F429542

General Info

Members Datasets Scaffolds Average Seq Length
383 184 380 196

Family's Representative Sequence

Representative Sequence 3300006028|Ga0070717_10048614|Ga0070717_100486144
Length 226
Sequence MRRNASCAGERLGTDAEAGGPTKDGSGNFAMSKLRLIVGLGNPGAEHLRTRHNAGFWFIDALAQRERARFGNETKLHSETAKIVLDGTPLLLLKPTTFMNKSGIAIASALRYWKIAPEEMLVAHDDLDLPPGAARLKFDGGHGGQNGLRDIFAHLGHGMFHRLRLGIGHPGHKDRVTPWVLGRASVADEDAIVGAIAAALDVLPLVVAGETNEAMKRLHTSQDDSR

Samples

Sample ID Description Type Environment
1 2593339238 Luteibacter sp. UNCMF366Tsu5.1 Isolate Unclassified
2 2919404418 Luteibacter sp. 3190 Isolate Unclassified
3 2987605356 Stenotrophomonas sp. ATCM1_4 Isolate Unclassified
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
27 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
37 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
38 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
42 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
44 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
46 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
49 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
50 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
55 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
56 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
57 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
58 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
59 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
60 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
63 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
64 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
65 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
66 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
67 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
68 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
113 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
114 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
115 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
116 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
117 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
118 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
119 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
120 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
121 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
122 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
123 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
124 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
125 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
126 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
127 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
128 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
129 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
130 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
131 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
132 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
133 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
134 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
135 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
136 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
137 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
138 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
139 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
140 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
141 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
142 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
143 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
144 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
145 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
146 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
147 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
148 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
149 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
150 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
151 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
152 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
153 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
167 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
168 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
169 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
170 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
171 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
172 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
173 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
174 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
175 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
176 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
177 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
179 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
180 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
181 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
182 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
183 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
184 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.22
Metatranscriptomes 0
Isolates 0.78

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.31
Nodule 0
Rhizoplane 1.83
Rhizosphere 91.64
Stem 0
Stem Tuber 0
Unclassified 5.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100028827 3300005329 Bacteria 5021
2 Ga0070683_100728651 3300005329 Bacteria 950
3 Ga0070690_100294012 3300005330 Bacteria 1163
4 Ga0070670_101098584 3300005331 Bacteria 725
5 Ga0068869_100151633 3300005334 Bacteria 1798
6 Ga0068869_100455533 3300005334 Bacteria 1061
7 Ga0070666_10002156 3300005335 Bacteria 11961
8 Ga0070666_10011715 3300005335 Bacteria 5514
9 Ga0070666_10023274 3300005335 Bacteria 4032
10 Ga0070680_100256167 3300005336 Unclassified 1480
11 Ga0070680_100379474 3300005336 Bacteria 1203
12 Ga0068868_100027583 3300005338 Bacteria 4333
13 Ga0068868_100143218 3300005338 Bacteria 1964
14 Ga0068868_100932155 3300005338 Bacteria 791
15 Ga0070661_100027981 3300005344 Bacteria 4063
16 Ga0070668_100011386 3300005347 Bacteria 6626
17 Ga0070671_100162538 3300005355 Bacteria 1887
18 Ga0070671_100265316 3300005355 Bacteria 1459
19 Ga0070671_100293895 3300005355 Bacteria 1383
20 Ga0070659_100513424 3300005366 Bacteria 1022
21 Ga0070667_100013329 3300005367 Bacteria 6792
22 Ga0070667_100074615 3300005367 Bacteria 2894
23 Ga0070667_100111424 3300005367 Bacteria 2373
24 Ga0070667_100166506 3300005367 Bacteria 1944
25 Ga0070667_100173242 3300005367 Bacteria 1906
26 Ga0070711_100639552 3300005439 Bacteria 891
27 Ga0070678_100099678 3300005456 Bacteria 2248
28 Ga0070678_100273084 3300005456 Bacteria 1426
29 Ga0070662_100011960 3300005457 Bacteria 5740
30 Ga0070662_100118353 3300005457 Bacteria 2028
31 Ga0070681_10000006 3300005458 Bacteria 169066
32 Ga0070681_10195549 3300005458 Bacteria 1941
33 Ga0068867_100112503 3300005459 Bacteria 2093
34 Ga0068867_100825607 3300005459 Bacteria 829
35 Ga0070685_10052525 3300005466 Bacteria 2359
36 Ga0070707_100514808 3300005468 Bacteria 1159
37 Ga0070679_101056173 3300005530 Bacteria 757
38 Ga0070684_100042837 3300005535 Bacteria 3909
39 Ga0068853_100002998 3300005539 Bacteria 12884
40 Ga0068853_100080235 3300005539 Bacteria 2854
41 Ga0068853_100218937 3300005539 Bacteria 1738
42 Ga0068853_100366780 3300005539 Bacteria 1343
43 Ga0068853_100630277 3300005539 Bacteria 1019
44 Ga0068853_100652498 3300005539 Bacteria 1002
45 Ga0070696_100129962 3300005546 Bacteria 1832
46 Ga0070693_100165490 3300005547 Bacteria 1412
47 Ga0070665_100000618 3300005548 Bacteria 48757
48 Ga0070665_100149077 3300005548 Bacteria 2342
49 Ga0068855_100130229 3300005563 Bacteria 2874
50 Ga0068855_100982909 3300005563 Bacteria 888
51 Ga0068857_100023137 3300005577 Bacteria 5466
52 Ga0068857_100267497 3300005577 Bacteria 1570
53 Ga0068854_100003193 3300005578 Bacteria 10231
54 Ga0068856_100016673 3300005614 Bacteria 7115
55 Ga0068856_100199539 3300005614 Bacteria 2015
56 Ga0068852_100160401 3300005616 Bacteria 2099
57 Ga0068852_100163992 3300005616 Bacteria 2077
58 Ga0068852_100191740 3300005616 Bacteria 1929
59 Ga0068852_100366373 3300005616 Bacteria 1411
60 Ga0068859_100141870 3300005617 Bacteria 2476
61 Ga0068859_100489238 3300005617 Bacteria 1326
62 Ga0068864_100201000 3300005618 Bacteria 1831
63 Ga0068866_10644101 3300005718 Bacteria 721
64 Ga0068851_10000823 3300005834 Bacteria 13417
65 Ga0068863_100002342 3300005841 Bacteria 18834
66 Ga0068863_100148874 3300005841 Bacteria 2239
67 Ga0068863_100536299 3300005841 Bacteria 1155
68 Ga0068858_100010788 3300005842 Bacteria 8636
69 Ga0068858_100025712 3300005842 Bacteria 5476
70 Ga0068858_100590738 3300005842 Bacteria 1077
71 Ga0068860_100010719 3300005843 Bacteria 9050
72 Ga0070717_10048614 3300006028 Bacteria 3480
73 Ga0070717_10269608 3300006028 Bacteria 1508
74 Ga0097621_100058904 3300006237 Bacteria 3143
75 Ga0097621_100896106 3300006237 Bacteria 826
76 Ga0068871_100144728 3300006358 Bacteria 2023
77 Ga0068871_100197957 3300006358 Bacteria 1733
78 Ga0097620_100141877 3300006931 Bacteria 2476
79 Ga0097620_100489214 3300006931 Bacteria 1326
80 Ga0105240_10000196 3300009093 Bacteria 123276
81 Ga0105240_10000669 3300009093 Bacteria 62916
82 Ga0105240_10349569 3300009093 Bacteria 1678
83 Ga0105240_10821608 3300009093 Bacteria 1005
84 Ga0111539_10415086 3300009094 Bacteria 1568
85 Ga0114129_10075148 3300009147 Bacteria 4705
86 Ga0105241_10006989 3300009174 Bacteria 8305
87 Ga0105241_10010402 3300009174 Bacteria 6827
88 Ga0105241_10237198 3300009174 Bacteria 1540
89 Ga0105241_10546736 3300009174 Bacteria 1039
90 Ga0105242_10000813 3300009176 Bacteria 24225
91 Ga0105242_10242754 3300009176 Bacteria 1620
92 Ga0105242_11248320 3300009176 Bacteria 764
93 Ga0105242_11549045 3300009176 Bacteria 695
94 Ga0105237_10047289 3300009545 Bacteria 4325
95 Ga0105237_10059383 3300009545 Bacteria 3826
96 Ga0105237_10280168 3300009545 Bacteria 1670
97 Ga0105237_10451554 3300009545 Bacteria 1291
98 Ga0105238_10007633 3300009551 Bacteria 10834
99 Ga0105238_10193735 3300009551 Bacteria 2008
100 Ga0105249_10012093 3300009553 Bacteria 7598
101 Ga0105239_10036523 3300010375 Bacteria 5395
102 Ga0105239_10047387 3300010375 Bacteria 4710
103 Ga0105239_10052649 3300010375 Bacteria 4464
104 Ga0105239_10402123 3300010375 Bacteria 1550
105 Ga0105239_10855393 3300010375 Bacteria 1043
106 Ga0105246_10010826 3300011119 Bacteria 5652
107 Ga0105246_10037275 3300011119 Bacteria 3263
108 Ga0105246_10786723 3300011119 Bacteria 843
109 Ga0157373_10027883 3300013100 Bacteria 4074
110 Ga0157373_10030671 3300013100 Bacteria 3868
111 Ga0157373_10174467 3300013100 Bacteria 1513
112 Ga0157373_10378625 3300013100 Bacteria 1012
113 Ga0157373_10397487 3300013100 Bacteria 987
114 Ga0157370_10040517 3300013104 Bacteria 4497
115 Ga0157370_10137864 3300013104 Bacteria 2273
116 Ga0157370_10153350 3300013104 Bacteria 2143
117 Ga0157370_10797778 3300013104 Bacteria 859
118 Ga0157369_10000030 3300013105 Bacteria 203569
119 Ga0157369_10227591 3300013105 Bacteria 1950
120 Ga0157374_10067127 3300013296 Bacteria 3371
121 Ga0157374_11301504 3300013296 Bacteria 749
122 Ga0163162_10002434 3300013306 Bacteria 17540
123 Ga0163162_10125069 3300013306 Bacteria 2677
124 Ga0163162_10294461 3300013306 Bacteria 1755
125 Ga0163162_10325527 3300013306 Bacteria 1669
126 Ga0163162_10362994 3300013306 Bacteria 1581
127 Ga0163162_11664692 3300013306 Bacteria 728
128 Ga0157372_10019283 3300013307 Bacteria 7345
129 Ga0157372_10321408 3300013307 Bacteria 1802
130 Ga0157372_10626376 3300013307 Bacteria 1253
131 Ga0157375_10001441 3300013308 Bacteria 20462
132 Ga0157375_10128089 3300013308 Bacteria 2656
133 Ga0157375_10283688 3300013308 Bacteria 1819
134 Ga0157375_11092602 3300013308 Bacteria 933
135 Ga0157375_11886202 3300013308 Bacteria 709
136 Ga0163163_10000304 3300014325 Bacteria 48244
137 Ga0163163_10001631 3300014325 Bacteria 18871
138 Ga0163163_10312651 3300014325 Bacteria 1624
139 Ga0182008_10357985 3300014497 Bacteria 775
140 Ga0157379_10001561 3300014968 Bacteria 18868
141 Ga0157379_10182055 3300014968 Bacteria 1898
142 Ga0157379_10192200 3300014968 Bacteria 1844
143 Ga0157379_10813612 3300014968 Bacteria 882
144 Ga0157376_10003935 3300014969 Bacteria 10273
145 Ga0157376_10016496 3300014969 Bacteria 5610
146 Ga0157376_10019364 3300014969 Bacteria 5245
147 Ga0157376_10398480 3300014969 Bacteria 1330
148 Ga0157376_10503077 3300014969 Bacteria 1191
149 Ga0157376_10668543 3300014969 Bacteria 1041
150 Ga0163161_10413553 3300017792 Bacteria 1084
151 Ga0209233_1001577 3300025261 Bacteria 8921
152 Ga0207697_10033856 3300025315 Bacteria 2091
153 Ga0207656_10000623 3300025321 Bacteria 11605
154 Ga0207680_10002673 3300025903 Bacteria 8337
155 Ga0207680_10252169 3300025903 Bacteria 1219
156 Ga0207647_10000286 3300025904 Bacteria 41390
157 Ga0207647_10004467 3300025904 Bacteria 10367
158 Ga0207699_10442032 3300025906 Bacteria 932
159 Ga0207705_10122790 3300025909 Bacteria 1929
160 Ga0207654_10000464 3300025911 Bacteria 23191
161 Ga0207654_10014364 3300025911 Bacteria 4090
162 Ga0207707_10001644 3300025912 Bacteria 20616
163 Ga0207695_10000014 3300025913 Bacteria 812599
164 Ga0207695_10000320 3300025913 Bacteria 116097
165 Ga0207695_10000355 3300025913 Bacteria 105211
166 Ga0207695_10000554 3300025913 Bacteria 76895
167 Ga0207695_10021758 3300025913 Bacteria 7305
168 Ga0207695_10117727 3300025913 Bacteria 2629
169 Ga0207671_10048036 3300025914 Bacteria 3159
170 Ga0207671_10282223 3300025914 Bacteria 1310
171 Ga0207657_10009366 3300025919 Bacteria 9849
172 Ga0207649_10072121 3300025920 Bacteria 2208
173 Ga0207649_10704878 3300025920 Bacteria 783
174 Ga0207649_10748846 3300025920 Bacteria 760
175 Ga0207652_10676083 3300025921 Bacteria 922
176 Ga0207694_10008000 3300025924 Bacteria 7994
177 Ga0207694_10040276 3300025924 Bacteria 3596
178 Ga0207694_10069613 3300025924 Bacteria 2749
179 Ga0207694_10121564 3300025924 Bacteria 2085
180 Ga0207694_10374574 3300025924 Bacteria 1181
181 Ga0207650_10070270 3300025925 Bacteria 2631
182 Ga0207650_10714545 3300025925 Bacteria 847
183 Ga0207659_10571637 3300025926 Bacteria 962
184 Ga0207644_10771098 3300025931 Bacteria 804
185 Ga0207644_11107658 3300025931 Bacteria 665
186 Ga0207706_10005842 3300025933 Bacteria 11443
187 Ga0207706_10077082 3300025933 Bacteria 2932
188 Ga0207706_10092139 3300025933 Bacteria 2665
189 Ga0207686_10000869 3300025934 Bacteria 18279
190 Ga0207686_10013084 3300025934 Bacteria 4582
191 Ga0207669_10103455 3300025937 Bacteria 1889
192 Ga0207704_10060621 3300025938 Bacteria 2342
193 Ga0207704_10088730 3300025938 Bacteria 2024
194 Ga0207691_10112533 3300025940 Bacteria 2419
195 Ga0207711_10061373 3300025941 Bacteria 3241
196 Ga0207689_10052582 3300025942 Bacteria 3356
197 Ga0207689_10101084 3300025942 Bacteria 2368
198 Ga0207661_10094331 3300025944 Bacteria 2499
199 Ga0207661_10554450 3300025944 Bacteria 1053
200 Ga0207667_10015023 3300025949 Bacteria 8808
201 Ga0207667_10105646 3300025949 Bacteria 2905
202 Ga0207667_10335182 3300025949 Bacteria 1544
203 Ga0207667_10373303 3300025949 Bacteria 1453
204 Ga0207712_10001772 3300025961 Bacteria 14399
205 Ga0207668_10052150 3300025972 Bacteria 2829
206 Ga0207640_10007385 3300025981 Bacteria 6067
207 Ga0207640_10166185 3300025981 Bacteria 1639
208 Ga0207658_10017016 3300025986 Bacteria 5005
209 Ga0207658_10171212 3300025986 Bacteria 1789
210 Ga0207658_10425494 3300025986 Bacteria 1172
211 Ga0207658_11368130 3300025986 Bacteria 647
212 Ga0207677_10024307 3300026023 Bacteria 3762
213 Ga0207677_10092920 3300026023 Bacteria 2198
214 Ga0207677_10133339 3300026023 Bacteria 1890
215 Ga0207703_10006406 3300026035 Bacteria 9410
216 Ga0207703_10067885 3300026035 Bacteria 2936
217 Ga0207703_10482003 3300026035 Bacteria 1162
218 Ga0207639_10002067 3300026041 Bacteria 13537
219 Ga0207639_10002553 3300026041 Bacteria 12218
220 Ga0207639_10103517 3300026041 Bacteria 2306
221 Ga0207639_10662849 3300026041 Bacteria 966
222 Ga0207639_10867324 3300026041 Bacteria 843
223 Ga0207678_10018910 3300026067 Bacteria 6053
224 Ga0207678_10119194 3300026067 Bacteria 2252
225 Ga0207678_10185147 3300026067 Bacteria 1778
226 Ga0207678_10243983 3300026067 Bacteria 1538
227 Ga0207702_10055511 3300026078 Bacteria 3359
228 Ga0207702_10058477 3300026078 Bacteria 3281
229 Ga0207641_10007225 3300026088 Bacteria 9253
230 Ga0207641_10212077 3300026088 Bacteria 1791
231 Ga0207641_10220308 3300026088 Bacteria 1759
232 Ga0207648_10073281 3300026089 Bacteria 2985
233 Ga0207648_10157520 3300026089 Bacteria 2005
234 Ga0207676_10212188 3300026095 Bacteria 1718
235 Ga0207676_11148866 3300026095 Bacteria 769
236 Ga0207674_10024711 3300026116 Bacteria 6414
237 Ga0207683_10012612 3300026121 Bacteria 7210
238 Ga0207683_10030853 3300026121 Bacteria 4648
239 Ga0207698_10021710 3300026142 Bacteria 4446
240 Ga0207698_10122954 3300026142 Bacteria 2200
241 Ga0207698_10253187 3300026142 Bacteria 1613
242 Ga0268266_10000013 3300028379 Bacteria 649715
243 Ga0268266_11035184 3300028379 Bacteria 794
244 Ga0268265_10105343 3300028380 Bacteria 2288
245 Ga0268264_10026003 3300028381 Bacteria 4779
246 Ga0268264_10084521 3300028381 Bacteria 2721
247 Ga0268264_10128953 3300028381 Bacteria 2239
248 Ga0307513_10166374 3300031456 Bacteria 2089
249 Ga0307408_100037261 3300031548 Bacteria 3425
250 Ga0307408_100838467 3300031548 Bacteria 837
251 Ga0307516_10166083 3300031730 Bacteria 1952
252 Ga0307516_10203404 3300031730 Bacteria 1698
253 Ga0307405_10063351 3300031731 Bacteria 2345
254 Ga0307416_100015716 3300032002 Bacteria 5237
255 Ga0307414_10101508 3300032004 Bacteria 2166
256 Ga0307414_10195190 3300032004 Bacteria 1641
257 Ga0307414_10491103 3300032004 Bacteria 1084
258 Ga0307507_10144289 3300033179 Bacteria 1814
259 Ga0373944_0006864 3300035089 Bacteria 3036
260 Ga0373955_0494194 3300035172 Bacteria 747
261 Ga0373933_0101778 3300035724 Bacteria 1783
262 Ga0373937_0006199 3300036401 Bacteria 10300
263 Ga0395900_0000142 3300037418 Bacteria 120365
264 Ga0395898_0173477 3300037466 Bacteria 2061
265 Ga0451793_0559891 3300041452 Bacteria 1226
266 Ga0451795_0389564 3300041456 Bacteria 1181
267 Ga0451807_1144360 3300041486 Bacteria 1789
268 Ga0451833_0256678 3300041491 Bacteria 662
269 Ga0451853_0910535 3300041512 Bacteria 772
270 Ga0451853_0947021 3300041512 Bacteria 1004
271 Ga0451853_3471180 3300041512 Bacteria 1152
272 Ga0439448_0207603 3300042005 Bacteria 687
273 Ga0439457_032692 3300042014 Bacteria 1155
274 Ga0453684_0008623 3300044712 Bacteria 18158
275 Ga0466967_0712095 3300045976 Bacteria 995
276 Ga0495580_0018411 3300046472 Bacteria 5201
277 Ga0495639_0190919 3300046475 Bacteria 1000
278 Ga0495587_0030772 3300046536 Bacteria 3255
279 Ga0495623_0293740 3300046679 Bacteria 900
280 Ga0495647_0008650 3300046681 Bacteria 3426
281 Ga0495658_0006384 3300046683 Bacteria 5792
282 Ga0495613_0397350 3300046689 Bacteria 941
283 Ga0495686_0122926 3300047472 Bacteria 1545
284 Ga0496104_0000058 3300048907 Bacteria 118768
285 Ga0496105_0000021 3300048908 Bacteria 164255
286 Ga0496108_0066148 3300048911 Bacteria 3048
287 Ga0496115_0000256 3300048918 Bacteria 47176
288 Ga0496117_0069079 3300048920 Bacteria 2381
289 Ga0496118_0006029 3300048921 Bacteria 13501
290 Ga0496118_0013165 3300048921 Bacteria 7849
291 Ga0496121_0133122 3300048924 Bacteria 1857
292 Ga0496122_0000903 3300048925 Bacteria 54843
293 Ga0496123_0000702 3300048926 Bacteria 54737
294 Ga0496125_0003336 3300048928 Bacteria 19575
295 Ga0496126_0000033 3300048929 Bacteria 368851
296 Ga0496126_0214127 3300048929 Bacteria 1621
297 Ga0501032_0125118 3300049569 Bacteria 1698
298 Ga0501032_0306894 3300049569 Bacteria 1025
299 Ga0501033_0006402 3300049570 Bacteria 9222
300 Ga0501033_0015482 3300049570 Bacteria 5784
301 Ga0501034_0000667 3300049571 Bacteria 52322
302 Ga0501034_0105325 3300049571 Bacteria 2813
303 Ga0501034_0253854 3300049571 Bacteria 1702
304 Ga0501034_0697887 3300049571 Bacteria 913
305 Ga0501036_0049772 3300049572 Bacteria 3549
306 Ga0501036_0063669 3300049572 Bacteria 3122
307 Ga0501037_0011887 3300049573 Bacteria 6411
308 Ga0501037_0131086 3300049573 Bacteria 1797
309 Ga0501037_0244912 3300049573 Bacteria 1256
310 Ga0501038_0010941 3300049574 Bacteria 8288
311 Ga0501038_0097801 3300049574 Bacteria 2448
312 Ga0501039_0014243 3300049575 Bacteria 6088
313 Ga0501039_0203586 3300049575 Bacteria 1556
314 Ga0501040_0066133 3300049576 Bacteria 2491
315 Ga0501042_0338861 3300049578 Bacteria 1087
316 Ga0501043_0065796 3300049579 Bacteria 2846
317 Ga0501043_0158824 3300049579 Bacteria 1767
318 Ga0501043_0552230 3300049579 Bacteria 855
319 Ga0501046_0026450 3300049580 Bacteria 4739
320 Ga0501046_0038747 3300049580 Bacteria 3822
321 Ga0501046_0281409 3300049580 Bacteria 1218
322 Ga0501047_0007796 3300049581 Bacteria 10079
323 Ga0501047_0017221 3300049581 Bacteria 6918
324 Ga0501047_0024889 3300049581 Bacteria 5748
325 Ga0501047_0187513 3300049581 Bacteria 1933
326 Ga0501047_0296150 3300049581 Bacteria 1461
327 Ga0501048_0486661 3300049582 Bacteria 884
328 Ga0501067_0000302 3300049583 Bacteria 27181
329 Ga0501067_0008878 3300049583 Bacteria 5568
330 Ga0501068_0008523 3300049584 Bacteria 5709
331 Ga0501068_0021267 3300049584 Bacteria 3787
332 Ga0501068_0067875 3300049584 Bacteria 2173
333 Ga0501069_0024529 3300049585 Bacteria 3290
334 Ga0501069_0201546 3300049585 Bacteria 1153
335 Ga0501070_0000933 3300049586 Bacteria 26357
336 Ga0501070_0041554 3300049586 Bacteria 3830
337 Ga0501070_0086351 3300049586 Bacteria 2597
338 Ga0501070_0344000 3300049586 Bacteria 1211
339 Ga0501071_0045454 3300049587 Bacteria 3152
340 Ga0501071_0112182 3300049587 Bacteria 2016
341 Ga0501072_0000451 3300049588 Bacteria 29591
342 Ga0501073_0003883 3300049589 Bacteria 11221
343 Ga0501073_0012317 3300049589 Bacteria 6239
344 Ga0501073_0073917 3300049589 Bacteria 2373
345 Ga0501073_0175186 3300049589 Bacteria 1484
346 Ga0501073_0182270 3300049589 Bacteria 1453
347 Ga0501073_0455304 3300049589 Bacteria 884
348 Ga0501074_0016648 3300049590 Bacteria 5335
349 Ga0501074_0047461 3300049590 Bacteria 3104
350 Ga0501074_0057179 3300049590 Bacteria 2810
351 Ga0501074_0107926 3300049590 Bacteria 1992
352 Ga0501074_0669731 3300049590 Bacteria 733
353 Ga0501079_0079404 3300049741 Bacteria 2537
354 Ga0501079_0124865 3300049741 Bacteria 2002
355 Ga0501079_0251463 3300049741 Bacteria 1381
356 Ga0501079_0483375 3300049741 Bacteria 973
357 Ga0501079_0850202 3300049741 Bacteria 718
358 Ga0501080_0000563 3300049742 Bacteria 29308
359 Ga0501080_0010517 3300049742 Bacteria 8471
360 Ga0501080_0023918 3300049742 Bacteria 5663
361 Ga0501080_0041578 3300049742 Bacteria 4282
362 Ga0501080_0063245 3300049742 Bacteria 3444
363 Ga0501083_0022759 3300049744 Bacteria 4348
364 Ga0501083_0141936 3300049744 Bacteria 1573
365 Ga0501083_0202499 3300049744 Bacteria 1294
366 Ga0501035_0063697 3300049822 Bacteria 3278
367 Ga0501035_0452037 3300049822 Bacteria 1062
368 Ga0501044_0003300 3300049823 Bacteria 18183
369 Ga0501044_0015741 3300049823 Bacteria 8145
370 Ga0501044_0111280 3300049823 Bacteria 2746
371 Ga0500651_0000131 3300053093 Bacteria 46394
372 Ga0500557_047659 3300053105 Bacteria 1365
373 Ga0500588_0033920 3300053146 Bacteria 1492
374 Ga0501084_0047300 3300054114 Bacteria 3603
375 Ga0501084_0078889 3300054114 Bacteria 2760
376 Ga0501084_0116992 3300054114 Bacteria 2241
377 Ga0500661_006273 3300055283 Bacteria 2215
378 Ga0501082_0001536 3300060353 Bacteria 20328
379 Ga0501082_0116394 3300060353 Bacteria 2315
380 Ga0501082_0201094 3300060353 Bacteria 1733

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005336 Ga0070680_100256167 Ga0070680_1002561672 165
2 3300055283 Ga0500661_006273 Ga0500661_006273_1484_2089 176
3 3300042005 Ga0439448_0207603 Ga0439448_0207603_33_638 182
4 3300048928 Ga0496125_0003336 Ga0496125_0003336_2888_3469 182
5 3300013104 Ga0157370_10040517 Ga0157370_100405177 183
6 3300049571 Ga0501034_0105325 Ga0501034_0105325_467_1048 183
7 3300049573 Ga0501037_0244912 Ga0501037_0244912_142_723 183
8 3300049581 Ga0501047_0187513 Ga0501047_0187513_175_756 183
9 3300049586 Ga0501070_0086351 Ga0501070_0086351_1080_1661 183
10 3300049589 Ga0501073_0073917 Ga0501073_0073917_798_1379 183
11 3300049590 Ga0501074_0016648 Ga0501074_0016648_3521_4102 183
12 3300049741 Ga0501079_0124865 Ga0501079_0124865_426_1007 183
13 3300049742 Ga0501080_0023918 Ga0501080_0023918_3799_4380 183
14 3300044712 Ga0453684_0008623 Ga0453684_0008623_2696_3250 184
15 3300031548 Ga0307408_100037261 Ga0307408_1000372612 185
16 3300031731 Ga0307405_10063351 Ga0307405_100633513 185
17 3300032002 Ga0307416_100015716 Ga0307416_1000157166 185
18 3300045976 Ga0466967_0712095 Ga0466967_0712095_213_806 187
19 iso_pu_bacteria 2593339238 2595448033 188
20 iso_pu_bacteria 2919404418 2919408083 188
21 3300009093 Ga0105240_10000196 Ga0105240_1000019658 189
22 3300009147 Ga0114129_10075148 Ga0114129_100751484 189
23 3300025913 Ga0207695_10000554 Ga0207695_1000055421 189
24 iso_pu_bacteria 2987605356 2987607969 189
25 3300005468 Ga0070707_100514808 Ga0070707_1005148082 191
26 3300010375 Ga0105239_10036523 Ga0105239_100365232 191
27 3300013296 Ga0157374_10067127 Ga0157374_100671273 191
28 3300048918 Ga0496115_0000256 Ga0496115_0000256_28594_29169 191
29 3300048920 Ga0496117_0069079 Ga0496117_0069079_1302_1877 191
30 3300048921 Ga0496118_0006029 Ga0496118_0006029_2838_3413 191
31 3300048924 Ga0496121_0133122 Ga0496121_0133122_278_853 191
32 3300048929 Ga0496126_0000033 Ga0496126_0000033_25540_26115 191
33 3300048929 Ga0496126_0214127 Ga0496126_0214127_195_770 191
34 3300005458 Ga0070681_10000006 Ga0070681_10000006156 192
35 3300006028 Ga0070717_10269608 Ga0070717_102696082 192
36 3300013100 Ga0157373_10030671 Ga0157373_100306711 192
37 3300025912 Ga0207707_10001644 Ga0207707_100016448 192
38 3300032004 Ga0307414_10101508 Ga0307414_101015082 192
39 3300005329 Ga0070683_100028827 Ga0070683_1000288275 193
40 3300005329 Ga0070683_100728651 Ga0070683_1007286511 193
41 3300005330 Ga0070690_100294012 Ga0070690_1002940121 193
42 3300005331 Ga0070670_101098584 Ga0070670_1010985841 193
43 3300005334 Ga0068869_100151633 Ga0068869_1001516331 193
44 3300005334 Ga0068869_100455533 Ga0068869_1004555331 193
45 3300005335 Ga0070666_10002156 Ga0070666_1000215611 193
46 3300005335 Ga0070666_10011715 Ga0070666_100117155 193
47 3300005335 Ga0070666_10023274 Ga0070666_100232745 193
48 3300005336 Ga0070680_100379474 Ga0070680_1003794742 193
49 3300005338 Ga0068868_100027583 Ga0068868_1000275832 193
50 3300005338 Ga0068868_100143218 Ga0068868_1001432182 193
51 3300005338 Ga0068868_100932155 Ga0068868_1009321551 193
52 3300005344 Ga0070661_100027981 Ga0070661_1000279811 193
53 3300005347 Ga0070668_100011386 Ga0070668_1000113867 193
54 3300005355 Ga0070671_100162538 Ga0070671_1001625382 193
55 3300005355 Ga0070671_100265316 Ga0070671_1002653161 193
56 3300005355 Ga0070671_100293895 Ga0070671_1002938952 193
57 3300005366 Ga0070659_100513424 Ga0070659_1005134242 193
58 3300005367 Ga0070667_100013329 Ga0070667_1000133291 193
59 3300005367 Ga0070667_100074615 Ga0070667_1000746154 193
60 3300005367 Ga0070667_100111424 Ga0070667_1001114242 193
61 3300005367 Ga0070667_100166506 Ga0070667_1001665063 193
62 3300005367 Ga0070667_100173242 Ga0070667_1001732422 193
63 3300005439 Ga0070711_100639552 Ga0070711_1006395521 193
64 3300005456 Ga0070678_100099678 Ga0070678_1000996782 193
65 3300005456 Ga0070678_100273084 Ga0070678_1002730842 193
66 3300005457 Ga0070662_100011960 Ga0070662_1000119605 193
67 3300005457 Ga0070662_100118353 Ga0070662_1001183532 193
68 3300005458 Ga0070681_10195549 Ga0070681_101955492 193
69 3300005459 Ga0068867_100112503 Ga0068867_1001125032 193
70 3300005459 Ga0068867_100825607 Ga0068867_1008256071 193
71 3300005466 Ga0070685_10052525 Ga0070685_100525252 193
72 3300005530 Ga0070679_101056173 Ga0070679_1010561731 193
73 3300005535 Ga0070684_100042837 Ga0070684_1000428373 193
74 3300005539 Ga0068853_100002998 Ga0068853_10000299810 193
75 3300005539 Ga0068853_100080235 Ga0068853_1000802353 193
76 3300005539 Ga0068853_100218937 Ga0068853_1002189372 193
77 3300005539 Ga0068853_100366780 Ga0068853_1003667802 193
78 3300005539 Ga0068853_100630277 Ga0068853_1006302771 193
79 3300005539 Ga0068853_100652498 Ga0068853_1006524982 193
80 3300005546 Ga0070696_100129962 Ga0070696_1001299622 193
81 3300005547 Ga0070693_100165490 Ga0070693_1001654902 193
82 3300005548 Ga0070665_100000618 Ga0070665_1000006182 193
83 3300005548 Ga0070665_100149077 Ga0070665_1001490772 193
84 3300005563 Ga0068855_100130229 Ga0068855_1001302294 193
85 3300005563 Ga0068855_100982909 Ga0068855_1009829091 193
86 3300005577 Ga0068857_100023137 Ga0068857_1000231372 193
87 3300005577 Ga0068857_100267497 Ga0068857_1002674972 193
88 3300005578 Ga0068854_100003193 Ga0068854_1000031939 193
89 3300005614 Ga0068856_100016673 Ga0068856_1000166737 193
90 3300005614 Ga0068856_100199539 Ga0068856_1001995393 193
91 3300005616 Ga0068852_100160401 Ga0068852_1001604013 193
92 3300005616 Ga0068852_100163992 Ga0068852_1001639923 193
93 3300005616 Ga0068852_100191740 Ga0068852_1001917402 193
94 3300005616 Ga0068852_100366373 Ga0068852_1003663732 193
95 3300005617 Ga0068859_100141870 Ga0068859_1001418703 193
96 3300005617 Ga0068859_100489238 Ga0068859_1004892382 193
97 3300005618 Ga0068864_100201000 Ga0068864_1002010002 193
98 3300005718 Ga0068866_10644101 Ga0068866_106441011 193
99 3300005834 Ga0068851_10000823 Ga0068851_100008233 193
100 3300005841 Ga0068863_100002342 Ga0068863_10000234215 193
101 3300005841 Ga0068863_100148874 Ga0068863_1001488742 193
102 3300005841 Ga0068863_100536299 Ga0068863_1005362991 193
103 3300005842 Ga0068858_100010788 Ga0068858_1000107883 193
104 3300005842 Ga0068858_100025712 Ga0068858_1000257125 193
105 3300005842 Ga0068858_100590738 Ga0068858_1005907381 193
106 3300005843 Ga0068860_100010719 Ga0068860_1000107196 193
107 3300006028 Ga0070717_10048614 Ga0070717_100486144 193
108 3300006237 Ga0097621_100058904 Ga0097621_1000589043 193
109 3300006237 Ga0097621_100896106 Ga0097621_1008961061 193
110 3300006358 Ga0068871_100144728 Ga0068871_1001447283 193
111 3300006358 Ga0068871_100197957 Ga0068871_1001979572 193
112 3300006931 Ga0097620_100141877 Ga0097620_1001418771 193
113 3300006931 Ga0097620_100489214 Ga0097620_1004892142 193
114 3300009093 Ga0105240_10000669 Ga0105240_1000066911 193
115 3300009093 Ga0105240_10349569 Ga0105240_103495692 193
116 3300009093 Ga0105240_10821608 Ga0105240_108216081 193
117 3300009094 Ga0111539_10415086 Ga0111539_104150862 193
118 3300009174 Ga0105241_10006989 Ga0105241_100069899 193
119 3300009174 Ga0105241_10010402 Ga0105241_100104027 193
120 3300009174 Ga0105241_10237198 Ga0105241_102371982 193
121 3300009174 Ga0105241_10546736 Ga0105241_105467362 193
122 3300009176 Ga0105242_10000813 Ga0105242_1000081324 193
123 3300009176 Ga0105242_10242754 Ga0105242_102427542 193
124 3300009176 Ga0105242_11248320 Ga0105242_112483201 193
125 3300009176 Ga0105242_11549045 Ga0105242_115490451 193
126 3300009545 Ga0105237_10047289 Ga0105237_100472895 193
127 3300009545 Ga0105237_10059383 Ga0105237_100593832 193
128 3300009545 Ga0105237_10280168 Ga0105237_102801682 193
129 3300009545 Ga0105237_10451554 Ga0105237_104515542 193
130 3300009551 Ga0105238_10007633 Ga0105238_1000763311 193
131 3300009551 Ga0105238_10193735 Ga0105238_101937352 193
132 3300009553 Ga0105249_10012093 Ga0105249_100120938 193
133 3300010375 Ga0105239_10047387 Ga0105239_100473875 193
134 3300010375 Ga0105239_10052649 Ga0105239_100526494 193
135 3300010375 Ga0105239_10402123 Ga0105239_104021231 193
136 3300010375 Ga0105239_10855393 Ga0105239_108553932 193
137 3300011119 Ga0105246_10010826 Ga0105246_100108267 193
138 3300011119 Ga0105246_10037275 Ga0105246_100372755 193
139 3300011119 Ga0105246_10786723 Ga0105246_107867231 193
140 3300013100 Ga0157373_10027883 Ga0157373_100278832 193
141 3300013100 Ga0157373_10174467 Ga0157373_101744672 193
142 3300013100 Ga0157373_10378625 Ga0157373_103786252 193
143 3300013100 Ga0157373_10397487 Ga0157373_103974871 193
144 3300013104 Ga0157370_10137864 Ga0157370_101378643 193
145 3300013104 Ga0157370_10153350 Ga0157370_101533502 193
146 3300013104 Ga0157370_10797778 Ga0157370_107977782 193
147 3300013105 Ga0157369_10000030 Ga0157369_10000030181 193
148 3300013105 Ga0157369_10227591 Ga0157369_102275912 193
149 3300013296 Ga0157374_11301504 Ga0157374_113015041 193
150 3300013306 Ga0163162_10002434 Ga0163162_100024342 193
151 3300013306 Ga0163162_10125069 Ga0163162_101250693 193
152 3300013306 Ga0163162_10294461 Ga0163162_102944612 193
153 3300013306 Ga0163162_10325527 Ga0163162_103255272 193
154 3300013306 Ga0163162_10362994 Ga0163162_103629942 193
155 3300013306 Ga0163162_11664692 Ga0163162_116646921 193
156 3300013307 Ga0157372_10019283 Ga0157372_100192837 193
157 3300013307 Ga0157372_10321408 Ga0157372_103214082 193
158 3300013307 Ga0157372_10626376 Ga0157372_106263762 193
159 3300013308 Ga0157375_10001441 Ga0157375_1000144116 193
160 3300013308 Ga0157375_10128089 Ga0157375_101280894 193
161 3300013308 Ga0157375_10283688 Ga0157375_102836882 193
162 3300013308 Ga0157375_11092602 Ga0157375_110926022 193
163 3300013308 Ga0157375_11886202 Ga0157375_118862021 193
164 3300014325 Ga0163163_10000304 Ga0163163_1000030415 193
165 3300014325 Ga0163163_10001631 Ga0163163_100016317 193
166 3300014325 Ga0163163_10312651 Ga0163163_103126512 193
167 3300014497 Ga0182008_10357985 Ga0182008_103579851 193
168 3300014968 Ga0157379_10001561 Ga0157379_100015617 193
169 3300014968 Ga0157379_10182055 Ga0157379_101820552 193
170 3300014968 Ga0157379_10192200 Ga0157379_101922002 193
171 3300014968 Ga0157379_10813612 Ga0157379_108136121 193
172 3300014969 Ga0157376_10003935 Ga0157376_100039356 193
173 3300014969 Ga0157376_10016496 Ga0157376_100164966 193
174 3300014969 Ga0157376_10019364 Ga0157376_100193645 193
175 3300014969 Ga0157376_10398480 Ga0157376_103984802 193
176 3300014969 Ga0157376_10503077 Ga0157376_105030772 193
177 3300014969 Ga0157376_10668543 Ga0157376_106685432 193
178 3300017792 Ga0163161_10413553 Ga0163161_104135531 193
179 3300025261 Ga0209233_1001577 Ga0209233_10015774 193
180 3300025315 Ga0207697_10033856 Ga0207697_100338562 193
181 3300025321 Ga0207656_10000623 Ga0207656_1000062310 193
182 3300025903 Ga0207680_10002673 Ga0207680_1000267310 193
183 3300025903 Ga0207680_10252169 Ga0207680_102521691 193
184 3300025904 Ga0207647_10000286 Ga0207647_1000028642 193
185 3300025904 Ga0207647_10004467 Ga0207647_1000446710 193
186 3300025906 Ga0207699_10442032 Ga0207699_104420322 193
187 3300025909 Ga0207705_10122790 Ga0207705_101227902 193
188 3300025911 Ga0207654_10000464 Ga0207654_100004648 193
189 3300025911 Ga0207654_10014364 Ga0207654_100143645 193
190 3300025913 Ga0207695_10000014 Ga0207695_10000014375 193
191 3300025913 Ga0207695_10000320 Ga0207695_100003201 193
192 3300025913 Ga0207695_10000355 Ga0207695_100003551 193
193 3300025913 Ga0207695_10021758 Ga0207695_100217587 193
194 3300025913 Ga0207695_10117727 Ga0207695_101177273 193
195 3300025914 Ga0207671_10048036 Ga0207671_100480362 193
196 3300025914 Ga0207671_10282223 Ga0207671_102822232 193
197 3300025919 Ga0207657_10009366 Ga0207657_100093667 193
198 3300025920 Ga0207649_10072121 Ga0207649_100721212 193
199 3300025920 Ga0207649_10704878 Ga0207649_107048782 193
200 3300025920 Ga0207649_10748846 Ga0207649_107488461 193
201 3300025921 Ga0207652_10676083 Ga0207652_106760832 193
202 3300025924 Ga0207694_10008000 Ga0207694_1000800011 193
203 3300025924 Ga0207694_10040276 Ga0207694_100402762 193
204 3300025924 Ga0207694_10069613 Ga0207694_100696134 193
205 3300025924 Ga0207694_10121564 Ga0207694_101215642 193
206 3300025924 Ga0207694_10374574 Ga0207694_103745741 193
207 3300025925 Ga0207650_10070270 Ga0207650_100702702 193
208 3300025925 Ga0207650_10714545 Ga0207650_107145452 193
209 3300025926 Ga0207659_10571637 Ga0207659_105716372 193
210 3300025931 Ga0207644_10771098 Ga0207644_107710981 193
211 3300025931 Ga0207644_11107658 Ga0207644_111076581 193
212 3300025933 Ga0207706_10005842 Ga0207706_100058426 193
213 3300025933 Ga0207706_10077082 Ga0207706_100770823 193
214 3300025933 Ga0207706_10092139 Ga0207706_100921392 193
215 3300025934 Ga0207686_10000869 Ga0207686_100008697 193
216 3300025934 Ga0207686_10013084 Ga0207686_100130841 193
217 3300025937 Ga0207669_10103455 Ga0207669_101034552 193
218 3300025938 Ga0207704_10060621 Ga0207704_100606213 193
219 3300025938 Ga0207704_10088730 Ga0207704_100887302 193
220 3300025940 Ga0207691_10112533 Ga0207691_101125332 193
221 3300025941 Ga0207711_10061373 Ga0207711_100613733 193
222 3300025942 Ga0207689_10052582 Ga0207689_100525822 193
223 3300025942 Ga0207689_10101084 Ga0207689_101010842 193
224 3300025944 Ga0207661_10094331 Ga0207661_100943312 193
225 3300025944 Ga0207661_10554450 Ga0207661_105544502 193
226 3300025949 Ga0207667_10015023 Ga0207667_100150239 193
227 3300025949 Ga0207667_10105646 Ga0207667_101056462 193
228 3300025949 Ga0207667_10335182 Ga0207667_103351822 193
229 3300025949 Ga0207667_10373303 Ga0207667_103733032 193
230 3300025961 Ga0207712_10001772 Ga0207712_100017726 193
231 3300025972 Ga0207668_10052150 Ga0207668_100521502 193
232 3300025981 Ga0207640_10007385 Ga0207640_100073852 193
233 3300025981 Ga0207640_10166185 Ga0207640_101661852 193
234 3300025986 Ga0207658_10017016 Ga0207658_100170165 193
235 3300025986 Ga0207658_10171212 Ga0207658_101712122 193
236 3300025986 Ga0207658_10425494 Ga0207658_104254942 193
237 3300025986 Ga0207658_11368130 Ga0207658_113681301 193
238 3300026023 Ga0207677_10024307 Ga0207677_100243075 193
239 3300026023 Ga0207677_10092920 Ga0207677_100929202 193
240 3300026023 Ga0207677_10133339 Ga0207677_101333392 193
241 3300026035 Ga0207703_10006406 Ga0207703_100064063 193
242 3300026035 Ga0207703_10067885 Ga0207703_100678854 193
243 3300026035 Ga0207703_10482003 Ga0207703_104820032 193
244 3300026041 Ga0207639_10002067 Ga0207639_1000206715 193
245 3300026041 Ga0207639_10002553 Ga0207639_100025539 193
246 3300026041 Ga0207639_10103517 Ga0207639_101035173 193
247 3300026041 Ga0207639_10662849 Ga0207639_106628492 193
248 3300026041 Ga0207639_10867324 Ga0207639_108673242 193
249 3300026067 Ga0207678_10018910 Ga0207678_100189107 193
250 3300026067 Ga0207678_10119194 Ga0207678_101191943 193
251 3300026067 Ga0207678_10185147 Ga0207678_101851472 193
252 3300026067 Ga0207678_10243983 Ga0207678_102439832 193
253 3300026078 Ga0207702_10055511 Ga0207702_100555115 193
254 3300026078 Ga0207702_10058477 Ga0207702_100584773 193
255 3300026088 Ga0207641_10007225 Ga0207641_100072252 193
256 3300026088 Ga0207641_10212077 Ga0207641_102120772 193
257 3300026088 Ga0207641_10220308 Ga0207641_102203082 193
258 3300026089 Ga0207648_10073281 Ga0207648_100732814 193
259 3300026089 Ga0207648_10157520 Ga0207648_101575202 193
260 3300026095 Ga0207676_10212188 Ga0207676_102121883 193
261 3300026095 Ga0207676_11148866 Ga0207676_111488662 193
262 3300026116 Ga0207674_10024711 Ga0207674_100247117 193
263 3300026121 Ga0207683_10012612 Ga0207683_100126125 193
264 3300026121 Ga0207683_10030853 Ga0207683_100308532 193
265 3300026142 Ga0207698_10021710 Ga0207698_100217102 193
266 3300026142 Ga0207698_10122954 Ga0207698_101229542 193
267 3300026142 Ga0207698_10253187 Ga0207698_102531872 193
268 3300028379 Ga0268266_10000013 Ga0268266_10000013127 193
269 3300028379 Ga0268266_11035184 Ga0268266_110351841 193
270 3300028380 Ga0268265_10105343 Ga0268265_101053432 193
271 3300028381 Ga0268264_10026003 Ga0268264_100260036 193
272 3300028381 Ga0268264_10084521 Ga0268264_100845212 193
273 3300028381 Ga0268264_10128953 Ga0268264_101289533 193
274 3300031456 Ga0307513_10166374 Ga0307513_101663742 193
275 3300031548 Ga0307408_100838467 Ga0307408_1008384672 193
276 3300031730 Ga0307516_10166083 Ga0307516_101660832 193
277 3300031730 Ga0307516_10203404 Ga0307516_102034042 193
278 3300032004 Ga0307414_10195190 Ga0307414_101951902 193
279 3300032004 Ga0307414_10491103 Ga0307414_104911032 193
280 3300033179 Ga0307507_10144289 Ga0307507_101442892 193
281 3300035089 Ga0373944_0006864 Ga0373944_0006864_2164_2754 193
282 3300035172 Ga0373955_0494194 Ga0373955_0494194_148_735 193
283 3300035724 Ga0373933_0101778 Ga0373933_0101778_561_1151 193
284 3300036401 Ga0373937_0006199 Ga0373937_0006199_7006_7596 193
285 3300037418 Ga0395900_0000142 Ga0395900_0000142_112255_112845 193
286 3300037466 Ga0395898_0173477 Ga0395898_0173477_259_849 193
287 3300041452 Ga0451793_0559891 Ga0451793_0559891_311_892 193
288 3300041456 Ga0451795_0389564 Ga0451795_0389564_251_832 193
289 3300041486 Ga0451807_1144360 Ga0451807_1144360_704_1285 193
290 3300041491 Ga0451833_0256678 Ga0451833_0256678_33_614 193
291 3300041512 Ga0451853_0910535 Ga0451853_0910535_131_712 193
292 3300041512 Ga0451853_0947021 Ga0451853_0947021_368_949 193
293 3300041512 Ga0451853_3471180 Ga0451853_3471180_346_933 193
294 3300042014 Ga0439457_032692 Ga0439457_032692_418_999 193
295 3300046472 Ga0495580_0018411 Ga0495580_0018411_4188_4778 193
296 3300046475 Ga0495639_0190919 Ga0495639_0190919_377_967 193
297 3300046536 Ga0495587_0030772 Ga0495587_0030772_2528_3118 193
298 3300046679 Ga0495623_0293740 Ga0495623_0293740_140_730 193
299 3300046681 Ga0495647_0008650 Ga0495647_0008650_2774_3364 193
300 3300046683 Ga0495658_0006384 Ga0495658_0006384_4497_5087 193
301 3300046689 Ga0495613_0397350 Ga0495613_0397350_107_697 193
302 3300047472 Ga0495686_0122926 Ga0495686_0122926_310_924 193
303 3300048907 Ga0496104_0000058 Ga0496104_0000058_111745_112350 193
304 3300048908 Ga0496105_0000021 Ga0496105_0000021_54819_55424 193
305 3300048911 Ga0496108_0066148 Ga0496108_0066148_1565_2146 193
306 3300048921 Ga0496118_0013165 Ga0496118_0013165_475_1056 193
307 3300048925 Ga0496122_0000903 Ga0496122_0000903_11403_11984 193
308 3300048926 Ga0496123_0000702 Ga0496123_0000702_42754_43335 193
309 3300049569 Ga0501032_0125118 Ga0501032_0125118_101_700 193
310 3300049569 Ga0501032_0306894 Ga0501032_0306894_70_663 193
311 3300049570 Ga0501033_0006402 Ga0501033_0006402_4989_5582 193
312 3300049570 Ga0501033_0015482 Ga0501033_0015482_3369_3968 193
313 3300049571 Ga0501034_0000667 Ga0501034_0000667_49459_50040 193
314 3300049571 Ga0501034_0253854 Ga0501034_0253854_751_1344 193
315 3300049571 Ga0501034_0697887 Ga0501034_0697887_300_899 193
316 3300049572 Ga0501036_0049772 Ga0501036_0049772_2635_3216 193
317 3300049572 Ga0501036_0063669 Ga0501036_0063669_956_1555 193
318 3300049573 Ga0501037_0011887 Ga0501037_0011887_4215_4808 193
319 3300049573 Ga0501037_0131086 Ga0501037_0131086_1064_1663 193
320 3300049574 Ga0501038_0010941 Ga0501038_0010941_1436_2029 193
321 3300049574 Ga0501038_0097801 Ga0501038_0097801_778_1359 193
322 3300049575 Ga0501039_0014243 Ga0501039_0014243_3402_3995 193
323 3300049575 Ga0501039_0203586 Ga0501039_0203586_642_1223 193
324 3300049576 Ga0501040_0066133 Ga0501040_0066133_53_652 193
325 3300049578 Ga0501042_0338861 Ga0501042_0338861_107_703 193
326 3300049579 Ga0501043_0065796 Ga0501043_0065796_1063_1656 193
327 3300049579 Ga0501043_0158824 Ga0501043_0158824_110_703 193
328 3300049579 Ga0501043_0552230 Ga0501043_0552230_164_745 193
329 3300049580 Ga0501046_0026450 Ga0501046_0026450_2086_2679 193
330 3300049580 Ga0501046_0038747 Ga0501046_0038747_1924_2523 193
331 3300049580 Ga0501046_0281409 Ga0501046_0281409_308_901 193
332 3300049581 Ga0501047_0007796 Ga0501047_0007796_2283_2864 193
333 3300049581 Ga0501047_0017221 Ga0501047_0017221_5105_5698 193
334 3300049581 Ga0501047_0024889 Ga0501047_0024889_2849_3430 193
335 3300049581 Ga0501047_0296150 Ga0501047_0296150_494_1087 193
336 3300049582 Ga0501048_0486661 Ga0501048_0486661_195_794 193
337 3300049583 Ga0501067_0000302 Ga0501067_0000302_2373_2954 193
338 3300049583 Ga0501067_0008878 Ga0501067_0008878_4369_4968 193
339 3300049584 Ga0501068_0008523 Ga0501068_0008523_47_640 193
340 3300049584 Ga0501068_0021267 Ga0501068_0021267_1762_2343 193
341 3300049584 Ga0501068_0067875 Ga0501068_0067875_299_898 193
342 3300049585 Ga0501069_0024529 Ga0501069_0024529_167_748 193
343 3300049585 Ga0501069_0201546 Ga0501069_0201546_74_667 193
344 3300049586 Ga0501070_0000933 Ga0501070_0000933_2820_3401 193
345 3300049586 Ga0501070_0041554 Ga0501070_0041554_2826_3407 193
346 3300049586 Ga0501070_0344000 Ga0501070_0344000_186_779 193
347 3300049587 Ga0501071_0045454 Ga0501071_0045454_1302_1901 193
348 3300049587 Ga0501071_0112182 Ga0501071_0112182_1082_1675 193
349 3300049588 Ga0501072_0000451 Ga0501072_0000451_26597_27178 193
350 3300049589 Ga0501073_0003883 Ga0501073_0003883_9827_10420 193
351 3300049589 Ga0501073_0012317 Ga0501073_0012317_3203_3784 193
352 3300049589 Ga0501073_0175186 Ga0501073_0175186_483_1076 193
353 3300049589 Ga0501073_0182270 Ga0501073_0182270_469_1062 193
354 3300049589 Ga0501073_0455304 Ga0501073_0455304_207_788 193
355 3300049590 Ga0501074_0047461 Ga0501074_0047461_1915_2496 193
356 3300049590 Ga0501074_0057179 Ga0501074_0057179_2028_2621 193
357 3300049590 Ga0501074_0107926 Ga0501074_0107926_169_750 193
358 3300049590 Ga0501074_0669731 Ga0501074_0669731_105_698 193
359 3300049741 Ga0501079_0079404 Ga0501079_0079404_15_614 193
360 3300049741 Ga0501079_0251463 Ga0501079_0251463_543_1124 193
361 3300049741 Ga0501079_0483375 Ga0501079_0483375_347_928 193
362 3300049741 Ga0501079_0850202 Ga0501079_0850202_82_675 193
363 3300049742 Ga0501080_0000563 Ga0501080_0000563_2283_2864 193
364 3300049742 Ga0501080_0010517 Ga0501080_0010517_4958_5551 193
365 3300049742 Ga0501080_0041578 Ga0501080_0041578_3483_4064 193
366 3300049742 Ga0501080_0063245 Ga0501080_0063245_1023_1622 193
367 3300049744 Ga0501083_0022759 Ga0501083_0022759_1368_1949 193
368 3300049744 Ga0501083_0141936 Ga0501083_0141936_551_1144 193
369 3300049744 Ga0501083_0202499 Ga0501083_0202499_15_614 193
370 3300049822 Ga0501035_0063697 Ga0501035_0063697_956_1555 193
371 3300049822 Ga0501035_0452037 Ga0501035_0452037_359_952 193
372 3300049823 Ga0501044_0003300 Ga0501044_0003300_15725_16306 193
373 3300049823 Ga0501044_0015741 Ga0501044_0015741_4989_5582 193
374 3300049823 Ga0501044_0111280 Ga0501044_0111280_549_1142 193
375 3300053093 Ga0500651_0000131 Ga0500651_0000131_18436_19020 193
376 3300053105 Ga0500557_047659 Ga0500557_047659_477_1079 193
377 3300053146 Ga0500588_0033920 Ga0500588_0033920_209_814 193
378 3300054114 Ga0501084_0047300 Ga0501084_0047300_578_1177 193
379 3300054114 Ga0501084_0078889 Ga0501084_0078889_1584_2177 193
380 3300054114 Ga0501084_0116992 Ga0501084_0116992_1177_1758 193
381 3300060353 Ga0501082_0001536 Ga0501082_0001536_8483_9076 193
382 3300060353 Ga0501082_0116394 Ga0501082_0116394_674_1267 193
383 3300060353 Ga0501082_0201094 Ga0501082_0201094_76_657 193

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01195

Pept_tRNA_hydro

Peptidyl-tRNA hydrolase

36

219

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
7brd-assembly1.cif.gz_A crystal structure of peptidyl-trna hydrolase from klebsiella pneumoniae 0.9747 4 189
3nea-assembly1.cif.gz_A crystal structure of peptidyl-trna hydrolase from francisella tularensis 0.9726 2 180
4olj-assembly1.cif.gz_A crystal structure of arg119gln mutant of peptidyl-trna hydrolase from acinetobacter baumannii at 1.49 a resolution 0.9693 1 190
6ix6-assembly1.cif.gz_A crystal structure of the complex of peptidyl-trna hydrolase with n-propanol at 1.43 a resolution 0.9691 4 190
5imb-assembly1.cif.gz_A crystal structure of peptidyl-trna hydrolase mutant-n14d from vibrio cholerae 0.9668 3 189
ID Description Score Start End Superfamily
3neaA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase 0.9726 2 180 3.40.50.1470
5ektA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase 0.9491 1 189 3.40.50.1470
1rynA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase 0.9385 1 177 3.40.50.1470
4ylyA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase 0.9271 4 193 3.40.50.1470
3neaA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase 0.9269 2 180 3.40.50.1470
ID Description Score Start End GO Terms
AF-A0A853G5J7-F1-model_v4 Peptidyl-tRNA hydrolase (PTH) (EC 3.1.1.29) 0.9807 2 188 GO:0004045
GO:0005737
GO:0006412
AF-A0A2E4UR40-F1-model_v4 Peptidyl-tRNA hydrolase (PTH) (EC 3.1.1.29) 0.9789 2 191 GO:0004045
GO:0005737
GO:0006412
AF-A0A2J4V7Z6-F1-model_v4 deleted 0.9783 2 164
AF-U3U870-F1-model_v4 Peptidyl-tRNA hydrolase (PTH) (EC 3.1.1.29) 0.978 1 189 GO:0004045
GO:0005737
GO:0006412
AF-W1DGF0-F1-model_v4 Peptidyl-tRNA hydrolase (PTH) (EC 3.1.1.29) 0.9778 2 189 GO:0004045
GO:0005737
GO:0006412

Feature Viewer

pLDDT pTM Quality
92.26 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map