F429537

General Info

Members Datasets Scaffolds Average Seq Length
383 261 766 326

Family's Representative Sequence

Representative Sequence 3300005937|Ga0081455_10090957|Ga0081455_100909572
Length 377
Sequence VTGFPLRYLHENVLVGTGAVDCDSRHSTTCTGRRRAHAVAADWLLMAMFDLPIDELREYRPDVAAPADIIDFWRHSIESARAHDLSAAFTAIDNKLAVIDTYDVTYAGFGGTPIRGWLHVPAGATGPLPTVVQYFGYSGGRGFPHTSTLWAQAGYAHFVMDTRGQGYDAGGPDPTPDNSAYAGLNHSPGFMTAGITSPETYYYRRVFVDAVRALDAARTSPLVDPDKIIVTGGSQGGGIAIAAAGLAGFAGIELLGCAPDVPFLCHFQRALQITDKDPYGEITRYLKGFRENVDAALRTLSYFDGVNLGRLATAPALFSVALMDAVCPPSTVFAAFNHYGSATKDIEVYSYNEHEGGQTYQQLAQLDWFAQIFAAKK

Samples

Sample ID Description Type Environment
1 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
6 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
7 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
8 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
9 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
10 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
11 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
34 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
35 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
36 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
37 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
38 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
39 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
40 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
41 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
42 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
43 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
45 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
46 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
47 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
48 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
49 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
50 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
51 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
52 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
53 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
54 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
55 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
81 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
83 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
84 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
85 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
86 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
87 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
88 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
89 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
90 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
91 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
92 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
93 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
94 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
95 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
96 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
97 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
98 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
99 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
100 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
101 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
102 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
103 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
104 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
105 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
106 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
107 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
108 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
109 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
110 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
111 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
112 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
113 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
114 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
115 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
116 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
117 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
118 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
119 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
120 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
121 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
122 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
123 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
124 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
125 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
126 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
127 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
128 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
129 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
130 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
131 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
132 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
133 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
134 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
135 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
136 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
137 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
138 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
139 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
140 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
141 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
142 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
143 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
144 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
145 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
146 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
147 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
148 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
149 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
150 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
151 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
152 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
153 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
154 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
155 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
156 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
157 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
158 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
159 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
160 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
161 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
162 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
163 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
164 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
165 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
166 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
167 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
168 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
169 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
170 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
171 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
172 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
173 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
174 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
175 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
176 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
177 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
178 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
179 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
180 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
181 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
196 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
197 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
198 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
199 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
200 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
201 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
202 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
203 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
204 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
205 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
206 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
207 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
208 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
209 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
212 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
213 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
214 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
215 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
216 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
217 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
218 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
219 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
220 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
221 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
222 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
223 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
224 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
225 2690315906 Arthrobacter sp. OY3WO11 Isolate Unclassified
226 2775506735 Arthrobacter sp. S95 1704 Isolate Unclassified
227 2808606357 Arthrobacter sp. SLBN-122 Isolate Unclassified
228 2808606360 Arthrobacter sp. SLBN-112 Isolate Unclassified
229 2808606366 Arthrobacter sp. SLBN-83 Isolate Unclassified
230 2808606370 Arthrobacter sp. SLBN-100 Isolate Unclassified
231 2808606371 Arthrobacter sp. SLBN-53 Isolate Unclassified
232 2811994871 Arthrobacter sp. SLBN-179 Isolate Unclassified
233 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
234 2837268691 Jiangella endophytica KE2-3 Isolate Rhizosphere
235 2857740372 Paenarthrobacter sp. R-74611 Isolate Unclassified
236 2861520306 Phytomonospora endophytica DSM 45386 Isolate Unclassified
237 2862574272 Streptomyces sp. AcE210 Isolate Nodule
238 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
239 2883821847 Microlunatus elymi KUDC0627 Isolate Rhizosphere
240 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
241 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
242 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
243 2904497146 Arthrobacter sp. 1276 Isolate Rhizosphere
244 2904776348 Paenarthrobacter sp. 1092 Isolate Rhizosphere
245 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
246 2919034639 Paenarthrobacter nitroguajacolicus 247 Isolate Rhizosphere
247 2919059106 Arthrobacter sp. 1088 Isolate Rhizosphere
248 2919538618 Paenarthrobacter nitroguajacolicus 3945 Isolate Unclassified
249 2932426870 Paenarthrobacter sp. 4246 Isolate Rhizosphere
250 2933418574 Jeotgalibacillus campisalis 4120 Isolate Rhizosphere
251 2939598168 Arthrobacter sp. 754 Isolate Rhizosphere
252 2939647034 Arthrobacter sp. 2762 Isolate Rhizosphere
253 2939674588 Arthrobacter bambusae 3552 Isolate Rhizosphere
254 2945916053 Arthrobacter ulcerisalmonis W1I2 Isolate Rhizosphere
255 2945920336 Pseudarthrobacter siccitolerans W1I3 Isolate Rhizosphere
256 2945941187 Arthrobacter pascens W1I14 Isolate Rhizosphere
257 2946037020 Arthrobacter sp. W4I7 Isolate Rhizosphere
258 2946059875 Arthrobacter sp. SLBN-112 Isolate Rhizosphere
259 2974302888 Pseudarthrobacter sp. SORGH_AS 212 Isolate Unclassified
260 8054107350 Arthrobacter rhizosphaerae CCNWLXL 1-35 Isolate Rhizosphere
261 8057568493 Actinorhabdospora filicis NBRC 111898 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.3
Metatranscriptomes 0
Isolates 10.7

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.48
Nodule 0.26
Rhizoplane 4.7
Rhizosphere 81.2
Stem 0
Stem Tuber 0
Unclassified 2.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081455_10090957 3300005937 Bacteria 2472
2 JGI24740J21852_10003267 3300001979 Bacteria 7150
3 rootH2_10111665 3300003320 Bacteria 2909
4 rootH2_10139569 3300003320 Bacteria 2144
5 rootH1_10000128 3300003323 Bacteria 3100
6 Ga0055539_1000135 3300003752 Bacteria 77054
7 Ga0055533_1000002 3300003756 Bacteria 1196393
8 Ga0055525_1000303 3300003759 Bacteria 40809
9 Ga0055527_1000003 3300003760 Bacteria 705001
10 Ga0055542_1000005 3300003762 Bacteria 550280
11 Ga0055529_1000006 3300003763 Bacteria 416978
12 Ga0055541_1005951 3300003841 Bacteria 2105
13 Ga0070683_100203348 3300005329 Unclassified 1881
14 Ga0070683_100598576 3300005329 Bacteria 1055
15 Ga0070670_100204524 3300005331 Bacteria 1716
16 Ga0070682_100141448 3300005337 Bacteria 1641
17 Ga0070675_100127466 3300005354 Bacteria 2166
18 Ga0070675_100402923 3300005354 Bacteria 1221
19 Ga0070673_100079133 3300005364 Bacteria 2661
20 Ga0070659_100077312 3300005366 Bacteria 2654
21 Ga0070709_10000215 3300005434 Bacteria 37346
22 Ga0070714_100220766 3300005435 Bacteria 1742
23 Ga0070713_100014652 3300005436 Bacteria 5830
24 Ga0070713_100019331 3300005436 Bacteria 5197
25 Ga0070710_10000034 3300005437 Bacteria 63340
26 Ga0068867_100170274 3300005459 Bacteria 1724
27 Ga0070706_100012227 3300005467 Bacteria 7956
28 Ga0070699_100211740 3300005518 Bacteria 1725
29 Ga0070697_100151072 3300005536 Bacteria 1957
30 Ga0068853_100075461 3300005539 Bacteria 2942
31 Ga0070672_100025177 3300005543 Bacteria 4410
32 Ga0070665_100192901 3300005548 Bacteria 2038
33 Ga0068857_100089000 3300005577 Bacteria 2762
34 Ga0068857_100101902 3300005577 Unclassified 2576
35 Ga0068854_100053583 3300005578 Bacteria 2898
36 Ga0068856_100004389 3300005614 Bacteria 14055
37 Ga0068852_100098909 3300005616 Unclassified 2628
38 Ga0068864_100427988 3300005618 Unclassified 1262
39 Ga0081455_10027350 3300005937 Bacteria 5227
40 Ga0081540_1001665 3300005983 Bacteria 18914
41 Ga0081539_10002698 3300005985 Bacteria 24088
42 Ga0081539_10007038 3300005985 Bacteria 10415
43 Ga0075432_10011342 3300006058 Bacteria 3027
44 Ga0070712_100019779 3300006175 Bacteria 4398
45 Ga0075433_10131784 3300006852 Bacteria 2221
46 Ga0075436_100029768 3300006914 Bacteria 3755
47 Ga0075435_100041889 3300007076 Bacteria 3661
48 Ga0105244_10147541 3300009036 Bacteria 1128
49 Ga0105245_10012567 3300009098 Bacteria 7368
50 Ga0114129_10067968 3300009147 Bacteria 4969
51 Ga0114129_10145067 3300009147 Bacteria 3252
52 Ga0105243_10219205 3300009148 Bacteria 1681
53 Ga0105248_10099822 3300009177 Bacteria 3271
54 Ga0105249_10143610 3300009553 Bacteria 2291
55 Ga0105239_10200767 3300010375 Bacteria 2234
56 Ga0105246_10009875 3300011119 Bacteria 5888
57 Ga0105246_10018058 3300011119 Bacteria 4493
58 Ga0157369_10481106 3300013105 Bacteria 1285
59 Ga0163162_10692268 3300013306 Bacteria 1141
60 Ga0157372_10044144 3300013307 Bacteria 4939
61 Ga0157372_10176294 3300013307 Bacteria 2474
62 Ga0209566_100032 3300025225 Bacteria 338313
63 Ga0209674_100001 3300025226 Bacteria 4013750
64 Ga0209672_100003 3300025228 Bacteria 1560476
65 Ga0209147_101562 3300025229 Bacteria 7817
66 Ga0209563_100001 3300025230 Bacteria 4013775
67 Ga0209677_100001 3300025253 Bacteria 4013787
68 Ga0209148_1000004 3300025254 Bacteria 1844481
69 Ga0209455_1000046 3300025272 Bacteria 382681
70 Ga0209051_1001809 3300025303 Bacteria 16949
71 Ga0207697_10004516 3300025315 Bacteria 6635
72 Ga0207655_1014493 3300025728 Bacteria 4451
73 Ga0207647_10005838 3300025904 Bacteria 8976
74 Ga0207647_10041026 3300025904 Bacteria 2912
75 Ga0207684_10022025 3300025910 Bacteria 5442
76 Ga0207693_10085952 3300025915 Bacteria 2464
77 Ga0207657_10019964 3300025919 Bacteria 6347
78 Ga0207687_10246543 3300025927 Bacteria 1418
79 Ga0207700_10153489 3300025928 Bacteria 1905
80 Ga0207664_10195555 3300025929 Bacteria 1743
81 Ga0207669_10067583 3300025937 Bacteria 2228
82 Ga0207691_10025621 3300025940 Bacteria 5536
83 Ga0207711_10060646 3300025941 Bacteria 3260
84 Ga0207661_10449963 3300025944 Bacteria 1173
85 Ga0207668_10172705 3300025972 Bacteria 1697
86 Ga0207639_10132817 3300026041 Unclassified 2063
87 Ga0207702_10005678 3300026078 Bacteria 10879
88 Ga0207648_10165889 3300026089 Unclassified 1952
89 Ga0207674_10029887 3300026116 Bacteria 5733
90 Ga0207674_10077865 3300026116 Bacteria 3321
91 Ga0207698_10354698 3300026142 Bacteria 1387
92 Ga0207428_10079450 3300027907 Bacteria 2565
93 Ga0268266_10097736 3300028379 Bacteria 2583
94 Ga0265326_10056456 3300028558 Bacteria 1111
95 Ga0307515_10000476 3300028794 Bacteria 95453
96 Ga0307515_10031082 3300028794 Bacteria 8923
97 Ga0307515_10043218 3300028794 Bacteria 7015
98 Ga0314311_1259696 3300030733 Bacteria 3638
99 Ga0307408_100025318 3300031548 Bacteria 4063
100 Ga0307408_100036976 3300031548 Bacteria 3435
101 Ga0307408_100040210 3300031548 Bacteria 3310
102 Ga0307408_100056907 3300031548 Bacteria 2836
103 Ga0307408_100103364 3300031548 Bacteria 2175
104 Ga0307408_100138180 3300031548 Bacteria 1909
105 Ga0307408_100139055 3300031548 Bacteria 1904
106 Ga0307408_100160265 3300031548 Bacteria 1786
107 Ga0307408_100345705 3300031548 Bacteria 1260
108 Ga0307508_10001221 3300031616 Bacteria 29396
109 Ga0307508_10034162 3300031616 Bacteria 4586
110 Ga0307508_10035484 3300031616 Bacteria 4494
111 Ga0307516_10194600 3300031730 Bacteria 1751
112 Ga0316577_10049069 3300031733 Unclassified 2356
113 Ga0307413_10021212 3300031824 Bacteria 3472
114 Ga0307413_10045774 3300031824 Bacteria 2597
115 Ga0307413_10096349 3300031824 Bacteria 1942
116 Ga0307413_10118772 3300031824 Bacteria 1786
117 Ga0307413_10266355 3300031824 Bacteria 1280
118 Ga0307518_10109621 3300031838 Bacteria 1968
119 Ga0307410_10005535 3300031852 Bacteria 6697
120 Ga0307410_10011180 3300031852 Bacteria 5121
121 Ga0307410_10058042 3300031852 Bacteria 2637
122 Ga0307410_10071217 3300031852 Bacteria 2410
123 Ga0307406_10136525 3300031901 Bacteria 1730
124 Ga0307407_10011552 3300031903 Bacteria 4208
125 Ga0307407_10058265 3300031903 Bacteria 2244
126 Ga0307407_10216267 3300031903 Bacteria 1293
127 Ga0307412_10039622 3300031911 Bacteria 3043
128 Ga0307412_10127709 3300031911 Bacteria 1841
129 Ga0307409_100030324 3300031995 Bacteria 3883
130 Ga0307409_100182209 3300031995 Bacteria 1860
131 Ga0307409_100295978 3300031995 Bacteria 1503
132 Ga0307416_100044847 3300032002 Bacteria 3475
133 Ga0307416_100056435 3300032002 Bacteria 3169
134 Ga0307416_100084553 3300032002 Bacteria 2696
135 Ga0307414_10117861 3300032004 Bacteria 2035
136 Ga0307415_100026118 3300032126 Bacteria 3678
137 Ga0307415_100054988 3300032126 Bacteria 2721
138 Ga0307415_100207662 3300032126 Bacteria 1560
139 Ga0373949_0048934 3300035090 Bacteria 1060
140 Ga0373936_0006373 3300035113 Bacteria 4446
141 Ga0373953_0019226 3300035117 Bacteria 2538
142 Ga0373943_0020778 3300035170 Bacteria 3030
143 Ga0373946_0024819 3300035171 Bacteria 2353
144 Ga0373955_0156513 3300035172 Bacteria 1342
145 Ga0373931_0172970 3300035691 Unclassified 1274
146 Ga0373935_0023765 3300035692 Bacteria 3765
147 Ga0373935_0284667 3300035692 Bacteria 1164
148 Ga0316582_0251250 3300036647 Bacteria 1212
149 Ga0373925_0004828 3300037068 Bacteria 10152
150 Ga0395899_0027263 3300037312 Bacteria 4308
151 Ga0395899_0128521 3300037312 Bacteria 1811
152 Ga0395900_0030137 3300037418 Bacteria 5569
153 Ga0395900_0112803 3300037418 Bacteria 2791
154 Ga0395898_0065326 3300037466 Bacteria 3527
155 Ga0395898_0076424 3300037466 Bacteria 3234
156 Ga0395898_0281835 3300037466 Bacteria 1585
157 Ga0395901_0019160 3300038443 Bacteria 6996
158 Ga0395901_0091825 3300038443 Bacteria 3178
159 Ga0395901_0152070 3300038443 Bacteria 2432
160 Ga0395901_0310465 3300038443 Bacteria 1633
161 Ga0395901_0329958 3300038443 Bacteria 1577
162 Ga0439439_0005425 3300041406 Bacteria 2911
163 Ga0451791_0038357 3300041451 Bacteria 1838
164 Ga0451791_1587302 3300041451 Bacteria 1213
165 Ga0451797_0722623 3300041453 Bacteria 1545
166 Ga0439448_0056645 3300042005 Bacteria 1291
167 Ga0439434_0014360 3300042435 Bacteria 2356
168 Ga0450918_001936 3300042531 Bacteria 3994
169 Ga0466972_0006521 3300044658 Bacteria 5864
170 Ga0466972_0009687 3300044658 Bacteria 4835
171 Ga0466965_0001675 3300044683 Bacteria 9087
172 Ga0466963_0018341 3300044694 Bacteria 4373
173 Ga0466970_0039062 3300044765 Bacteria 2518
174 Ga0466970_0164574 3300044765 Bacteria 1227
175 Ga0466957_0022147 3300044842 Bacteria 3746
176 Ga0466960_0031412 3300044901 Bacteria 2450
177 Ga0466959_0026741 3300045049 Bacteria 4278
178 Ga0495592_0005440 3300046454 Bacteria 9401
179 Ga0495592_0092320 3300046454 Bacteria 2169
180 Ga0495603_0015819 3300046455 Bacteria 4560
181 Ga0495629_0035827 3300046459 Bacteria 3505
182 Ga0495641_0004231 3300046461 Bacteria 10273
183 Ga0495651_0004416 3300046462 Bacteria 10775
184 Ga0495651_0026957 3300046462 Bacteria 4473
185 Ga0495653_0001578 3300046463 Bacteria 17865
186 Ga0495653_0027866 3300046463 Bacteria 4521
187 Ga0495580_0019510 3300046472 Bacteria 5038
188 Ga0495582_0011045 3300046473 Bacteria 4971
189 Ga0495662_0008964 3300046476 Bacteria 4913
190 Ga0495664_0000890 3300046477 Bacteria 15357
191 Ga0495664_0010171 3300046477 Bacteria 5279
192 Ga0495608_0000841 3300046511 Bacteria 21466
193 Ga0495608_0052039 3300046511 Bacteria 2712
194 Ga0495608_0063320 3300046511 Bacteria 2427
195 Ga0495628_0006995 3300046516 Bacteria 9784
196 Ga0495628_0047392 3300046516 Bacteria 3410
197 Ga0495628_0057382 3300046516 Bacteria 3062
198 Ga0495630_0070151 3300046517 Bacteria 2636
199 Ga0495666_0001908 3300046526 Bacteria 10278
200 Ga0495652_0193946 3300046529 Bacteria 1548
201 Ga0495665_0002723 3300046531 Bacteria 9531
202 Ga0495665_0009199 3300046531 Bacteria 5351
203 Ga0495640_0017029 3300046533 Bacteria 5424
204 Ga0495640_0245971 3300046533 Bacteria 1121
205 Ga0495586_0038522 3300046535 Bacteria 2568
206 Ga0495587_0017684 3300046536 Bacteria 4426
207 Ga0495587_0071995 3300046536 Bacteria 2010
208 Ga0495645_0010361 3300046543 Bacteria 6533
209 Ga0495645_0023473 3300046543 Bacteria 4466
210 Ga0495667_0025145 3300046559 Bacteria 4014
211 Ga0495668_0089594 3300046616 Bacteria 1686
212 Ga0495635_0039534 3300046663 Bacteria 3262
213 Ga0495635_0108475 3300046663 Bacteria 1897
214 Ga0495657_0102233 3300046675 Bacteria 1824
215 Ga0495599_0009911 3300046678 Bacteria 5830
216 Ga0495623_0012438 3300046679 Bacteria 5509
217 Ga0495623_0125107 3300046679 Bacteria 1544
218 Ga0495646_0002766 3300046680 Bacteria 10850
219 Ga0495658_0037150 3300046683 Bacteria 2691
220 Ga0495613_0012143 3300046689 Bacteria 6401
221 Ga0495670_0048219 3300046691 Bacteria 2131
222 Ga0495589_0028459 3300046794 Bacteria 2820
223 Ga0495600_0031847 3300046809 Bacteria 3418
224 Ga0495600_0155708 3300046809 Bacteria 1478
225 Ga0495600_0193696 3300046809 Bacteria 1306
226 Ga0495581_0037829 3300047315 Bacteria 2792
227 Ga0495604_0004425 3300047317 Bacteria 11124
228 Ga0495604_0008324 3300047317 Bacteria 8202
229 Ga0495674_0029240 3300047319 Bacteria 5020
230 Ga0495674_0043045 3300047319 Bacteria 4022
231 Ga0495676_0175025 3300047321 Bacteria 1507
232 Ga0495680_0027060 3300047322 Bacteria 4717
233 Ga0495680_0174876 3300047322 Bacteria 1553
234 Ga0495675_0016641 3300047444 Bacteria 4650
235 Ga0495675_0028361 3300047444 Bacteria 3568
236 Ga0495684_0318506 3300047471 Bacteria 1112
237 Ga0495593_0004489 3300047673 Bacteria 8289
238 Ga0495593_0025868 3300047673 Bacteria 3247
239 Ga0495593_0085849 3300047673 Bacteria 1624
240 Ga0495602_0159106 3300048088 Bacteria 1765
241 Ga0496102_0050308 3300048905 Bacteria 3794
242 Ga0496102_0067988 3300048905 Bacteria 3268
243 Ga0496102_0093077 3300048905 Bacteria 2792
244 Ga0496104_0714710 3300048907 Bacteria 909
245 Ga0496105_0025335 3300048908 Bacteria 4828
246 Ga0496107_0040001 3300048910 Bacteria 3365
247 Ga0496108_0000008 3300048911 Bacteria 294619
248 Ga0496108_0018691 3300048911 Bacteria 5679
249 Ga0496109_0089293 3300048912 Bacteria 2849
250 Ga0496109_0273754 3300048912 Bacteria 1591
251 Ga0496111_0086513 3300048914 Bacteria 2293
252 Ga0496111_0135217 3300048914 Bacteria 1826
253 Ga0496114_0093189 3300048917 Bacteria 2561
254 Ga0496114_0111379 3300048917 Bacteria 2346
255 Ga0496115_0033092 3300048918 Unclassified 4080
256 Ga0496117_0132645 3300048920 Bacteria 1507
257 Ga0496118_0099766 3300048921 Bacteria 1967
258 Ga0496119_0037907 3300048922 Bacteria 3123
259 Ga0496124_0020771 3300048927 Bacteria 6061
260 Ga0496125_0001233 3300048928 Bacteria 38274
261 Ga0501031_0005619 3300049568 Bacteria 8170
262 Ga0501031_0026481 3300049568 Bacteria 3780
263 Ga0501032_0006367 3300049569 Bacteria 8702
264 Ga0501032_0006843 3300049569 Bacteria 8365
265 Ga0501032_0022308 3300049569 Bacteria 4389
266 Ga0501032_0120522 3300049569 Bacteria 1734
267 Ga0501033_0004108 3300049570 Bacteria 11733
268 Ga0501033_0026149 3300049570 Bacteria 4393
269 Ga0501033_0039119 3300049570 Bacteria 3543
270 Ga0501034_0000042 3300049571 Bacteria 229124
271 Ga0501034_0029671 3300049571 Bacteria 5560
272 Ga0501034_0372104 3300049571 Bacteria 1355
273 Ga0501036_0084224 3300049572 Bacteria 2688
274 Ga0501036_0118216 3300049572 Bacteria 2238
275 Ga0501036_0129156 3300049572 Bacteria 2134
276 Ga0501037_0002658 3300049573 Bacteria 12879
277 Ga0501037_0014408 3300049573 Bacteria 5820
278 Ga0501037_0039780 3300049573 Bacteria 3460
279 Ga0501038_0003396 3300049574 Bacteria 14845
280 Ga0501038_0025581 3300049574 Bacteria 5260
281 Ga0501038_0029943 3300049574 Bacteria 4819
282 Ga0501038_0030239 3300049574 Bacteria 4794
283 Ga0501039_0037314 3300049575 Bacteria 3750
284 Ga0501039_0045412 3300049575 Bacteria 3394
285 Ga0501039_0049298 3300049575 Bacteria 3255
286 Ga0501039_0247285 3300049575 Bacteria 1402
287 Ga0501040_0049975 3300049576 Bacteria 2859
288 Ga0501042_0008065 3300049578 Bacteria 6932
289 Ga0501043_0012539 3300049579 Bacteria 6628
290 Ga0501043_0045964 3300049579 Bacteria 3432
291 Ga0501043_0080444 3300049579 Bacteria 2560
292 Ga0501043_0269939 3300049579 Bacteria 1306
293 Ga0501046_0078992 3300049580 Bacteria 2544
294 Ga0501046_0094789 3300049580 Bacteria 2293
295 Ga0501046_0149637 3300049580 Bacteria 1762
296 Ga0501047_0009033 3300049581 Bacteria 9411
297 Ga0501047_0082898 3300049581 Bacteria 3082
298 Ga0501048_0001969 3300049582 Bacteria 15618
299 Ga0501048_0055344 3300049582 Bacteria 2816
300 Ga0501068_0079468 3300049584 Bacteria 2011
301 Ga0501069_0012239 3300049585 Bacteria 4558
302 Ga0501070_0048997 3300049586 Bacteria 3508
303 Ga0501071_0016050 3300049587 Bacteria 5146
304 Ga0501072_0004832 3300049588 Bacteria 10261
305 Ga0501073_0155612 3300049589 Bacteria 1584
306 Ga0501074_0019669 3300049590 Bacteria 4901
307 Ga0501074_0046052 3300049590 Bacteria 3154
308 Ga0501075_0011984 3300049591 Bacteria 6153
309 Ga0501076_0020954 3300049592 Bacteria 5007
310 Ga0501077_0189910 3300049593 Bacteria 1305
311 Ga0501079_0007586 3300049741 Bacteria 8218
312 Ga0501080_0039550 3300049742 Bacteria 4401
313 Ga0501080_0046777 3300049742 Bacteria 4028
314 Ga0501080_0075809 3300049742 Bacteria 3128
315 Ga0501081_0040183 3300049743 Bacteria 3202
316 Ga0501083_0029349 3300049744 Bacteria 3784
317 Ga0501083_0197495 3300049744 Bacteria 1312
318 Ga0501035_0005092 3300049822 Bacteria 12446
319 Ga0501035_0050465 3300049822 Bacteria 3728
320 Ga0501035_0051958 3300049822 Bacteria 3667
321 Ga0501044_0001730 3300049823 Bacteria 25539
322 Ga0501044_0011616 3300049823 Bacteria 9543
323 Ga0501044_0026342 3300049823 Bacteria 6156
324 Ga0501044_0309825 3300049823 Bacteria 1505
325 Ga0501044_0385010 3300049823 Bacteria 1317
326 Ga0501044_0391496 3300049823 Bacteria 1303
327 Ga0501045_0017683 3300049824 Bacteria 5063
328 Ga0501045_0110171 3300049824 Bacteria 2041
329 nmdc:mga05p37_494330_c1 3300050507 Bacteria 1406
330 nmdc:mga0n895_84460_c1 3300050512 Bacteria 3168
331 nmdc:mga0rr50_15133_c1 3300050513 Bacteria 5085
332 Ga0495601_0039645 3300053077 Bacteria 2950
333 Ga0495612_0005629 3300053078 Bacteria 5177
334 Ga0495619_0003537 3300053085 Bacteria 10084
335 Ga0495619_0098744 3300053085 Bacteria 1985
336 Ga0500646_0000069 3300053090 Bacteria 29115
337 Ga0500641_0001140 3300053096 Bacteria 9444
338 Ga0500660_043008 3300053100 Bacteria 2287
339 Ga0500573_0116997 3300053140 Bacteria 1487
340 Ga0500630_095634 3300053159 Bacteria 1363
341 Ga0501084_0004116 3300054114 Bacteria 11848
342 Ga0501082_0018832 3300060353 Bacteria 5948
343 2691515221 2690315906 Bacteria 4517044
344 2775655677 2775506735 Bacteria 4556596
345 2808828410 2808606357 Bacteria 4466944
346 2808849650 2808606360 Bacteria 4404006
347 2808877757 2808606366 Bacteria 4415912
348 2808892629 2808606370 Bacteria 4942454
349 2808899191 2808606371 Bacteria 4251511
350 2812319874 2811994871 Bacteria 4497550
351 2816423485 2816332119 Bacteria 8120218
352 2816426314 2816332119 Bacteria 8120218
353 2837273183 2837268691 Bacteria 7850704
354 2857742297 2857740372 Bacteria 4782044
355 2861520487 2861520306 Bacteria 8348283
356 2862575271 2862574272 Bacteria 10567477
357 2873152489 2873151551 Bacteria 8625867
358 2883822684 2883821847 Bacteria 5121194
359 2884700543 2884693830 Bacteria 11273186
360 2895430725 2895427314 Bacteria 13147766
361 2895450236 2895442618 Bacteria 11027144
362 2904497196 2904497146 Bacteria 4731781
363 2904500555 2904497146 Bacteria 4731781
364 2904777197 2904776348 Bacteria 4658726
365 2917743701 2917736166 Bacteria 9690793
366 2919037859 2919034639 Bacteria 4763403
367 2919038257 2919034639 Bacteria 4763403
368 2919059200 2919059106 Bacteria 4991624
369 2919541193 2919538618 Bacteria 4677069
370 2932427346 2932426870 Bacteria 4547726
371 2933420890 2933418574 Bacteria 4476724
372 2939599261 2939598168 Bacteria 4687164
373 2939650438 2939647034 Bacteria 4681660
374 2939676800 2939674588 Bacteria 4844420
375 2945917623 2945916053 Bacteria 4555517
376 2945922085 2945920336 Bacteria 4501603
377 2945941752 2945941187 Bacteria 4682474
378 2946037664 2946037020 Bacteria 4900426
379 2946061443 2946059875 Bacteria 4386623
380 2974305688 2974302888 Bacteria 4369871
381 8054108352 8054107350 Bacteria 5022511
382 8054108360 8054107350 Bacteria 5022511
383 8057569098 8057568493 Bacteria 7221719
384 Ga0081455_10090957
385 JGI24740J21852_10003267
386 rootH2_10111665
387 rootH2_10139569
388 rootH1_10000128
389 Ga0055539_1000135
390 Ga0055533_1000002
391 Ga0055525_1000303
392 Ga0055527_1000003
393 Ga0055542_1000005
394 Ga0055529_1000006
395 Ga0055541_1005951
396 Ga0070683_100203348
397 Ga0070683_100598576
398 Ga0070670_100204524
399 Ga0070682_100141448
400 Ga0070675_100127466
401 Ga0070675_100402923
402 Ga0070673_100079133
403 Ga0070659_100077312
404 Ga0070709_10000215
405 Ga0070714_100220766
406 Ga0070713_100014652
407 Ga0070713_100019331
408 Ga0070710_10000034
409 Ga0068867_100170274
410 Ga0070706_100012227
411 Ga0070699_100211740
412 Ga0070697_100151072
413 Ga0068853_100075461
414 Ga0070672_100025177
415 Ga0070665_100192901
416 Ga0068857_100089000
417 Ga0068857_100101902
418 Ga0068854_100053583
419 Ga0068856_100004389
420 Ga0068852_100098909
421 Ga0068864_100427988
422 Ga0081455_10027350
423 Ga0081540_1001665
424 Ga0081539_10002698
425 Ga0081539_10007038
426 Ga0075432_10011342
427 Ga0070712_100019779
428 Ga0075433_10131784
429 Ga0075436_100029768
430 Ga0075435_100041889
431 Ga0105244_10147541
432 Ga0105245_10012567
433 Ga0114129_10067968
434 Ga0114129_10145067
435 Ga0105243_10219205
436 Ga0105248_10099822
437 Ga0105249_10143610
438 Ga0105239_10200767
439 Ga0105246_10009875
440 Ga0105246_10018058
441 Ga0157369_10481106
442 Ga0163162_10692268
443 Ga0157372_10044144
444 Ga0157372_10176294
445 Ga0209566_100032
446 Ga0209674_100001
447 Ga0209672_100003
448 Ga0209147_101562
449 Ga0209563_100001
450 Ga0209677_100001
451 Ga0209148_1000004
452 Ga0209455_1000046
453 Ga0209051_1001809
454 Ga0207697_10004516
455 Ga0207655_1014493
456 Ga0207647_10005838
457 Ga0207647_10041026
458 Ga0207684_10022025
459 Ga0207693_10085952
460 Ga0207657_10019964
461 Ga0207687_10246543
462 Ga0207700_10153489
463 Ga0207664_10195555
464 Ga0207669_10067583
465 Ga0207691_10025621
466 Ga0207711_10060646
467 Ga0207661_10449963
468 Ga0207668_10172705
469 Ga0207639_10132817
470 Ga0207702_10005678
471 Ga0207648_10165889
472 Ga0207674_10029887
473 Ga0207674_10077865
474 Ga0207698_10354698
475 Ga0207428_10079450
476 Ga0268266_10097736
477 Ga0265326_10056456
478 Ga0307515_10000476
479 Ga0307515_10031082
480 Ga0307515_10043218
481 Ga0314311_1259696
482 Ga0307408_100025318
483 Ga0307408_100036976
484 Ga0307408_100040210
485 Ga0307408_100056907
486 Ga0307408_100103364
487 Ga0307408_100138180
488 Ga0307408_100139055
489 Ga0307408_100160265
490 Ga0307408_100345705
491 Ga0307508_10001221
492 Ga0307508_10034162
493 Ga0307508_10035484
494 Ga0307516_10194600
495 Ga0316577_10049069
496 Ga0307413_10021212
497 Ga0307413_10045774
498 Ga0307413_10096349
499 Ga0307413_10118772
500 Ga0307413_10266355
501 Ga0307518_10109621
502 Ga0307410_10005535
503 Ga0307410_10011180
504 Ga0307410_10058042
505 Ga0307410_10071217
506 Ga0307406_10136525
507 Ga0307407_10011552
508 Ga0307407_10058265
509 Ga0307407_10216267
510 Ga0307412_10039622
511 Ga0307412_10127709
512 Ga0307409_100030324
513 Ga0307409_100182209
514 Ga0307409_100295978
515 Ga0307416_100044847
516 Ga0307416_100056435
517 Ga0307416_100084553
518 Ga0307414_10117861
519 Ga0307415_100026118
520 Ga0307415_100054988
521 Ga0307415_100207662
522 Ga0373949_0048934
523 Ga0373936_0006373
524 Ga0373953_0019226
525 Ga0373943_0020778
526 Ga0373946_0024819
527 Ga0373955_0156513
528 Ga0373931_0172970
529 Ga0373935_0023765
530 Ga0373935_0284667
531 Ga0316582_0251250
532 Ga0373925_0004828
533 Ga0395899_0027263
534 Ga0395899_0128521
535 Ga0395900_0030137
536 Ga0395900_0112803
537 Ga0395898_0065326
538 Ga0395898_0076424
539 Ga0395898_0281835
540 Ga0395901_0019160
541 Ga0395901_0091825
542 Ga0395901_0152070
543 Ga0395901_0310465
544 Ga0395901_0329958
545 Ga0439439_0005425
546 Ga0451791_0038357
547 Ga0451791_1587302
548 Ga0451797_0722623
549 Ga0439448_0056645
550 Ga0439434_0014360
551 Ga0450918_001936
552 Ga0466972_0006521
553 Ga0466972_0009687
554 Ga0466965_0001675
555 Ga0466963_0018341
556 Ga0466970_0039062
557 Ga0466970_0164574
558 Ga0466957_0022147
559 Ga0466960_0031412
560 Ga0466959_0026741
561 Ga0495592_0005440
562 Ga0495592_0092320
563 Ga0495603_0015819
564 Ga0495629_0035827
565 Ga0495641_0004231
566 Ga0495651_0004416
567 Ga0495651_0026957
568 Ga0495653_0001578
569 Ga0495653_0027866
570 Ga0495580_0019510
571 Ga0495582_0011045
572 Ga0495662_0008964
573 Ga0495664_0000890
574 Ga0495664_0010171
575 Ga0495608_0000841
576 Ga0495608_0052039
577 Ga0495608_0063320
578 Ga0495628_0006995
579 Ga0495628_0047392
580 Ga0495628_0057382
581 Ga0495630_0070151
582 Ga0495666_0001908
583 Ga0495652_0193946
584 Ga0495665_0002723
585 Ga0495665_0009199
586 Ga0495640_0017029
587 Ga0495640_0245971
588 Ga0495586_0038522
589 Ga0495587_0017684
590 Ga0495587_0071995
591 Ga0495645_0010361
592 Ga0495645_0023473
593 Ga0495667_0025145
594 Ga0495668_0089594
595 Ga0495635_0039534
596 Ga0495635_0108475
597 Ga0495657_0102233
598 Ga0495599_0009911
599 Ga0495623_0012438
600 Ga0495623_0125107
601 Ga0495646_0002766
602 Ga0495658_0037150
603 Ga0495613_0012143
604 Ga0495670_0048219
605 Ga0495589_0028459
606 Ga0495600_0031847
607 Ga0495600_0155708
608 Ga0495600_0193696
609 Ga0495581_0037829
610 Ga0495604_0004425
611 Ga0495604_0008324
612 Ga0495674_0029240
613 Ga0495674_0043045
614 Ga0495676_0175025
615 Ga0495680_0027060
616 Ga0495680_0174876
617 Ga0495675_0016641
618 Ga0495675_0028361
619 Ga0495684_0318506
620 Ga0495593_0004489
621 Ga0495593_0025868
622 Ga0495593_0085849
623 Ga0495602_0159106
624 Ga0496102_0050308
625 Ga0496102_0067988
626 Ga0496102_0093077
627 Ga0496104_0714710
628 Ga0496105_0025335
629 Ga0496107_0040001
630 Ga0496108_0000008
631 Ga0496108_0018691
632 Ga0496109_0089293
633 Ga0496109_0273754
634 Ga0496111_0086513
635 Ga0496111_0135217
636 Ga0496114_0093189
637 Ga0496114_0111379
638 Ga0496115_0033092
639 Ga0496117_0132645
640 Ga0496118_0099766
641 Ga0496119_0037907
642 Ga0496124_0020771
643 Ga0496125_0001233
644 Ga0501031_0005619
645 Ga0501031_0026481
646 Ga0501032_0006367
647 Ga0501032_0006843
648 Ga0501032_0022308
649 Ga0501032_0120522
650 Ga0501033_0004108
651 Ga0501033_0026149
652 Ga0501033_0039119
653 Ga0501034_0000042
654 Ga0501034_0029671
655 Ga0501034_0372104
656 Ga0501036_0084224
657 Ga0501036_0118216
658 Ga0501036_0129156
659 Ga0501037_0002658
660 Ga0501037_0014408
661 Ga0501037_0039780
662 Ga0501038_0003396
663 Ga0501038_0025581
664 Ga0501038_0029943
665 Ga0501038_0030239
666 Ga0501039_0037314
667 Ga0501039_0045412
668 Ga0501039_0049298
669 Ga0501039_0247285
670 Ga0501040_0049975
671 Ga0501042_0008065
672 Ga0501043_0012539
673 Ga0501043_0045964
674 Ga0501043_0080444
675 Ga0501043_0269939
676 Ga0501046_0078992
677 Ga0501046_0094789
678 Ga0501046_0149637
679 Ga0501047_0009033
680 Ga0501047_0082898
681 Ga0501048_0001969
682 Ga0501048_0055344
683 Ga0501068_0079468
684 Ga0501069_0012239
685 Ga0501070_0048997
686 Ga0501071_0016050
687 Ga0501072_0004832
688 Ga0501073_0155612
689 Ga0501074_0019669
690 Ga0501074_0046052
691 Ga0501075_0011984
692 Ga0501076_0020954
693 Ga0501077_0189910
694 Ga0501079_0007586
695 Ga0501080_0039550
696 Ga0501080_0046777
697 Ga0501080_0075809
698 Ga0501081_0040183
699 Ga0501083_0029349
700 Ga0501083_0197495
701 Ga0501035_0005092
702 Ga0501035_0050465
703 Ga0501035_0051958
704 Ga0501044_0001730
705 Ga0501044_0011616
706 Ga0501044_0026342
707 Ga0501044_0309825
708 Ga0501044_0385010
709 Ga0501044_0391496
710 Ga0501045_0017683
711 Ga0501045_0110171
712 nmdc:mga05p37_494330_c1
713 nmdc:mga0n895_84460_c1
714 nmdc:mga0rr50_15133_c1
715 Ga0495601_0039645
716 Ga0495612_0005629
717 Ga0495619_0003537
718 Ga0495619_0098744
719 Ga0500646_0000069
720 Ga0500641_0001140
721 Ga0500660_043008
722 Ga0500573_0116997
723 Ga0500630_095634
724 Ga0501084_0004116
725 Ga0501082_0018832
726 2691515221
727 2775655677
728 2808828410
729 2808849650
730 2808877757
731 2808892629
732 2808899191
733 2812319874
734 2816423485
735 2816426314
736 2837273183
737 2857742297
738 2861520487
739 2862575271
740 2873152489
741 2883822684
742 2884700543
743 2895430725
744 2895450236
745 2904497196
746 2904500555
747 2904777197
748 2917743701
749 2919037859
750 2919038257
751 2919059200
752 2919541193
753 2932427346
754 2933420890
755 2939599261
756 2939650438
757 2939676800
758 2945917623
759 2945922085
760 2945941752
761 2946037664
762 2946061443
763 2974305688
764 8054108352
765 8054108360
766 8057569098

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05448

AXE1

Acetyl xylan esterase (AXE1)

46

372

0.95

PF00326

Peptidase_S9

Prolyl oligopeptidase family

200

376

0.71

Structural Annotation

Top 5 Hits

ID Description Score Start End
5hfn-assembly1.cif.gz_A crystal structure of a loop truncation variant of thermotoga maritima acetyl esterase tm0077 (apo structure) at 2.75 angstrom resolution 0.9857 2 321
5hfn-assembly1.cif.gz_E crystal structure of a loop truncation variant of thermotoga maritima acetyl esterase tm0077 (apo structure) at 2.75 angstrom resolution 0.9834 2 321
5hfn-assembly1.cif.gz_A crystal structure of a loop truncation variant of thermotoga maritima acetyl esterase tm0077 (apo structure) at 2.75 angstrom resolution 0.9822 2 321
5jib-assembly1.cif.gz_A crystal structure of the thermotoga maritima acetyl esterase (tm0077) complex with a substrate analog 0.9809 5 321
5hfn-assembly1.cif.gz_E crystal structure of a loop truncation variant of thermotoga maritima acetyl esterase tm0077 (apo structure) at 2.75 angstrom resolution 0.9799 2 321
ID Description Score Start End Superfamily
5hfnF00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9784 5 321 3.40.50.1820
5hfnF00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9715 5 321 3.40.50.1820
3m83C00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9707 1 320 3.40.50.1820
3m83C00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9648 1 320 3.40.50.1820
6agqE00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9506 6 318 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A251XMR5-F1-model_v4 Cephalosporin-C deacetylase 0.9931 175 321 GO:0005976
GO:0052689
AF-A0A101EPQ3-F1-model_v4 Cephalosporin-C deacetylase 0.9885 140 320 GO:0005976
GO:0052689
AF-A0A109B7V5-F1-model_v4 deleted 0.9873 5 321
AF-A0A2N2LPF7-F1-model_v4 Acetylxylan esterase 0.9872 190 319 GO:0005976
GO:0052689
AF-A0A251XMR5-F1-model_v4 Cephalosporin-C deacetylase 0.9864 175 321 GO:0005976
GO:0052689

Map