F429540

General Info

Members Datasets Scaffolds Average Seq Length
383 188 383 98

Family's Representative Sequence

Representative Sequence 3300005985|Ga0081539_10000644|Ga0081539_1000064416
Length 113
Sequence MLQHYVFLRYREGTPEAHVADFCERMSALGAIGGIQRLEIGRDELRDPRSWDLVLIMEFASVDDLRTYQRDSRHLAVMAFNEPFVANVASVDFTRLPPDTDSPPGSMSQGQVT

Samples

Sample ID Description Type Environment
1 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
2 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
3 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
53 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
57 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
58 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
59 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
74 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
75 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
80 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
81 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
82 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
83 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
84 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
85 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
122 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
126 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
127 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
128 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
129 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
130 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
131 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
132 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
133 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
134 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
135 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
136 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
137 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
138 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
139 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
140 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
141 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
142 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
143 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
144 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
145 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
146 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
147 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
148 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
149 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
150 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
151 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
152 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
153 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
154 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
155 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
156 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
157 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
158 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
159 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
160 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
161 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
162 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
163 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
164 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
165 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
166 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
167 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
168 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
169 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
170 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
171 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
172 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
173 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
174 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
175 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
176 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
177 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
178 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
179 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
180 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
181 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
182 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
183 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
184 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
185 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
186 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
187 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
188 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.57
Rhizosphere 98.43
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 ARcpr5yngRDRAFT_c019559 3300000043 Bacteria 572
2 JGI24749J21850_1023349 3300002076 Unclassified 878
3 Ga0065714_10082076 3300005288 Unclassified 2331
4 Ga0065712_10019048 3300005290 Unclassified 1908
5 Ga0065715_10211967 3300005293 Bacteria 1310
6 Ga0065715_10255658 3300005293 Unclassified 1128
7 Ga0065715_10294166 3300005293 Bacteria 1056
8 Ga0065707_10001890 3300005295 Bacteria 7376
9 Ga0065707_10254771 3300005295 Bacteria 1114
10 Ga0070670_100024182 3300005331 Bacteria 5227
11 Ga0070670_100678822 3300005331 Bacteria 925
12 Ga0070670_101923638 3300005331 Unclassified 545
13 Ga0070677_10530800 3300005333 Unclassified 642
14 Ga0070677_10589306 3300005333 Unclassified 614
15 Ga0068869_100149527 3300005334 Unclassified 1810
16 Ga0068869_100461712 3300005334 Bacteria 1054
17 Ga0068869_100619724 3300005334 Bacteria 916
18 Ga0068869_100815965 3300005334 Unclassified 803
19 Ga0068868_100226169 3300005338 Unclassified 1568
20 Ga0068868_100565588 3300005338 Bacteria 1003
21 Ga0070689_100555735 3300005340 Unclassified 989
22 Ga0070689_100582095 3300005340 Bacteria 968
23 Ga0070689_100674887 3300005340 Bacteria 901
24 Ga0070691_10646918 3300005341 Bacteria 629
25 Ga0070687_100145616 3300005343 Unclassified 1385
26 Ga0070687_100703398 3300005343 Bacteria 706
27 Ga0070669_100137569 3300005353 Unclassified 1880
28 Ga0070669_101713911 3300005353 Unclassified 548
29 Ga0070669_101746149 3300005353 Bacteria 543
30 Ga0070675_100066047 3300005354 Bacteria 2992
31 Ga0070675_100150141 3300005354 Bacteria 1997
32 Ga0070675_100240737 3300005354 Bacteria 1581
33 Ga0070675_100277063 3300005354 Bacteria 1473
34 Ga0070675_100899010 3300005354 Unclassified 811
35 Ga0070675_101020398 3300005354 Unclassified 760
36 Ga0070675_101084746 3300005354 Unclassified 736
37 Ga0070671_100063150 3300005355 Unclassified 3084
38 Ga0070671_100326154 3300005355 Bacteria 1308
39 Ga0070671_101870034 3300005355 Unclassified 534
40 Ga0070674_100157461 3300005356 Bacteria 1720
41 Ga0070673_100624425 3300005364 Unclassified 984
42 Ga0070673_101162060 3300005364 Bacteria 722
43 Ga0070688_100082285 3300005365 Unclassified 2086
44 Ga0070688_100441084 3300005365 Bacteria 971
45 Ga0070688_100700939 3300005365 Unclassified 784
46 Ga0070667_100024899 3300005367 Unclassified 4972
47 Ga0070701_10201117 3300005438 Unclassified 1178
48 Ga0070711_101823699 3300005439 Unclassified 534
49 Ga0070705_100331918 3300005440 Bacteria 1102
50 Ga0070694_101158798 3300005444 Bacteria 646
51 Ga0070663_100179119 3300005455 Unclassified 1643
52 Ga0070678_101156855 3300005456 Bacteria 716
53 Ga0070662_100298224 3300005457 Unclassified 1309
54 Ga0068867_101251543 3300005459 Bacteria 683
55 Ga0068867_101888812 3300005459 Bacteria 563
56 Ga0070685_10040273 3300005466 Bacteria 2658
57 Ga0070685_10109466 3300005466 Unclassified 1699
58 Ga0070707_100796700 3300005468 Unclassified 909
59 Ga0070698_101334320 3300005471 Unclassified 668
60 Ga0070699_100057634 3300005518 Bacteria 3365
61 Ga0070699_100634092 3300005518 Unclassified 975
62 Ga0070684_101694995 3300005535 Unclassified 596
63 Ga0068853_100592043 3300005539 Unclassified 1053
64 Ga0068853_101454531 3300005539 Bacteria 663
65 Ga0070672_100075590 3300005543 Unclassified 2690
66 Ga0070672_101402603 3300005543 Unclassified 625
67 Ga0070686_100538553 3300005544 Bacteria 912
68 Ga0070695_101867349 3300005545 Unclassified 505
69 Ga0070665_100290654 3300005548 Unclassified 1637
70 Ga0070704_100753867 3300005549 Unclassified 867
71 Ga0070664_100036042 3300005564 Unclassified 4154
72 Ga0070664_100166409 3300005564 Bacteria 1954
73 Ga0068857_100307485 3300005577 Unclassified 1462
74 Ga0068857_100692659 3300005577 Unclassified 968
75 Ga0070702_100105226 3300005615 Unclassified 1739
76 Ga0068859_100011095 3300005617 Bacteria 9063
77 Ga0068859_100114059 3300005617 Bacteria 2766
78 Ga0068859_100424360 3300005617 Bacteria 1426
79 Ga0068859_100835420 3300005617 Bacteria 1007
80 Ga0068859_101624505 3300005617 Unclassified 714
81 Ga0068859_101950262 3300005617 Unclassified 648
82 Ga0068859_103011846 3300005617 Unclassified 515
83 Ga0068864_100240967 3300005618 Unclassified 1676
84 Ga0068864_100714425 3300005618 Bacteria 980
85 Ga0068864_101325384 3300005618 Unclassified 720
86 Ga0068866_10740682 3300005718 Unclassified 678
87 Ga0068861_100366192 3300005719 Unclassified 1269
88 Ga0068861_101966292 3300005719 Bacteria 583
89 Ga0068870_10093271 3300005840 Bacteria 1688
90 Ga0068870_10198445 3300005840 Unclassified 1215
91 Ga0068863_100027456 3300005841 Bacteria 5429
92 Ga0068863_100674926 3300005841 Bacteria 1026
93 Ga0068858_100033915 3300005842 Unclassified 4735
94 Ga0068858_101050779 3300005842 Bacteria 799
95 Ga0068858_101886589 3300005842 Bacteria 590
96 Ga0068860_100066560 3300005843 Unclassified 3422
97 Ga0068860_100518976 3300005843 Unclassified 1191
98 Ga0068862_100169665 3300005844 Bacteria 1953
99 Ga0068862_100359043 3300005844 Unclassified 1354
100 Ga0068862_100621745 3300005844 Bacteria 1039
101 Ga0081539_10000644 3300005985 Bacteria 70362
102 Ga0070717_11019968 3300006028 Bacteria 754
103 Ga0097621_100053416 3300006237 Unclassified 3294
104 Ga0097621_101706261 3300006237 Unclassified 600
105 Ga0097621_102317574 3300006237 Unclassified 514
106 Ga0068871_100012970 3300006358 Bacteria 6171
107 Ga0075428_100008696 3300006844 Bacteria 11264
108 Ga0075428_100101695 3300006844 Bacteria 3133
109 Ga0075428_101805081 3300006844 Unclassified 636
110 Ga0075430_100005028 3300006846 Bacteria 11132
111 Ga0075430_100024365 3300006846 Bacteria 5150
112 Ga0075431_100064135 3300006847 Bacteria 3792
113 Ga0075431_100388549 3300006847 Bacteria 1398
114 Ga0075433_10135902 3300006852 Bacteria 2185
115 Ga0075433_10308717 3300006852 Bacteria 1400
116 Ga0075433_11222337 3300006852 Bacteria 652
117 Ga0075434_100213313 3300006871 Bacteria 1951
118 Ga0075434_100385892 3300006871 Bacteria 1421
119 Ga0075429_100105025 3300006880 Bacteria 2467
120 Ga0075429_100571605 3300006880 Bacteria 990
121 Ga0068865_100118889 3300006881 Bacteria 1962
122 Ga0068865_100799112 3300006881 Unclassified 814
123 Ga0068865_101067851 3300006881 Bacteria 710
124 Ga0097620_100011095 3300006931 Bacteria 9063
125 Ga0097620_100114058 3300006931 Bacteria 2766
126 Ga0097620_100424368 3300006931 Bacteria 1426
127 Ga0097620_100835430 3300006931 Bacteria 1007
128 Ga0097620_101624750 3300006931 Unclassified 714
129 Ga0097620_101950240 3300006931 Unclassified 648
130 Ga0097620_103012107 3300006931 Unclassified 515
131 Ga0111539_10006912 3300009094 Bacteria 14572
132 Ga0111539_10031436 3300009094 Bacteria 6448
133 Ga0111539_10143466 3300009094 Bacteria 2795
134 Ga0111539_10152944 3300009094 Unclassified 2700
135 Ga0111539_10174541 3300009094 Bacteria 2510
136 Ga0111539_10825292 3300009094 Unclassified 1079
137 Ga0111539_11071081 3300009094 Unclassified 937
138 Ga0111539_12264708 3300009094 Unclassified 630
139 Ga0111539_12608267 3300009094 Unclassified 586
140 Ga0105245_10454914 3300009098 Bacteria 1289
141 Ga0105245_11761585 3300009098 Bacteria 672
142 Ga0105245_13296725 3300009098 Unclassified 500
143 Ga0105247_10057447 3300009101 Bacteria 2406
144 Ga0114129_10732477 3300009147 Unclassified 1267
145 Ga0114129_11276792 3300009147 Bacteria 911
146 Ga0114129_11277199 3300009147 Bacteria 911
147 Ga0105243_11160741 3300009148 Bacteria 784
148 Ga0105242_10180249 3300009176 Bacteria 1863
149 Ga0105242_10192737 3300009176 Bacteria 1805
150 Ga0105242_10289192 3300009176 Unclassified 1491
151 Ga0105242_11010990 3300009176 Unclassified 840
152 Ga0105242_11041020 3300009176 Unclassified 829
153 Ga0105248_10011732 3300009177 Bacteria 9663
154 Ga0105248_10556463 3300009177 Unclassified 1294
155 Ga0105248_10816023 3300009177 Unclassified 1053
156 Ga0105248_11777823 3300009177 Unclassified 699
157 Ga0105248_11970676 3300009177 Unclassified 663
158 Ga0105238_11490928 3300009551 Unclassified 705
159 Ga0105238_11513697 3300009551 Unclassified 700
160 Ga0105249_10210162 3300009553 Unclassified 1909
161 Ga0105249_10735895 3300009553 Bacteria 1048
162 Ga0105249_13420457 3300009553 Unclassified 511
163 Ga0105246_10368112 3300011119 Unclassified 1183
164 Ga0157374_10854772 3300013296 Unclassified 927
165 Ga0157374_11193516 3300013296 Unclassified 782
166 Ga0157378_10147283 3300013297 Unclassified 2191
167 Ga0157378_10205588 3300013297 Bacteria 1864
168 Ga0157378_10521046 3300013297 Bacteria 1190
169 Ga0157378_11218199 3300013297 Unclassified 792
170 Ga0157378_12945714 3300013297 Unclassified 528
171 Ga0163162_10071444 3300013306 Unclassified 3524
172 Ga0157372_12386056 3300013307 Unclassified 607
173 Ga0157375_10006153 3300013308 Bacteria 10459
174 Ga0157375_10059149 3300013308 Unclassified 3795
175 Ga0157375_10370302 3300013308 Unclassified 1599
176 Ga0157375_11674427 3300013308 Bacteria 753
177 Ga0157375_13642688 3300013308 Bacteria 512
178 Ga0163163_10026037 3300014325 Bacteria 5586
179 Ga0163163_11169722 3300014325 Bacteria 832
180 Ga0163163_11295613 3300014325 Unclassified 791
181 Ga0157380_10165163 3300014326 Bacteria 1928
182 Ga0157380_10194691 3300014326 Unclassified 1793
183 Ga0157380_10266278 3300014326 Bacteria 1559
184 Ga0157380_12593672 3300014326 Unclassified 573
185 Ga0157380_12906166 3300014326 Unclassified 545
186 Ga0157377_10244113 3300014745 Unclassified 1161
187 Ga0157377_11700058 3300014745 Bacteria 509
188 Ga0157379_10001821 3300014968 Bacteria 17601
189 Ga0157379_10131945 3300014968 Bacteria 2249
190 Ga0157376_10082854 3300014969 Bacteria 2758
191 Ga0163161_10123033 3300017792 Bacteria 1951
192 Ga0163161_12010284 3300017792 Unclassified 514
193 Ga0207697_10058334 3300025315 Unclassified 1603
194 Ga0207682_10156189 3300025893 Bacteria 1031
195 Ga0207682_10270225 3300025893 Unclassified 794
196 Ga0207710_10128380 3300025900 Unclassified 1216
197 Ga0207688_10681926 3300025901 Unclassified 649
198 Ga0207680_10003126 3300025903 Bacteria 7778
199 Ga0207680_10031693 3300025903 Unclassified 2997
200 Ga0207643_10027786 3300025908 Bacteria 3139
201 Ga0207643_10513942 3300025908 Unclassified 766
202 Ga0207707_11543304 3300025912 Unclassified 525
203 Ga0207660_10665934 3300025917 Bacteria 849
204 Ga0207662_10022337 3300025918 Bacteria 3627
205 Ga0207662_10040400 3300025918 Bacteria 2742
206 Ga0207662_10617973 3300025918 Bacteria 755
207 Ga0207649_10018973 3300025920 Bacteria 3924
208 Ga0207681_10172119 3300025923 Bacteria 1642
209 Ga0207681_10730764 3300025923 Unclassified 824
210 Ga0207681_11116869 3300025923 Unclassified 662
211 Ga0207650_10013358 3300025925 Bacteria 5685
212 Ga0207650_10035672 3300025925 Bacteria 3614
213 Ga0207650_10567373 3300025925 Bacteria 952
214 Ga0207659_10056900 3300025926 Bacteria 2802
215 Ga0207659_10092298 3300025926 Bacteria 2263
216 Ga0207659_10115691 3300025926 Unclassified 2046
217 Ga0207659_10169890 3300025926 Unclassified 1719
218 Ga0207659_10200959 3300025926 Unclassified 1592
219 Ga0207659_10236922 3300025926 Bacteria 1475
220 Ga0207659_10309312 3300025926 Bacteria 1300
221 Ga0207659_10510968 3300025926 Bacteria 1018
222 Ga0207659_10883778 3300025926 Bacteria 768
223 Ga0207644_10065417 3300025931 Unclassified 2644
224 Ga0207644_11216442 3300025931 Unclassified 633
225 Ga0207706_10072094 3300025933 Bacteria 3038
226 Ga0207686_10189539 3300025934 Bacteria 1465
227 Ga0207686_10392777 3300025934 Bacteria 1055
228 Ga0207686_10393895 3300025934 Unclassified 1053
229 Ga0207686_10880914 3300025934 Unclassified 721
230 Ga0207709_10054452 3300025935 Bacteria 2467
231 Ga0207670_10029802 3300025936 Unclassified 3479
232 Ga0207670_10152252 3300025936 Bacteria 1717
233 Ga0207670_11725017 3300025936 Unclassified 533
234 Ga0207669_10244426 3300025937 Unclassified 1332
235 Ga0207704_10012106 3300025938 Bacteria 4272
236 Ga0207704_11098047 3300025938 Unclassified 676
237 Ga0207691_10004363 3300025940 Bacteria 13712
238 Ga0207691_10014063 3300025940 Bacteria 7637
239 Ga0207691_10208711 3300025940 Bacteria 1698
240 Ga0207691_10856433 3300025940 Unclassified 762
241 Ga0207711_10005764 3300025941 Bacteria 10461
242 Ga0207711_10020638 3300025941 Bacteria 5498
243 Ga0207711_10547040 3300025941 Unclassified 1080
244 Ga0207689_10023325 3300025942 Bacteria 5195
245 Ga0207689_10274404 3300025942 Bacteria 1396
246 Ga0207679_10058728 3300025945 Unclassified 2852
247 Ga0207679_10093758 3300025945 Bacteria 2329
248 Ga0207679_10465844 3300025945 Bacteria 1123
249 Ga0207651_10017445 3300025960 Unclassified 4244
250 Ga0207651_10536963 3300025960 Bacteria 1015
251 Ga0207712_10208967 3300025961 Bacteria 1553
252 Ga0207712_10758430 3300025961 Unclassified 850
253 Ga0207658_10146710 3300025986 Bacteria 1917
254 Ga0207658_10369509 3300025986 Unclassified 1253
255 Ga0207677_10019674 3300026023 Bacteria 4083
256 Ga0207677_10189021 3300026023 Unclassified 1627
257 Ga0207677_10861684 3300026023 Bacteria 815
258 Ga0207703_10056830 3300026035 Unclassified 3188
259 Ga0207703_10116236 3300026035 Bacteria 2290
260 Ga0207703_11123539 3300026035 Unclassified 755
261 Ga0207678_10166420 3300026067 Bacteria 1883
262 Ga0207641_10006889 3300026088 Bacteria 9510
263 Ga0207641_10022390 3300026088 Bacteria 5202
264 Ga0207641_10917421 3300026088 Bacteria 870
265 Ga0207648_10317088 3300026089 Bacteria 1400
266 Ga0207676_10186226 3300026095 Unclassified 1822
267 Ga0207676_10213819 3300026095 Unclassified 1712
268 Ga0207676_10804291 3300026095 Bacteria 917
269 Ga0207674_10318996 3300026116 Unclassified 1503
270 Ga0207674_12129713 3300026116 Unclassified 524
271 Ga0207683_10655034 3300026121 Unclassified 973
272 Ga0207683_10706732 3300026121 Bacteria 935
273 Ga0207683_11161675 3300026121 Bacteria 716
274 Ga0209966_1174755 3300027695 Unclassified 503
275 Ga0207428_10002364 3300027907 Bacteria 18839
276 Ga0207428_10041998 3300027907 Bacteria 3700
277 Ga0207428_10102634 3300027907 Bacteria 2208
278 Ga0207428_10325565 3300027907 Bacteria 1134
279 Ga0207428_10375792 3300027907 Unclassified 1043
280 Ga0268266_10664380 3300028379 Unclassified 1003
281 Ga0268265_10165211 3300028380 Bacteria 1886
282 Ga0268265_10244238 3300028380 Bacteria 1586
283 Ga0268265_10517214 3300028380 Unclassified 1128
284 Ga0268265_11115539 3300028380 Unclassified 784
285 Ga0268264_10046120 3300028381 Unclassified 3620
286 Ga0268264_10666293 3300028381 Unclassified 1031
287 Ga0265338_10329056 3300028800 Bacteria 1104
288 Ga0265332_10010175 3300031238 Bacteria 4187
289 Ga0307408_100565653 3300031548 Bacteria 1005
290 Ga0265314_10040759 3300031711 Bacteria 3330
291 Ga0265342_10021817 3300031712 Bacteria 4082
292 Ga0307410_10731904 3300031852 Bacteria 836
293 Ga0307409_100251948 3300031995 Bacteria 1615
294 Ga0307411_10040073 3300032005 Bacteria 2969
295 Ga0373934_0129066 3300035086 Unclassified 1031
296 Ga0373940_0234413 3300035088 Unclassified 614
297 Ga0373951_0112075 3300035091 Bacteria 735
298 Ga0373936_0348758 3300035113 Unclassified 674
299 Ga0373953_0082736 3300035117 Unclassified 1336
300 Ga0373953_0122553 3300035117 Bacteria 1105
301 Ga0373954_0120245 3300035118 Unclassified 1275
302 Ga0373957_0014139 3300035120 Bacteria 2723
303 Ga0373960_0011663 3300035121 Bacteria 2169
304 Ga0373955_0289568 3300035172 Bacteria 986
305 Ga0373962_0121767 3300035242 Unclassified 832
306 Ga0373962_0130790 3300035242 Bacteria 808
307 Ga0373924_0046809 3300035410 Unclassified 1783
308 Ga0373931_0094106 3300035691 Bacteria 1675
309 Ga0373931_0105901 3300035691 Bacteria 1589
310 Ga0373933_0168625 3300035724 Bacteria 1393
311 Ga0373933_0335691 3300035724 Unclassified 981
312 Ga0373933_0409437 3300035724 Unclassified 885
313 Ga0373937_0056086 3300036401 Bacteria 3618
314 Ga0373937_0147277 3300036401 Unclassified 2204
315 Ga0373937_0614119 3300036401 Bacteria 1032
316 Ga0373937_0630257 3300036401 Bacteria 1017
317 Ga0373937_0852007 3300036401 Unclassified 860
318 Ga0242420_026302 3300038996 Bacteria 1061
319 Ga0242420_031996 3300038996 Bacteria 979
320 Ga0436360_0217243 3300039438 Unclassified 1334
321 Ga0439435_0116679 3300042436 Unclassified 833
322 Ga0439464_0029350 3300042439 Bacteria 1537
323 Ga0439440_0287313 3300042993 Unclassified 509
324 Ga0495592_0130881 3300046454 Bacteria 1755
325 Ga0495629_0217913 3300046459 Unclassified 1317
326 Ga0495651_0938237 3300046462 Unclassified 528
327 Ga0495582_0247927 3300046473 Bacteria 1021
328 Ga0495639_0066866 3300046475 Unclassified 1655
329 Ga0495664_0184685 3300046477 Unclassified 1264
330 Ga0495664_0248055 3300046477 Unclassified 1077
331 Ga0495594_0344713 3300046499 Unclassified 848
332 Ga0495608_0024278 3300046511 Unclassified 4148
333 Ga0495618_0491753 3300046514 Unclassified 740
334 Ga0495628_1033198 3300046516 Unclassified 564
335 Ga0495652_0314204 3300046529 Unclassified 1134
336 Ga0495665_0229072 3300046531 Unclassified 960
337 Ga0495598_0091406 3300046537 Unclassified 993
338 Ga0495645_0486152 3300046543 Unclassified 774
339 Ga0495634_0545770 3300046642 Unclassified 676
340 Ga0495635_0183980 3300046663 Unclassified 1420
341 Ga0495657_0002546 3300046675 Bacteria 15293
342 Ga0495647_0051322 3300046681 Bacteria 1603
343 Ga0495658_0072805 3300046683 Unclassified 1999
344 Ga0495613_0531256 3300046689 Unclassified 789
345 Ga0495613_1020962 3300046689 Unclassified 530
346 Ga0495600_0181412 3300046809 Unclassified 1357
347 Ga0495636_0013303 3300047318 Bacteria 3265
348 Ga0495674_0055567 3300047319 Unclassified 3471
349 Ga0495680_0115912 3300047322 Bacteria 1982
350 Ga0495675_0235152 3300047444 Unclassified 1105
351 Ga0496108_0209720 3300048911 Bacteria 1691
352 Ga0496108_0416514 3300048911 Bacteria 1173
353 Ga0496108_1267311 3300048911 Unclassified 621
354 Ga0496109_0966284 3300048912 Unclassified 790
355 Ga0496110_0419798 3300048913 Unclassified 1220
356 Ga0496113_0515441 3300048916 Bacteria 960
357 nmdc:mga05p37_224393_c1 3300050507 Bacteria 2266
358 nmdc:mga05p37_244955_c1 3300050507 Bacteria 2153
359 nmdc:mga05p37_466828_c1 3300050507 Bacteria 1457
360 nmdc:mga05p37_608868_c1 3300050507 Bacteria 1232
361 nmdc:mga09592_71929_c1 3300050508 Bacteria 2936
362 nmdc:mga09592_96837_c1 3300050508 Bacteria 2525
363 nmdc:mga0qj67_102091_c1 3300050509 Bacteria 2313
364 nmdc:mga0qj67_112625_c1 3300050509 Bacteria 2197
365 nmdc:mga06r32_117269_c1 3300050510 Bacteria 2624
366 nmdc:mga06r32_168914_c1 3300050510 Bacteria 2171
367 nmdc:mga08y16_1028215_c1 3300050511 Unclassified 802
368 nmdc:mga08y16_11998_c1 3300050511 Bacteria 9100
369 nmdc:mga08y16_1526638_c1 3300050511 Unclassified 628
370 nmdc:mga08y16_1703400_c1 3300050511 Unclassified 586
371 nmdc:mga08y16_173722_c1 3300050511 Unclassified 2237
372 nmdc:mga08y16_200723_c1 3300050511 Bacteria 2067
373 nmdc:mga08y16_2930_c1 3300050511 Bacteria 17570
374 nmdc:mga08y16_59664_c1 3300050511 Bacteria 3985
375 nmdc:mga08y16_601818_c1 3300050511 Unclassified 1108
376 nmdc:mga08y16_91044_c1 3300050511 Bacteria 3179
377 nmdc:mga0n895_102849_c1 3300050512 Bacteria 2868
378 nmdc:mga0n895_1585102_c1 3300050512 Unclassified 619
379 nmdc:mga0n895_292206_c1 3300050512 Bacteria 1652
380 nmdc:mga0n895_335408_c1 3300050512 Bacteria 1532
381 nmdc:mga0a205_221728_c1 3300050515 Bacteria 1776
382 nmdc:mga0a205_94472_c1 3300050515 Bacteria 2889
383 Ga0495619_0049673 3300053085 Unclassified 2767

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300014326 Ga0157380_12593672 Ga0157380_125936721 82
2 3300035117 Ga0373953_0122553 Ga0373953_0122553_822_1091 89
3 3300035172 Ga0373955_0289568 Ga0373955_0289568_349_618 89
4 3300035242 Ga0373962_0121767 Ga0373962_0121767_15_284 89
5 3300035724 Ga0373933_0168625 Ga0373933_0168625_500_769 89
6 3300036401 Ga0373937_0056086 Ga0373937_0056086_85_354 89
7 3300046477 Ga0495664_0184685 Ga0495664_0184685_186_455 89
8 3300005354 Ga0070675_101020398 Ga0070675_1010203982 95
9 3300005354 Ga0070675_101084746 Ga0070675_1010847462 95
10 3300005355 Ga0070671_100326154 Ga0070671_1003261542 95
11 3300005355 Ga0070671_101870034 Ga0070671_1018700342 95
12 3300005356 Ga0070674_100157461 Ga0070674_1001574612 95
13 3300005364 Ga0070673_101162060 Ga0070673_1011620602 95
14 3300005439 Ga0070711_101823699 Ga0070711_1018236992 95
15 3300005456 Ga0070678_101156855 Ga0070678_1011568552 95
16 3300005459 Ga0068867_101251543 Ga0068867_1012515432 95
17 3300005543 Ga0070672_101402603 Ga0070672_1014026032 95
18 3300005617 Ga0068859_101624505 Ga0068859_1016245052 95
19 3300005617 Ga0068859_101950262 Ga0068859_1019502622 95
20 3300005617 Ga0068859_103011846 Ga0068859_1030118462 95
21 3300005718 Ga0068866_10740682 Ga0068866_107406822 95
22 3300005842 Ga0068858_101886589 Ga0068858_1018865891 95
23 3300005843 Ga0068860_100518976 Ga0068860_1005189762 95
24 3300006028 Ga0070717_11019968 Ga0070717_110199682 95
25 3300006237 Ga0097621_101706261 Ga0097621_1017062612 95
26 3300006881 Ga0068865_100799112 Ga0068865_1007991121 95
27 3300006931 Ga0097620_101624750 Ga0097620_1016247502 95
28 3300006931 Ga0097620_101950240 Ga0097620_1019502402 95
29 3300006931 Ga0097620_103012107 Ga0097620_1030121072 95
30 3300009094 Ga0111539_10031436 Ga0111539_100314365 95
31 3300009094 Ga0111539_11071081 Ga0111539_110710812 95
32 3300009094 Ga0111539_12608267 Ga0111539_126082672 95
33 3300009176 Ga0105242_11010990 Ga0105242_110109901 95
34 3300009176 Ga0105242_11041020 Ga0105242_110410202 95
35 3300009177 Ga0105248_10556463 Ga0105248_105564632 95
36 3300009177 Ga0105248_11777823 Ga0105248_117778232 95
37 3300009177 Ga0105248_11970676 Ga0105248_119706762 95
38 3300009551 Ga0105238_11513697 Ga0105238_115136972 95
39 3300009553 Ga0105249_10735895 Ga0105249_107358952 95
40 3300013297 Ga0157378_10205588 Ga0157378_102055882 95
41 3300013297 Ga0157378_10521046 Ga0157378_105210462 95
42 3300013297 Ga0157378_11218199 Ga0157378_112181992 95
43 3300013308 Ga0157375_10370302 Ga0157375_103703022 95
44 3300013308 Ga0157375_13642688 Ga0157375_136426881 95
45 3300014325 Ga0163163_11169722 Ga0163163_111697222 95
46 3300014326 Ga0157380_10165163 Ga0157380_101651632 95
47 3300017792 Ga0163161_12010284 Ga0163161_120102842 95
48 3300025901 Ga0207688_10681926 Ga0207688_106819262 95
49 3300025903 Ga0207680_10003126 Ga0207680_100031261 95
50 3300025908 Ga0207643_10513942 Ga0207643_105139421 95
51 3300025912 Ga0207707_11543304 Ga0207707_115433042 95
52 3300025917 Ga0207660_10665934 Ga0207660_106659342 95
53 3300025918 Ga0207662_10040400 Ga0207662_100404004 95
54 3300025920 Ga0207649_10018973 Ga0207649_100189734 95
55 3300025923 Ga0207681_10172119 Ga0207681_101721192 95
56 3300025923 Ga0207681_11116869 Ga0207681_111168692 95
57 3300025925 Ga0207650_10013358 Ga0207650_100133582 95
58 3300025926 Ga0207659_10092298 Ga0207659_100922982 95
59 3300025926 Ga0207659_10169890 Ga0207659_101698902 95
60 3300025926 Ga0207659_10200959 Ga0207659_102009592 95
61 3300025931 Ga0207644_11216442 Ga0207644_112164422 95
62 3300025934 Ga0207686_10880914 Ga0207686_108809142 95
63 3300025937 Ga0207669_10244426 Ga0207669_102444262 95
64 3300025938 Ga0207704_10012106 Ga0207704_100121062 95
65 3300025940 Ga0207691_10004363 Ga0207691_100043632 95
66 3300025940 Ga0207691_10856433 Ga0207691_108564332 95
67 3300025941 Ga0207711_10020638 Ga0207711_100206385 95
68 3300025941 Ga0207711_10547040 Ga0207711_105470402 95
69 3300025945 Ga0207679_10093758 Ga0207679_100937582 95
70 3300025960 Ga0207651_10017445 Ga0207651_100174454 95
71 3300025960 Ga0207651_10536963 Ga0207651_105369632 95
72 3300025961 Ga0207712_10208967 Ga0207712_102089672 95
73 3300025986 Ga0207658_10369509 Ga0207658_103695092 95
74 3300026023 Ga0207677_10019674 Ga0207677_100196742 95
75 3300026035 Ga0207703_10116236 Ga0207703_101162362 95
76 3300026088 Ga0207641_10022390 Ga0207641_100223904 95
77 3300026089 Ga0207648_10317088 Ga0207648_103170882 95
78 3300026095 Ga0207676_10213819 Ga0207676_102138191 95
79 3300026121 Ga0207683_11161675 Ga0207683_111616751 95
80 3300027907 Ga0207428_10102634 Ga0207428_101026342 95
81 3300028380 Ga0268265_10517214 Ga0268265_105172142 95
82 3300028380 Ga0268265_11115539 Ga0268265_111155392 95
83 3300028381 Ga0268264_10666293 Ga0268264_106662932 95
84 3300035088 Ga0373940_0234413 Ga0373940_0234413_192_479 95
85 3300035091 Ga0373951_0112075 Ga0373951_0112075_434_721 95
86 3300035121 Ga0373960_0011663 Ga0373960_0011663_105_392 95
87 3300035691 Ga0373931_0094106 Ga0373931_0094106_596_883 95
88 3300035691 Ga0373931_0105901 Ga0373931_0105901_395_682 95
89 3300035724 Ga0373933_0409437 Ga0373933_0409437_323_610 95
90 3300036401 Ga0373937_0614119 Ga0373937_0614119_610_897 95
91 3300036401 Ga0373937_0852007 Ga0373937_0852007_219_506 95
92 3300038996 Ga0242420_031996 Ga0242420_031996_639_926 95
93 3300046537 Ga0495598_0091406 Ga0495598_0091406_380_667 95
94 3300046689 Ga0495613_0531256 Ga0495613_0531256_40_327 95
95 3300047318 Ga0495636_0013303 Ga0495636_0013303_2074_2361 95
96 3300050511 nmdc:mga08y16_1703400_c1 nmdc:mga08y16_1703400_c1_39_326 95
97 3300050511 nmdc:mga08y16_173722_c1 nmdc:mga08y16_173722_c1_1045_1332 95
98 3300050511 nmdc:mga08y16_91044_c1 nmdc:mga08y16_91044_c1_1399_1686 95
99 3300050512 nmdc:mga0n895_335408_c1 nmdc:mga0n895_335408_c1_877_1164 95
100 3300005331 Ga0070670_101923638 Ga0070670_1019236381 96
101 3300005354 Ga0070675_100277063 Ga0070675_1002770632 96
102 3300005577 Ga0068857_100307485 Ga0068857_1003074852 96
103 3300009094 Ga0111539_10825292 Ga0111539_108252922 96
104 3300013308 Ga0157375_10059149 Ga0157375_100591493 96
105 3300013308 Ga0157375_11674427 Ga0157375_116744271 96
106 3300014969 Ga0157376_10082854 Ga0157376_100828543 96
107 3300025926 Ga0207659_10236922 Ga0207659_102369222 96
108 3300026116 Ga0207674_10318996 Ga0207674_103189962 96
109 3300035086 Ga0373934_0129066 Ga0373934_0129066_421_714 96
110 3300035113 Ga0373936_0348758 Ga0373936_0348758_148_441 96
111 3300035117 Ga0373953_0082736 Ga0373953_0082736_457_750 96
112 3300035118 Ga0373954_0120245 Ga0373954_0120245_937_1230 96
113 3300035120 Ga0373957_0014139 Ga0373957_0014139_913_1206 96
114 3300035410 Ga0373924_0046809 Ga0373924_0046809_563_856 96
115 3300035724 Ga0373933_0335691 Ga0373933_0335691_232_525 96
116 3300036401 Ga0373937_0147277 Ga0373937_0147277_1716_2009 96
117 3300036401 Ga0373937_0630257 Ga0373937_0630257_660_953 96
118 3300046454 Ga0495592_0130881 Ga0495592_0130881_1279_1572 96
119 3300046459 Ga0495629_0217913 Ga0495629_0217913_565_858 96
120 3300046462 Ga0495651_0938237 Ga0495651_0938237_23_313 96
121 3300046473 Ga0495582_0247927 Ga0495582_0247927_474_767 96
122 3300046475 Ga0495639_0066866 Ga0495639_0066866_955_1248 96
123 3300046477 Ga0495664_0248055 Ga0495664_0248055_700_993 96
124 3300046499 Ga0495594_0344713 Ga0495594_0344713_313_603 96
125 3300046511 Ga0495608_0024278 Ga0495608_0024278_2861_3154 96
126 3300046514 Ga0495618_0491753 Ga0495618_0491753_389_682 96
127 3300046516 Ga0495628_1033198 Ga0495628_1033198_146_439 96
128 3300046529 Ga0495652_0314204 Ga0495652_0314204_156_449 96
129 3300046531 Ga0495665_0229072 Ga0495665_0229072_334_627 96
130 3300046543 Ga0495645_0486152 Ga0495645_0486152_393_686 96
131 3300046642 Ga0495634_0545770 Ga0495634_0545770_365_655 96
132 3300046663 Ga0495635_0183980 Ga0495635_0183980_643_936 96
133 3300046675 Ga0495657_0002546 Ga0495657_0002546_7553_7846 96
134 3300046681 Ga0495647_0051322 Ga0495647_0051322_863_1156 96
135 3300046683 Ga0495658_0072805 Ga0495658_0072805_632_925 96
136 3300046689 Ga0495613_1020962 Ga0495613_1020962_37_330 96
137 3300046809 Ga0495600_0181412 Ga0495600_0181412_723_1016 96
138 3300047319 Ga0495674_0055567 Ga0495674_0055567_2327_2620 96
139 3300047322 Ga0495680_0115912 Ga0495680_0115912_30_323 96
140 3300047444 Ga0495675_0235152 Ga0495675_0235152_774_1067 96
141 3300050511 nmdc:mga08y16_601818_c1 nmdc:mga08y16_601818_c1_89_379 96
142 3300053085 Ga0495619_0049673 Ga0495619_0049673_165_458 96
143 3300005295 Ga0065707_10254771 Ga0065707_102547712 97
144 3300005539 Ga0068853_100592043 Ga0068853_1005920432 97
145 3300009094 Ga0111539_12264708 Ga0111539_122647082 97
146 3300009176 Ga0105242_10192737 Ga0105242_101927372 97
147 3300025934 Ga0207686_10189539 Ga0207686_101895392 97
148 3300050507 nmdc:mga05p37_466828_c1 nmdc:mga05p37_466828_c1_832_1125 97
149 3300050511 nmdc:mga08y16_1028215_c1 nmdc:mga08y16_1028215_c1_428_721 97
150 3300002076 JGI24749J21850_1023349 JGI24749J21850_10233492 98
151 3300005288 Ga0065714_10082076 Ga0065714_100820762 98
152 3300005290 Ga0065712_10019048 Ga0065712_100190483 98
153 3300005293 Ga0065715_10255658 Ga0065715_102556582 98
154 3300005331 Ga0070670_100024182 Ga0070670_1000241822 98
155 3300005333 Ga0070677_10589306 Ga0070677_105893061 98
156 3300005334 Ga0068869_100149527 Ga0068869_1001495272 98
157 3300005338 Ga0068868_100226169 Ga0068868_1002261692 98
158 3300005340 Ga0070689_100555735 Ga0070689_1005557352 98
159 3300005343 Ga0070687_100145616 Ga0070687_1001456161 98
160 3300005353 Ga0070669_100137569 Ga0070669_1001375692 98
161 3300005354 Ga0070675_100150141 Ga0070675_1001501412 98
162 3300005355 Ga0070671_100063150 Ga0070671_1000631503 98
163 3300005364 Ga0070673_100624425 Ga0070673_1006244252 98
164 3300005365 Ga0070688_100082285 Ga0070688_1000822852 98
165 3300005367 Ga0070667_100024899 Ga0070667_1000248994 98
166 3300005438 Ga0070701_10201117 Ga0070701_102011172 98
167 3300005457 Ga0070662_100298224 Ga0070662_1002982241 98
168 3300005466 Ga0070685_10109466 Ga0070685_101094662 98
169 3300005518 Ga0070699_100634092 Ga0070699_1006340922 98
170 3300005543 Ga0070672_100075590 Ga0070672_1000755902 98
171 3300005548 Ga0070665_100290654 Ga0070665_1002906542 98
172 3300005549 Ga0070704_100753867 Ga0070704_1007538672 98
173 3300005564 Ga0070664_100036042 Ga0070664_1000360423 98
174 3300005577 Ga0068857_100692659 Ga0068857_1006926592 98
175 3300005615 Ga0070702_100105226 Ga0070702_1001052262 98
176 3300005617 Ga0068859_100011095 Ga0068859_1000110952 98
177 3300005618 Ga0068864_100240967 Ga0068864_1002409672 98
178 3300005719 Ga0068861_100366192 Ga0068861_1003661922 98
179 3300005841 Ga0068863_100027456 Ga0068863_1000274562 98
180 3300005842 Ga0068858_100033915 Ga0068858_1000339152 98
181 3300005843 Ga0068860_100066560 Ga0068860_1000665603 98
182 3300005844 Ga0068862_100359043 Ga0068862_1003590432 98
183 3300005985 Ga0081539_10000644 Ga0081539_1000064416 98
184 3300006237 Ga0097621_100053416 Ga0097621_1000534163 98
185 3300006358 Ga0068871_100012970 Ga0068871_1000129704 98
186 3300006852 Ga0075433_11222337 Ga0075433_112223372 98
187 3300006881 Ga0068865_100118889 Ga0068865_1001188892 98
188 3300006931 Ga0097620_100011095 Ga0097620_1000110952 98
189 3300009094 Ga0111539_10152944 Ga0111539_101529442 98
190 3300009098 Ga0105245_10454914 Ga0105245_104549141 98
191 3300009101 Ga0105247_10057447 Ga0105247_100574472 98
192 3300009176 Ga0105242_10289192 Ga0105242_102891922 98
193 3300009177 Ga0105248_10011732 Ga0105248_100117328 98
194 3300009553 Ga0105249_10210162 Ga0105249_102101623 98
195 3300013297 Ga0157378_10147283 Ga0157378_101472833 98
196 3300013306 Ga0163162_10071444 Ga0163162_100714443 98
197 3300013308 Ga0157375_10006153 Ga0157375_100061538 98
198 3300014325 Ga0163163_10026037 Ga0163163_100260372 98
199 3300014326 Ga0157380_10194691 Ga0157380_101946912 98
200 3300014745 Ga0157377_10244113 Ga0157377_102441132 98
201 3300014968 Ga0157379_10001821 Ga0157379_1000182113 98
202 3300017792 Ga0163161_10123033 Ga0163161_101230332 98
203 3300025315 Ga0207697_10058334 Ga0207697_100583342 98
204 3300025893 Ga0207682_10270225 Ga0207682_102702252 98
205 3300025900 Ga0207710_10128380 Ga0207710_101283802 98
206 3300025903 Ga0207680_10031693 Ga0207680_100316933 98
207 3300025918 Ga0207662_10022337 Ga0207662_100223373 98
208 3300025923 Ga0207681_10730764 Ga0207681_107307641 98
209 3300025925 Ga0207650_10035672 Ga0207650_100356722 98
210 3300025926 Ga0207659_10056900 Ga0207659_100569003 98
211 3300025926 Ga0207659_10115691 Ga0207659_101156912 98
212 3300025931 Ga0207644_10065417 Ga0207644_100654172 98
213 3300025933 Ga0207706_10072094 Ga0207706_100720942 98
214 3300025934 Ga0207686_10393895 Ga0207686_103938952 98
215 3300025936 Ga0207670_10029802 Ga0207670_100298023 98
216 3300025938 Ga0207704_11098047 Ga0207704_110980472 98
217 3300025940 Ga0207691_10014063 Ga0207691_100140633 98
218 3300025941 Ga0207711_10005764 Ga0207711_100057649 98
219 3300025942 Ga0207689_10023325 Ga0207689_100233254 98
220 3300025945 Ga0207679_10058728 Ga0207679_100587282 98
221 3300025961 Ga0207712_10758430 Ga0207712_107584302 98
222 3300025986 Ga0207658_10146710 Ga0207658_101467102 98
223 3300026023 Ga0207677_10189021 Ga0207677_101890212 98
224 3300026035 Ga0207703_10056830 Ga0207703_100568303 98
225 3300026088 Ga0207641_10006889 Ga0207641_100068898 98
226 3300026095 Ga0207676_10186226 Ga0207676_101862262 98
227 3300026116 Ga0207674_12129713 Ga0207674_121297132 98
228 3300026121 Ga0207683_10655034 Ga0207683_106550342 98
229 3300027695 Ga0209966_1174755 Ga0209966_11747552 98
230 3300027907 Ga0207428_10375792 Ga0207428_103757922 98
231 3300028379 Ga0268266_10664380 Ga0268266_106643802 98
232 3300028381 Ga0268264_10046120 Ga0268264_100461202 98
233 3300031548 Ga0307408_100565653 Ga0307408_1005656532 98
234 3300031852 Ga0307410_10731904 Ga0307410_107319042 98
235 3300031995 Ga0307409_100251948 Ga0307409_1002519482 98
236 3300032005 Ga0307411_10040073 Ga0307411_100400733 98
237 3300048911 Ga0496108_1267311 Ga0496108_1267311_40_336 98
238 3300048913 Ga0496110_0419798 Ga0496110_0419798_358_654 98
239 3300050511 nmdc:mga08y16_11998_c1 nmdc:mga08y16_11998_c1_6683_6979 98
240 3300050511 nmdc:mga08y16_1526638_c1 nmdc:mga08y16_1526638_c1_87_383 98
241 3300000043 ARcpr5yngRDRAFT_c019559 ARcpr5yngRDRAFT_0195591 99
242 3300005293 Ga0065715_10211967 Ga0065715_102119672 99
243 3300005293 Ga0065715_10294166 Ga0065715_102941661 99
244 3300005295 Ga0065707_10001890 Ga0065707_100018902 99
245 3300005331 Ga0070670_100678822 Ga0070670_1006788222 99
246 3300005333 Ga0070677_10530800 Ga0070677_105308001 99
247 3300005334 Ga0068869_100461712 Ga0068869_1004617122 99
248 3300005334 Ga0068869_100619724 Ga0068869_1006197242 99
249 3300005334 Ga0068869_100815965 Ga0068869_1008159652 99
250 3300005338 Ga0068868_100565588 Ga0068868_1005655882 99
251 3300005340 Ga0070689_100582095 Ga0070689_1005820951 99
252 3300005340 Ga0070689_100674887 Ga0070689_1006748872 99
253 3300005341 Ga0070691_10646918 Ga0070691_106469182 99
254 3300005343 Ga0070687_100703398 Ga0070687_1007033982 99
255 3300005353 Ga0070669_101713911 Ga0070669_1017139112 99
256 3300005353 Ga0070669_101746149 Ga0070669_1017461492 99
257 3300005354 Ga0070675_100066047 Ga0070675_1000660472 99
258 3300005354 Ga0070675_100240737 Ga0070675_1002407372 99
259 3300005354 Ga0070675_100899010 Ga0070675_1008990101 99
260 3300005365 Ga0070688_100441084 Ga0070688_1004410842 99
261 3300005365 Ga0070688_100700939 Ga0070688_1007009392 99
262 3300005440 Ga0070705_100331918 Ga0070705_1003319182 99
263 3300005444 Ga0070694_101158798 Ga0070694_1011587981 99
264 3300005455 Ga0070663_100179119 Ga0070663_1001791193 99
265 3300005459 Ga0068867_101888812 Ga0068867_1018888121 99
266 3300005466 Ga0070685_10040273 Ga0070685_100402733 99
267 3300005468 Ga0070707_100796700 Ga0070707_1007967001 99
268 3300005471 Ga0070698_101334320 Ga0070698_1013343201 99
269 3300005518 Ga0070699_100057634 Ga0070699_1000576344 99
270 3300005535 Ga0070684_101694995 Ga0070684_1016949952 99
271 3300005539 Ga0068853_101454531 Ga0068853_1014545311 99
272 3300005544 Ga0070686_100538553 Ga0070686_1005385531 99
273 3300005545 Ga0070695_101867349 Ga0070695_1018673492 99
274 3300005564 Ga0070664_100166409 Ga0070664_1001664093 99
275 3300005617 Ga0068859_100114059 Ga0068859_1001140592 99
276 3300005617 Ga0068859_100424360 Ga0068859_1004243602 99
277 3300005617 Ga0068859_100835420 Ga0068859_1008354202 99
278 3300005618 Ga0068864_100714425 Ga0068864_1007144252 99
279 3300005618 Ga0068864_101325384 Ga0068864_1013253841 99
280 3300005719 Ga0068861_101966292 Ga0068861_1019662922 99
281 3300005840 Ga0068870_10093271 Ga0068870_100932711 99
282 3300005840 Ga0068870_10198445 Ga0068870_101984452 99
283 3300005841 Ga0068863_100674926 Ga0068863_1006749262 99
284 3300005842 Ga0068858_101050779 Ga0068858_1010507792 99
285 3300005844 Ga0068862_100169665 Ga0068862_1001696652 99
286 3300005844 Ga0068862_100621745 Ga0068862_1006217452 99
287 3300006237 Ga0097621_102317574 Ga0097621_1023175742 99
288 3300006844 Ga0075428_100008696 Ga0075428_1000086966 99
289 3300006844 Ga0075428_100101695 Ga0075428_1001016954 99
290 3300006844 Ga0075428_101805081 Ga0075428_1018050812 99
291 3300006846 Ga0075430_100005028 Ga0075430_1000050282 99
292 3300006846 Ga0075430_100024365 Ga0075430_1000243654 99
293 3300006847 Ga0075431_100064135 Ga0075431_1000641353 99
294 3300006847 Ga0075431_100388549 Ga0075431_1003885492 99
295 3300006852 Ga0075433_10135902 Ga0075433_101359023 99
296 3300006852 Ga0075433_10308717 Ga0075433_103087172 99
297 3300006871 Ga0075434_100213313 Ga0075434_1002133132 99
298 3300006871 Ga0075434_100385892 Ga0075434_1003858922 99
299 3300006880 Ga0075429_100105025 Ga0075429_1001050252 99
300 3300006880 Ga0075429_100571605 Ga0075429_1005716052 99
301 3300006881 Ga0068865_101067851 Ga0068865_1010678512 99
302 3300006931 Ga0097620_100114058 Ga0097620_1001140582 99
303 3300006931 Ga0097620_100424368 Ga0097620_1004243682 99
304 3300006931 Ga0097620_100835430 Ga0097620_1008354302 99
305 3300009094 Ga0111539_10006912 Ga0111539_1000691212 99
306 3300009094 Ga0111539_10143466 Ga0111539_101434662 99
307 3300009094 Ga0111539_10174541 Ga0111539_101745412 99
308 3300009098 Ga0105245_11761585 Ga0105245_117615852 99
309 3300009098 Ga0105245_13296725 Ga0105245_132967252 99
310 3300009147 Ga0114129_10732477 Ga0114129_107324772 99
311 3300009147 Ga0114129_11276792 Ga0114129_112767922 99
312 3300009147 Ga0114129_11277199 Ga0114129_112771992 99
313 3300009148 Ga0105243_11160741 Ga0105243_111607412 99
314 3300009176 Ga0105242_10180249 Ga0105242_101802492 99
315 3300009177 Ga0105248_10816023 Ga0105248_108160232 99
316 3300009551 Ga0105238_11490928 Ga0105238_114909282 99
317 3300009553 Ga0105249_13420457 Ga0105249_134204572 99
318 3300011119 Ga0105246_10368112 Ga0105246_103681122 99
319 3300013296 Ga0157374_10854772 Ga0157374_108547722 99
320 3300013296 Ga0157374_11193516 Ga0157374_111935162 99
321 3300013297 Ga0157378_12945714 Ga0157378_129457142 99
322 3300013307 Ga0157372_12386056 Ga0157372_123860561 99
323 3300014325 Ga0163163_11295613 Ga0163163_112956132 99
324 3300014326 Ga0157380_10266278 Ga0157380_102662782 99
325 3300014326 Ga0157380_12906166 Ga0157380_129061662 99
326 3300014745 Ga0157377_11700058 Ga0157377_117000581 99
327 3300014968 Ga0157379_10131945 Ga0157379_101319452 99
328 3300025893 Ga0207682_10156189 Ga0207682_101561892 99
329 3300025908 Ga0207643_10027786 Ga0207643_100277862 99
330 3300025918 Ga0207662_10617973 Ga0207662_106179732 99
331 3300025925 Ga0207650_10567373 Ga0207650_105673732 99
332 3300025926 Ga0207659_10309312 Ga0207659_103093122 99
333 3300025926 Ga0207659_10510968 Ga0207659_105109682 99
334 3300025926 Ga0207659_10883778 Ga0207659_108837782 99
335 3300025934 Ga0207686_10392777 Ga0207686_103927772 99
336 3300025935 Ga0207709_10054452 Ga0207709_100544522 99
337 3300025936 Ga0207670_10152252 Ga0207670_101522522 99
338 3300025936 Ga0207670_11725017 Ga0207670_117250172 99
339 3300025940 Ga0207691_10208711 Ga0207691_102087112 99
340 3300025942 Ga0207689_10274404 Ga0207689_102744042 99
341 3300025945 Ga0207679_10465844 Ga0207679_104658442 99
342 3300026023 Ga0207677_10861684 Ga0207677_108616842 99
343 3300026035 Ga0207703_11123539 Ga0207703_111235392 99
344 3300026067 Ga0207678_10166420 Ga0207678_101664202 99
345 3300026088 Ga0207641_10917421 Ga0207641_109174212 99
346 3300026095 Ga0207676_10804291 Ga0207676_108042912 99
347 3300026121 Ga0207683_10706732 Ga0207683_107067322 99
348 3300027907 Ga0207428_10002364 Ga0207428_1000236416 99
349 3300027907 Ga0207428_10041998 Ga0207428_100419984 99
350 3300027907 Ga0207428_10325565 Ga0207428_103255652 99
351 3300028380 Ga0268265_10165211 Ga0268265_101652112 99
352 3300028380 Ga0268265_10244238 Ga0268265_102442382 99
353 3300028800 Ga0265338_10329056 Ga0265338_103290562 99
354 3300031238 Ga0265332_10010175 Ga0265332_100101754 99
355 3300031711 Ga0265314_10040759 Ga0265314_100407593 99
356 3300031712 Ga0265342_10021817 Ga0265342_100218173 99
357 3300035242 Ga0373962_0130790 Ga0373962_0130790_474_773 99
358 3300038996 Ga0242420_026302 Ga0242420_026302_574_873 99
359 3300039438 Ga0436360_0217243 Ga0436360_0217243_170_472 99
360 3300042436 Ga0439435_0116679 Ga0439435_0116679_496_795 99
361 3300042439 Ga0439464_0029350 Ga0439464_0029350_1166_1465 99
362 3300042993 Ga0439440_0287313 Ga0439440_0287313_128_427 99
363 3300048911 Ga0496108_0209720 Ga0496108_0209720_564_863 99
364 3300048911 Ga0496108_0416514 Ga0496108_0416514_796_1098 99
365 3300048912 Ga0496109_0966284 Ga0496109_0966284_334_633 99
366 3300048916 Ga0496113_0515441 Ga0496113_0515441_470_769 99
367 3300050507 nmdc:mga05p37_224393_c1 nmdc:mga05p37_224393_c1_1235_1534 99
368 3300050507 nmdc:mga05p37_244955_c1 nmdc:mga05p37_244955_c1_1548_1847 99
369 3300050507 nmdc:mga05p37_608868_c1 nmdc:mga05p37_608868_c1_526_825 99
370 3300050508 nmdc:mga09592_71929_c1 nmdc:mga09592_71929_c1_1497_1796 99
371 3300050508 nmdc:mga09592_96837_c1 nmdc:mga09592_96837_c1_1988_2287 99
372 3300050509 nmdc:mga0qj67_102091_c1 nmdc:mga0qj67_102091_c1_540_839 99
373 3300050509 nmdc:mga0qj67_112625_c1 nmdc:mga0qj67_112625_c1_396_695 99
374 3300050510 nmdc:mga06r32_117269_c1 nmdc:mga06r32_117269_c1_319_618 99
375 3300050510 nmdc:mga06r32_168914_c1 nmdc:mga06r32_168914_c1_149_448 99
376 3300050511 nmdc:mga08y16_200723_c1 nmdc:mga08y16_200723_c1_1107_1406 99
377 3300050511 nmdc:mga08y16_2930_c1 nmdc:mga08y16_2930_c1_10300_10599 99
378 3300050511 nmdc:mga08y16_59664_c1 nmdc:mga08y16_59664_c1_1205_1504 99
379 3300050512 nmdc:mga0n895_102849_c1 nmdc:mga0n895_102849_c1_974_1273 99
380 3300050512 nmdc:mga0n895_1585102_c1 nmdc:mga0n895_1585102_c1_53_352 99
381 3300050512 nmdc:mga0n895_292206_c1 nmdc:mga0n895_292206_c1_896_1195 99
382 3300050515 nmdc:mga0a205_221728_c1 nmdc:mga0a205_221728_c1_476_775 99
383 3300050515 nmdc:mga0a205_94472_c1 nmdc:mga0a205_94472_c1_736_1035 99

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07876

Dabb

Stress responsive A/B Barrel Domain

2

95

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
5b0b-assembly2.cif.gz_B polyketide cyclase oac from cannabis sativa, i7f mutant 0.9286 1 98
5b0b-assembly2.cif.gz_B polyketide cyclase oac from cannabis sativa, i7f mutant 0.919 1 98
5b0b-assembly2.cif.gz_D polyketide cyclase oac from cannabis sativa, i7f mutant 0.9088 1 98
5b0b-assembly2.cif.gz_D polyketide cyclase oac from cannabis sativa, i7f mutant 0.8997 1 98
5b0g-assembly1.cif.gz_A-2 polyketide cyclase oac from cannabis sativa, h78s mutant 0.8989 1 98
ID Description Score Start End Superfamily
3bguB01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9372 1 96 3.30.70.100
3bguB01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9278 1 96 3.30.70.100
5b0bD00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9088 1 98 3.30.70.100
af_Q67XD6_47_155_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9007 2 94 3.30.70.100
5b0bD00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8997 1 98 3.30.70.100
ID Description Score Start End GO Terms
AF-A0A858QWV3-F1-model_v4 Dabb family protein 0.9754 1 97
AF-A0A2N5K5W9-F1-model_v4 Stress responsive protein 0.9655 1 97
AF-A0A4P6PAY4-F1-model_v4 Dabb family protein 0.9642 1 96
AF-A0A2E8WN66-F1-model_v4 Stress protein 0.9635 1 98
AF-A0A520T0J8-F1-model_v4 Dabb family protein 0.9581 1 97

Feature Viewer

pLDDT pTM Quality
93.95 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map