassified 1026
108 Ga0070716_101078216 3300006173 Unclassified 639
109 Ga0070712_100252067 3300006175 Bacteria 1411
110 Ga0070712_100299465 3300006175 Bacteria 1301
111 Ga0070712_100346191 3300006175 Unclassified 1215
112 Ga0097621_100042144 3300006237 Bacteria 3676
113 Ga0097621_100238250 3300006237 Bacteria 1590
114 Ga0097621_100339010 3300006237 Unclassified 1335
115 Ga0097621_100975977 3300006237 Bacteria 792
116 Ga0068871_100407440 3300006358 Bacteria 1212
117 Ga0075428_101015755 3300006844 Bacteria 878
118 Ga0075433_10009823 3300006852 Bacteria 7670
119 Ga0075433_10013829 3300006852 Bacteria 6580
120 Ga0075433_10144704 3300006852 Bacteria 2113
121 Ga0075433_10547628 3300006852 Unclassified 1017
122 Ga0075434_100000447 3300006871 Bacteria 30712
123 Ga0075434_100017468 3300006871 Bacteria 6914
124 Ga0075434_100049860 3300006871 Bacteria 4158
125 Ga0068865_100048033 3300006881 Bacteria 2936
126 Ga0075436_100062058 3300006914 Bacteria 2583
127 Ga0075436_100276731 3300006914 Bacteria 1199
128 Ga0075436_100526229 3300006914 Bacteria 867
129 Ga0097620_100000011 3300006931 Bacteria 309687
130 Ga0097620_100001665 3300006931 Bacteria 22626
131 Ga0097620_100037005 3300006931 Bacteria 4899
132 Ga0097620_101001461 3300006931 Bacteria 918
133 Ga0075435_100002545 3300007076 Bacteria 12138
134 Ga0075435_100215787 3300007076 Bacteria 1628
135 Ga0075435_101010194 3300007076 Unclassified 726
136 Ga0111539_11890173 3300009094 Unclassified 692
137 Ga0105245_10306018 3300009098 Unclassified 1561
138 Ga0105245_10361694 3300009098 Bacteria 1440
139 Ga0105247_10038434 3300009101 Bacteria 2922
140 Ga0114129_10010033 3300009147 Bacteria 13501
141 Ga0114129_10016999 3300009147 Bacteria 10356
142 Ga0114129_10048870 3300009147 Bacteria 5946
143 Ga0105243_10046459 3300009148 Bacteria 3416
144 Ga0105241_10015173 3300009174 Bacteria 5643
145 Ga0105241_10334575 3300009174 Bacteria 1310
146 Ga0105242_10342322 3300009176 Unclassified 1378
147 Ga0105242_10420445 3300009176 Bacteria 1252
148 Ga0105242_10964095 3300009176 Bacteria 858
149 Ga0105248_10002020 3300009177 Bacteria 22509
150 Ga0105248_10202572 3300009177 Bacteria 2236
151 Ga0105237_10771346 3300009545 Bacteria 968
152 Ga0105249_10017645 3300009553 Bacteria 6338
153 Ga0105249_10128031 3300009553 Bacteria 2420
154 Ga0163162_10004675 3300013306 Bacteria 13204
155 Ga0163162_10162679 3300013306 Bacteria 2354
156 Ga0163162_10980254 3300013306 Bacteria 955
157 Ga0157375_10003622 3300013308 Bacteria 13398
158 Ga0157375_11427869 3300013308 Bacteria 816
159 Ga0163163_10280484 3300014325 Bacteria 1718
160 Ga0157380_10319158 3300014326 Bacteria 1439
161 Ga0182008_10266863 3300014497 Bacteria 887
162 Ga0157377_10267277 3300014745 Bacteria 1115
163 Ga0157379_10001795 3300014968 Bacteria 17712
164 Ga0157379_10036639 3300014968 Bacteria 4373
165 Ga0157376_10008796 3300014969 Bacteria 7306
166 Ga0157376_10031796 3300014969 Bacteria 4231
167 Ga0157376_10274181 3300014969 Bacteria 1586
168 Ga0207697_10046785 3300025315 Bacteria 1782
169 Ga0207697_10230023 3300025315 Unclassified 819
170 Ga0207682_10001284 3300025893 Bacteria 11524
171 Ga0207692_10845889 3300025898 Bacteria 600
172 Ga0207642_10003784 3300025899 Bacteria 4816
173 Ga0207710_10010853 3300025900 Bacteria 3837
174 Ga0207688_10011119 3300025901 Bacteria 4897
175 Ga0207680_10007693 3300025903 Bacteria 5265
176 Ga0207647_10426792 3300025904 Unclassified 745
177 Ga0207647_10681862 3300025904 Unclassified 561
178 Ga0207685_10621113 3300025905 Bacteria 582
179 Ga0207699_10647401 3300025906 Bacteria 772
180 Ga0207645_10011132 3300025907 Bacteria 6155
181 Ga0207643_10012986 3300025908 Bacteria 4503
182 Ga0207684_10004489 3300025910 Bacteria 13127
183 Ga0207684_10078349 3300025910 Bacteria 2810
184 Ga0207684_10112419 3300025910 Bacteria 2331
185 Ga0207684_10249547 3300025910 Bacteria 1531
186 Ga0207684_10551711 3300025910 Bacteria 986
187 Ga0207684_10958489 3300025910 Unclassified 717
188 Ga0207654_10132314 3300025911 Bacteria 1580
189 Ga0207693_10282282 3300025915 Bacteria 1301
190 Ga0207663_10581921 3300025916 Bacteria 878
191 Ga0207662_10420981 3300025918 Unclassified 909
192 Ga0207652_11329471 3300025921 Bacteria 622
193 Ga0207646_10126613 3300025922 Bacteria 2297
194 Ga0207646_10133450 3300025922 Bacteria 2235
195 Ga0207646_10516742 3300025922 Bacteria 1075
196 Ga0207646_10520679 3300025922 Bacteria 1071
197 Ga0207681_10225678 3300025923 Bacteria 1451
198 Ga0207659_10022017 3300025926 Bacteria 4239
199 Ga0207687_10394764 3300025927 Bacteria 1136
200 Ga0207690_10216700 3300025932 Bacteria 1463
201 Ga0207706_10011248 3300025933 Bacteria 8162
202 Ga0207686_10119877 3300025934 Bacteria 1789
203 Ga0207686_10423986 3300025934 Bacteria 1018
204 Ga0207670_10021196 3300025936 Bacteria 4006
205 Ga0207670_10479460 3300025936 Bacteria 1007
206 Ga0207704_10035166 3300025938 Bacteria 2868
207 Ga0207665_10856198 3300025939 Unclassified 720
208 Ga0207691_10007006 3300025940 Bacteria 10876
209 Ga0207691_10452997 3300025940 Unclassified 1092
210 Ga0207711_10000407 3300025941 Bacteria 45641
211 Ga0207689_10034771 3300025942 Bacteria 4184
212 Ga0207679_10123621 3300025945 Bacteria 2064
213 Ga0207667_10045125 3300025949 Bacteria 4668
214 Ga0207651_10025963 3300025960 Bacteria 3650
215 Ga0207651_11374891 3300025960 Bacteria 635
216 Ga0207712_10019405 3300025961 Bacteria 4439
217 Ga0207640_10067935 3300025981 Bacteria 2387
218 Ga0207640_10161255 3300025981 Bacteria 1659
219 Ga0207658_10002290 3300025986 Bacteria 14143
220 Ga0207658_10303250 3300025986 Bacteria 1377
221 Ga0207658_10542318 3300025986 Bacteria 1040
222 Ga0207658_10573292 3300025986 Bacteria 1012
223 Ga0207703_10029346 3300026035 Bacteria 4339
224 Ga0207639_11704325 3300026041 Archaea 590
225 Ga0207678_10012139 3300026067 Bacteria 7566
226 Ga0207678_10014460 3300026067 Bacteria 6938
227 Ga0207678_10051812 3300026067 Bacteria 3542
228 Ga0207702_10009584 3300026078 Bacteria 8131
229 Ga0207641_10033498 3300026088 Bacteria 4267
230 Ga0207641_10033634 3300026088 Bacteria 4259
231 Ga0207641_10044891 3300026088 Bacteria 3718
232 Ga0207641_10092366 3300026088 Bacteria 2650
233 Ga0207648_10017790 3300026089 Bacteria 6452
234 Ga0207648_10394589 3300026089 Bacteria 1253
235 Ga0207674_10692552 3300026116 Bacteria 984
236 Ga0207675_100022324 3300026118 Bacteria 5893
237 Ga0207675_100106106 3300026118 Bacteria 2648
238 Ga0207683_10070606 3300026121 Bacteria 3086
239 Ga0207683_10293739 3300026121 Bacteria 1486
240 Ga0209981_1013104 3300027378 Unclassified 1151
241 Ga0209995_1010086 3300027471 Unclassified 1529
242 Ga0209970_1000217 3300027614 Bacteria 9237
243 Ga0210002_1006194 3300027617 Unclassified 1803
244 Ga0209983_1015743 3300027665 Bacteria 1560
245 Ga0209971_1001401 3300027682 Bacteria 5992
246 Ga0209966_1010889 3300027695 Bacteria 1650
247 Ga0209974_10000145 3300027876 Bacteria 21472
248 Ga0268266_10115890 3300028379 Bacteria 2379
249 Ga0268266_10125712 3300028379 Bacteria 2288
250 Ga0268265_10317911 3300028380 Bacteria 1408
251 Ga0268265_10474405 3300028380 Unclassified 1174
252 Ga0268265_10522208 3300028380 Bacteria 1122
253 Ga0268264_10003027 3300028381 Bacteria 14575
254 Ga0268264_10077039 3300028381 Bacteria 2839
255 Ga0268264_10332610 3300028381 Bacteria 1440
256 Ga0268264_10710145 3300028381 Bacteria 999
257 Ga0265330_10019291 3300031235 Bacteria 3127
258 Ga0265332_10136437 3300031238 Unclassified 1028
259 Ga0265329_10052826 3300031242 Unclassified 1292
260 Ga0265339_10142619 3300031249 Unclassified 1217
261 Ga0265331_10086799 3300031250 Unclassified 1449
262 Ga0265342_10061194 3300031712 Bacteria 2219
263 Ga0373940_0117602 3300035088 Unclassified 822
264 Ga0373944_0305658 3300035089 Unclassified 598
265 Ga0373951_0104740 3300035091 Bacteria 756
266 Ga0373936_0407009 3300035113 Bacteria 625
267 Ga0373943_0414186 3300035170 Bacteria 779
268 Ga0373946_0027516 3300035171 Bacteria 2250
269 Ga0373955_0048859 3300035172 Bacteria 2296
270 Ga0373962_0038502 3300035242 Bacteria 1339
271 Ga0373924_0078778 3300035410 Bacteria 1399
272 Ga0373924_0227064 3300035410 Bacteria 825
273 Ga0373937_0071995 3300036401 Bacteria 3188
274 Ga0373937_0267888 3300036401 Bacteria 1612
275 Ga0373925_0061527 3300037068 Bacteria 2820
276 Ga0451577_0164835 3300042876 Bacteria 1996
277 Ga0451577_1106227 3300042876 Unclassified 709
278 Ga0451577_1687188 3300042876 Bacteria 558
279 Ga0453684_0278641 3300044712 Bacteria 1908
280 Ga0451576_1069725 3300045051 Unclassified 845
281 Ga0495603_0202004 3300046455 Bacteria 1149
282 Ga0495629_0043819 3300046459 Bacteria 3141
283 Ga0495629_0397405 3300046459 Bacteria 937
284 Ga0495651_0462667 3300046462 Bacteria 818
285 Ga0495580_0001599 3300046472 Bacteria 19889
286 Ga0495580_0034257 3300046472 Bacteria 3657
287 Ga0495580_0158443 3300046472 Bacteria 1567
288 Ga0495639_0140438 3300046475 Bacteria 1161
289 Ga0495662_0021843 3300046476 Bacteria 3093
290 Ga0495585_0281343 3300046492 Unclassified 822
291 Ga0495594_0491809 3300046499 Bacteria 697
292 Ga0495594_0712273 3300046499 Unclassified 567
293 Ga0495618_0129068 3300046514 Bacteria 1618
294 Ga0495628_0281408 3300046516 Archaea 1235
295 Ga0495630_0187539 3300046517 Bacteria 1578
296 Ga0495640_0033890 3300046533 Bacteria 3627
297 Ga0495586_0075669 3300046535 Bacteria 1843
298 Ga0495587_0766668 3300046536 Unclassified 527
299 Ga0495645_0507176 3300046543 Bacteria 753
300 Ga0495633_0130530 3300046558 Bacteria 1163
301 Ga0495634_0487262 3300046642 Bacteria 724
302 Ga0495635_0019966 3300046663 Bacteria 4669
303 Ga0495635_0221117 3300046663 Unclassified 1281
304 Ga0495657_0325859 3300046675 Bacteria 912
305 Ga0495599_0102959 3300046678 Bacteria 1779
306 Ga0495623_0285106 3300046679 Bacteria 917
307 Ga0495647_0079243 3300046681 Bacteria 1329
308 Ga0495658_0011523 3300046683 Bacteria 4450
309 Ga0495658_0825189 3300046683 Bacteria 593
310 Ga0495624_0227081 3300046690 Bacteria 1131
311 Ga0495600_0107203 3300046809 Bacteria 1820
312 Ga0495604_0128989 3300047317 Bacteria 1820
313 Ga0495674_1190699 3300047319 Archaea 576
314 Ga0495680_0311706 3300047322 Bacteria 1103
315 Ga0495684_0103122 3300047471 Bacteria 2156
316 Ga0495684_0294353 3300047471 Unclassified 1167
317 Ga0495602_0142850 3300048088 Bacteria 1893
318 Ga0495614_0189860 3300048089 Unclassified 927
319 Ga0496100_0487528 3300048903 Bacteria 948
320 Ga0496101_0064294 3300048904 Bacteria 2672
321 Ga0496102_0000492 3300048905 Bacteria 43621
322 Ga0496102_0096684 3300048905 Bacteria 2738
323 Ga0496102_0633943 3300048905 Bacteria 992
324 Ga0496103_0006237 3300048906 Bacteria 7127
325 Ga0496103_0123341 3300048906 Bacteria 1651
326 Ga0496104_0154958 3300048907 Bacteria 2199
327 Ga0496105_0133181 3300048908 Bacteria 2048
328 Ga0496106_0000969 3300048909 Bacteria 20944
329 Ga0496107_0002514 3300048910 Bacteria 11926
330 Ga0496107_0009828 3300048910 Bacteria 6635
331 Ga0496108_0055076 3300048911 Bacteria 3339
332 Ga0496109_0554568 3300048912 Bacteria 1084
333 Ga0496109_0860386 3300048912 Unclassified 844
334 Ga0496110_0026342 3300048913 Bacteria 4974
335 Ga0496111_0075998 3300048914 Bacteria 2447
336 Ga0496113_0048389 3300048916 Bacteria 3163
337 Ga0496114_0092514 3300048917 Bacteria 2569
338 Ga0496114_0274019 3300048917 Bacteria 1487
339 Ga0496114_1071885 3300048917 Unclassified 690
340 Ga0496115_0230764 3300048918 Bacteria 1526
341 Ga0501031_0287181 3300049568 Bacteria 1067
342 Ga0501033_0925651 3300049570 Unclassified 585
343 Ga0501033_0967261 3300049570 Unclassified 570
344 Ga0501038_0691269 3300049574 Bacteria 765
345 Ga0501042_0241964 3300049578 Bacteria 1302
346 Ga0501067_0033734 3300049583 Unclassified 2840
347 Ga0501067_0245854 3300049583 Unclassified 996
348 Ga0501069_0351421 3300049585 Bacteria 869
349 Ga0501071_0464181 3300049587 Bacteria 970
350 Ga0501072_0827646 3300049588 Unclassified 724
351 Ga0501075_0068091 3300049591 Unclassified 2689
352 Ga0501076_0019815 3300049592 Bacteria 5146
353 Ga0501076_0843115 3300049592 Unclassified 756
354 Ga0501076_1332367 3300049592 Unclassified 590
355 Ga0501079_0080307 3300049741 Bacteria 2522
356 Ga0501079_0102798 3300049741 Bacteria 2216
357 Ga0501080_0812843 3300049742 Bacteria 819
358 Ga0501045_0162472 3300049824 Bacteria 1663
359 Ga0501045_0609575 3300049824 Unclassified 808
360 nmdc:mga05p37_25259_c1 3300050507 Bacteria 7225
361 nmdc:mga05p37_29708_c1 3300050507 Bacteria 6669
362 nmdc:mga05p37_616612_c1 3300050507 Bacteria 1222
363 nmdc:mga08y16_554697_c1 3300050511 Bacteria 1162
364 nmdc:mga0n895_17230_c1 3300050512 Bacteria 6657
365 nmdc:mga0n895_223974_c1 3300050512 Bacteria 1909
366 nmdc:mga0n895_71459_c1 3300050512 Bacteria 3441
367 nmdc:mga0n895_80870_c1 3300050512 Bacteria 3238
368 nmdc:mga0n895_823539_c1 3300050512 Bacteria 917
369 nmdc:mga0rr50_11368_c1 3300050513 Bacteria 5696
370 nmdc:mga0rr50_602_c1 3300050513 Bacteria 19302
371 nmdc:mga08x19_100448_c1 3300050514 Bacteria 1919
372 nmdc:mga08x19_1119385_c1 3300050514 Unclassified 559
373 nmdc:mga0a205_1090032_c1 3300050515 Bacteria 646
374 nmdc:mga0a205_150133_c1 3300050515 Unclassified 894
375 nmdc:mga0a205_173699_c1 3300050515 Bacteria 2051
376 nmdc:mga0a205_3341_c1 3300050515 Bacteria 14293
377 Ga0495601_0057980 3300053077 Bacteria 2453
378 Ga0495612_0169700 3300053078 Bacteria 955
379 Ga0495595_0061236 3300053084 Bacteria 1762
380 Ga0495619_0833764 3300053085 Bacteria 622
381 Ga0501084_0111964 3300054114 Unclassified 2294
382 Ga0530510_0360807 3300061734 Bacteria 1092
383 Ga0530510_0554287 3300061734 Unclassified 873
384 Ga0105245_10590509
385 JGI26145J50221_1012776
386 JGI26138J51218_105477
387 Ga0065707_10813917
388 Ga0070690_100000155
389 Ga0070670_100053833
390 Ga0070677_10002820
391 Ga0068869_100032374
392 Ga0070666_10001188
393 Ga0070666_10244876
394 Ga0070660_100236159
395 Ga0070689_100039379
396 Ga0070689_100778474
397 Ga0070661_100377455
398 Ga0070692_10008929
399 Ga0070675_100029062
400 Ga0070673_100071090
401 Ga0070673_100636315
402 Ga0070688_100274780
403 Ga0070659_100542721
404 Ga0070667_100003267
405 Ga0070667_100592131
406 Ga0070667_101059945
407 Ga0070709_10219133
408 Ga0070710_10761872
409 Ga0070701_10074975
410 Ga0070705_100040797
411 Ga0070700_100039644
412 Ga0070694_100005856
413 Ga0070694_100127833
414 Ga0070708_100008266
415 Ga0070708_100028321
416 Ga0070708_101982579
417 Ga0070663_100007770
418 Ga0070663_100068791
419 Ga0070678_100243325
420 Ga0070678_102136026
421 Ga0070662_100030093
422 Ga0068867_100047826
423 Ga0068867_100444433
424 Ga0070706_100008167
425 Ga0070706_100014175
426 Ga0070706_100048950
427 Ga0070706_100593650
428 Ga0070706_100994190
429 Ga0070706_101982615
430 Ga0070706_102110009
431 Ga0070707_100010653
432 Ga0070707_100265332
433 Ga0070707_100962444
434 Ga0070707_100966840
435 Ga0070698_100001309
436 Ga0070698_100207700
437 Ga0070698_100207788
438 Ga0070699_100251847
439 Ga0070699_100443320
440 Ga0070699_100790807
441 Ga0070699_100953984
442 Ga0070699_101342757
443 Ga0070697_100000744
444 Ga0070697_100013990
445 Ga0070697_100071041
446 Ga0070697_101975532
447 Ga0068853_100180345
448 Ga0068853_100827875
449 Ga0070672_100004384
450 Ga0070672_100055548
451 Ga0070672_100139333
452 Ga0070686_100027557
453 Ga0070695_100084394
454 Ga0070695_100507562
455 Ga0070696_100036681
456 Ga0070696_100156545
457 Ga0070693_100045687
458 Ga0070665_100040501
459 Ga0070665_101631739
460 Ga0070704_100058778
461 Ga0070704_100080893
462 Ga0070704_100145373
463 Ga0070704_100347039
464 Ga0068854_100240662
465 Ga0068856_100087387
466 Ga0068856_101102376
467 Ga0070702_100054424
468 Ga0068859_100000011
469 Ga0068859_100001665
470 Ga0068859_100036997
471 Ga0068859_101001489
472 Ga0068864_100013150
473 Ga0068864_101404122
474 Ga0068866_10011159
475 Ga0068861_100025235
476 Ga0068870_10001866
477 Ga0068863_100009318
478 Ga0068863_100074462
479 Ga0068863_100099978
480 Ga0068858_100003180
481 Ga0068860_100010251
482 Ga0068860_100015495
483 Ga0068860_100338122
484 Ga0068860_100716329
485 Ga0068862_100115816
486 Ga0068862_100286496
487 Ga0068862_101681377
488 Ga0081455_10104127
489 Ga0070717_11821065
490 Ga0070715_10194599
491 Ga0070716_101078216
492 Ga0070712_100252067
493 Ga0070712_100299465
494 Ga0070712_100346191
495 Ga0097621_100042144
496 Ga0097621_100238250
497 Ga0097621_100339010
498 Ga0097621_100975977
499 Ga0068871_100407440
500 Ga0075428_101015755
501 Ga0075433_10009823
502 Ga0075433_10013829
503 Ga0075433_10144704
504 Ga0075433_10547628
505 Ga0075434_100000447
506 Ga0075434_100017468
507 Ga0075434_100049860
508 Ga0068865_100048033
509 Ga0075436_100062058
510 Ga0075436_100276731
511 Ga0075436_100526229
512 Ga0097620_100000011
513 Ga0097620_100001665
514 Ga0097620_100037005
515 Ga0097620_101001461
516 Ga0075435_100002545
517 Ga0075435_100215787
518 Ga0075435_101010194
519 Ga0111539_11890173
520 Ga0105245_10306018
521 Ga0105245_10361694
522 Ga0105247_10038434
523 Ga0114129_10010033
524 Ga0114129_10016999
525 Ga0114129_10048870
526 Ga0105243_10046459
527 Ga0105241_10015173
528 Ga0105241_10334575
529 Ga0105242_10342322
530 Ga0105242_10420445
531 Ga0105242_10964095
532 Ga0105248_10002020
533 Ga0105248_10202572
534 Ga0105237_10771346
535 Ga0105249_10017645
536 Ga0105249_10128031
537 Ga0163162_10004675
538 Ga0163162_10162679
539 Ga0163162_10980254
540 Ga0157375_10003622
541 Ga0157375_11427869
542 Ga0163163_10280484
543 Ga0157380_10319158
544 Ga0182008_10266863
545 Ga0157377_10267277
546 Ga0157379_10001795
547 Ga0157379_10036639
548 Ga0157376_10008796
549 Ga0157376_10031796
550 Ga0157376_10274181
551 Ga0207697_10046785
552 Ga0207697_10230023
553 Ga0207682_10001284
554 Ga0207692_10845889
555 Ga0207642_10003784
556 Ga0207710_10010853
557 Ga0207688_10011119
558 Ga0207680_10007693
559 Ga0207647_10426792
560 Ga0207647_10681862
561 Ga0207685_10621113
562 Ga0207699_10647401
563 Ga0207645_10011132
564 Ga0207643_10012986
565 Ga0207684_10004489
566 Ga0207684_10078349
567 Ga0207684_10112419
568 Ga0207684_10249547
569 Ga0207684_10551711
570 Ga0207684_10958489
571 Ga0207654_10132314
572 Ga0207693_10282282
573 Ga0207663_10581921
574 Ga0207662_10420981
575 Ga0207652_11329471
576 Ga0207646_10126613
577 Ga0207646_10133450
578 Ga0207646_10516742
579 Ga0207646_10520679
580 Ga0207681_10225678
581 Ga0207659_10022017
582 Ga0207687_10394764
583 Ga0207690_10216700
584 Ga0207706_10011248
585 Ga0207686_10119877
586 Ga0207686_10423986
587 Ga0207670_10021196
588 Ga0207670_10479460
589 Ga0207704_10035166
590 Ga0207665_10856198
591 Ga0207691_10007006
592 Ga0207691_10452997
593 Ga0207711_10000407
594 Ga0207689_10034771
595 Ga0207679_10123621
596 Ga0207667_10045125
597 Ga0207651_10025963
598 Ga0207651_11374891
599 Ga0207712_10019405
600 Ga0207640_10067935
601 Ga0207640_10161255
602 Ga0207658_10002290
603 Ga0207658_10303250
604 Ga0207658_10542318
605 Ga0207658_10573292
606 Ga0207703_10029346
607 Ga0207639_11704325
608 Ga0207678_10012139
609 Ga0207678_10014460
610 Ga0207678_10051812
611 Ga0207702_10009584
612 Ga0207641_10033498
613 Ga0207641_10033634
614 Ga0207641_10044891
615 Ga0207641_10092366
616 Ga0207648_10017790
617 Ga0207648_10394589
618 Ga0207674_10692552
619 Ga0207675_100022324
620 Ga0207675_100106106
621 Ga0207683_10070606
622 Ga0207683_10293739
623 Ga0209981_1013104
624 Ga0209995_1010086
625 Ga0209970_1000217
626 Ga0210002_1006194
627 Ga0209983_1015743
628 Ga0209971_1001401
629 Ga0209966_1010889
630 Ga0209974_10000145
631 Ga0268266_10115890
632 Ga0268266_10125712
633 Ga0268265_10317911
634 Ga0268265_10474405
635 Ga0268265_10522208
636 Ga0268264_10003027
637 Ga0268264_10077039
638 Ga0268264_10332610
639 Ga0268264_10710145
640 Ga0265330_10019291
641 Ga0265332_10136437
642 Ga0265329_10052826
643 Ga0265339_10142619
644 Ga0265331_10086799
645 Ga0265342_10061194
646 Ga0373940_0117602
647 Ga0373944_0305658
648 Ga0373951_0104740
649 Ga0373936_0407009
650 Ga0373943_0414186
651 Ga0373946_0027516
652 Ga0373955_0048859
653 Ga0373962_0038502
654 Ga0373924_0078778
655 Ga0373924_0227064
656 Ga0373937_0071995
657 Ga0373937_0267888
658 Ga0373925_0061527
659 Ga0451577_0164835
660 Ga0451577_1106227
661 Ga0451577_1687188
662 Ga0453684_0278641
663 Ga0451576_1069725
664 Ga0495603_0202004
665 Ga0495629_0043819
666 Ga0495629_0397405
667 Ga0495651_0462667
668 Ga0495580_0001599
669 Ga0495580_0034257
670 Ga0495580_0158443
671 Ga0495639_0140438
672 Ga0495662_0021843
673 Ga0495585_0281343
674 Ga0495594_0491809
675 Ga0495594_0712273
676 Ga0495618_0129068
677 Ga0495628_0281408
678 Ga0495630_0187539
679 Ga0495640_0033890
680 Ga0495586_0075669
681 Ga0495587_0766668
682 Ga0495645_0507176
683 Ga0495633_0130530
684 Ga0495634_0487262
685 Ga0495635_0019966
686 Ga0495635_0221117
687 Ga0495657_0325859
688 Ga0495599_0102959
689 Ga0495623_0285106
690 Ga0495647_0079243
691 Ga0495658_0011523
692 Ga0495658_0825189
693 Ga0495624_0227081
694 Ga0495600_0107203
695 Ga0495604_0128989
696 Ga0495674_1190699
697 Ga0495680_0311706
698 Ga0495684_0103122
699 Ga0495684_0294353
700 Ga0495602_0142850
701 Ga0495614_0189860
702 Ga0496100_0487528
703 Ga0496101_0064294
704 Ga0496102_0000492
705 Ga0496102_0096684
706 Ga0496102_0633943
707 Ga0496103_0006237
708 Ga0496103_0123341
709 Ga0496104_0154958
710 Ga0496105_0133181
711 Ga0496106_0000969
712 Ga0496107_0002514
713 Ga0496107_0009828
714 Ga0496108_0055076
715 Ga0496109_0554568
716 Ga0496109_0860386
717 Ga0496110_0026342
718 Ga0496111_0075998
719 Ga0496113_0048389
720 Ga0496114_0092514
721 Ga0496114_0274019
722 Ga0496114_1071885
723 Ga0496115_0230764
724 Ga0501031_0287181
725 Ga0501033_0925651
726 Ga0501033_0967261
727 Ga0501038_0691269
728 Ga0501042_0241964
729 Ga0501067_0033734
730 Ga0501067_0245854
731 Ga0501069_0351421
732 Ga0501071_0464181
733 Ga0501072_0827646
734 Ga0501075_0068091
735 Ga0501076_0019815
736 Ga0501076_0843115
737 Ga0501076_1332367
738 Ga0501079_0080307
739 Ga0501079_0102798
740 Ga0501080_0812843
741 Ga0501045_0162472
742 Ga0501045_0609575
743 nmdc:mga05p37_25259_c1
744 nmdc:mga05p37_29708_c1
745 nmdc:mga05p37_616612_c1
746 nmdc:mga08y16_554697_c1
747 nmdc:mga0n895_17230_c1
748 nmdc:mga0n895_223974_c1
749 nmdc:mga0n895_71459_c1
750 nmdc:mga0n895_80870_c1
751 nmdc:mga0n895_823539_c1
752 nmdc:mga0rr50_11368_c1
753 nmdc:mga0rr50_602_c1
754 nmdc:mga08x19_100448_c1
755 nmdc:mga08x19_1119385_c1
756 nmdc:mga0a205_1090032_c1
757 nmdc:mga0a205_150133_c1
758 nmdc:mga0a205_173699_c1
759 nmdc:mga0a205_3341_c1
760 Ga0495601_0057980
761 Ga0495612_0169700
762 Ga0495595_0061236
763 Ga0495619_0833764
764 Ga0501084_0111964
765 Ga0530510_0360807
766 Ga0530510_0554287

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01242

PTPS

6-pyruvoyl tetrahydropterin synthase

29

163

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
2dtt-assembly1.cif.gz_A crystal structure of 6-pyruvoyl tetrahydrobiopterin synthase from pyrococcus horikoshii ot3 complexed with (1'r,2's)-biopterin 0.9507 2 136
2dtt-assembly1.cif.gz_A crystal structure of 6-pyruvoyl tetrahydrobiopterin synthase from pyrococcus horikoshii ot3 complexed with (1'r,2's)-biopterin 0.9248 2 136
4ntm-assembly1.cif.gz_A qued soaked with sepiapterin (selenomethionine substituted protein) 0.9007 2 136
1b66-assembly1.cif.gz_A 6-pyruvoyl tetrahydropterin synthase 0.8795 2 135
3i2b-assembly3.cif.gz_I the crystal structure of human 6 pyruvoyl tetrahydrobiopterin synthase 0.878 2 135
ID Description Score Start End Superfamily
4ntmA00 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD 0.8968 1 136 3.30.479.10
4ntmA00 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD 0.8893 1 136 3.30.479.10
af_Q1ZXI0_1_135_3.30.479.10 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD 0.8793 2 135 3.30.479.10
2g64A00 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD 0.8676 2 136 3.30.479.10
af_Q2G1X5_11_135_3.30.479.10 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD 0.8523 2 136 3.30.479.10
ID Description Score Start End GO Terms
AF-A0A350BT81-F1-model_v4 6-carboxy-5,6,7,8-tetrahydropterin synthase (EC 4.1.2.50) (Queuosine biosynthesis protein QueD) 0.9363 37 137 GO:0046872
GO:0070497
AF-A0A6N6VWG2-F1-model_v4 6-carboxy-5,6,7,8-tetrahydropterin synthase (EC 4.-.-.-) 0.9349 1 136 GO:0008616
GO:0046872
GO:0070497
AF-A0A7X9PNH0-F1-model_v4 deleted 0.9343 37 136
AF-A0A2D4K2E0-F1-model_v4 6-pyruvoyl tetrahydrobiopterin synthase (EC 4.2.3.12) 0.9306 36 135 GO:0003874
GO:0005739
GO:0006729
GO:0046872
AF-A0A350BT81-F1-model_v4 6-carboxy-5,6,7,8-tetrahydropterin synthase (EC 4.1.2.50) (Queuosine biosynthesis protein QueD) 0.9271 37 137 GO:0046872
GO:0070497

Map