F429536

General Info

Members Datasets Scaffolds Average Seq Length
383 337 766 239

Family's Representative Sequence

Representative Sequence 3300005937|Ga0081455_10043241|Ga0081455_100432412
Length 232
Sequence MNGTLLHIAFDAIAWLAAGLSLFWLTRGMQVRFPVAPTDFTYIATLIFGAGLGAVLFGTANLWLSHLPGIARSIEGGIVGAIIAVELYKRIAGIGARRIGCFLSGMDDFTHGTPTSLPLGYDFGDGIMRHPVQLYESATMFAFAAVYVWRVRRHDRFVIDNGFYLAVGCYGAQRFAWEFLKPYGTLVGPFTLFHVLSAALVAYAVVMIATAPTPRAARQDLEKDQHDDRAFA

Samples

Sample ID Description Type Environment
1 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
6 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
7 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
8 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
9 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
34 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
35 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
36 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
37 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
38 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
39 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
40 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
41 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
42 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
43 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
44 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
45 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
46 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
48 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
49 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
53 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
54 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
55 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
56 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
57 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
60 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
61 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
62 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
63 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
67 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
68 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
69 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
70 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
71 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
72 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
73 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
74 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
75 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
76 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
77 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
81 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
83 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
84 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
85 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
86 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
117 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
118 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
119 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
121 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
122 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
124 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
125 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
126 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
127 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
128 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
129 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
130 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
131 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
132 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
133 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
134 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
135 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
136 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
137 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
138 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
139 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
140 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
141 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
142 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
143 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
144 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
145 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
146 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
147 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
148 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
149 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
150 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
151 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
152 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
153 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
154 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
155 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
156 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
157 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
158 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
159 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
160 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
161 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
162 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
163 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
164 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
165 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
166 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
167 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
168 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
169 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
170 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
171 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
172 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
173 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
174 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
175 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
176 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
177 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
178 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
179 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
180 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
181 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
182 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
183 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
184 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
185 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
186 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
187 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
188 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
189 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
190 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
191 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
192 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
193 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
194 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
195 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
196 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
197 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
198 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
199 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
200 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
201 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
202 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
203 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
204 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
205 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
206 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
207 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
208 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
209 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
210 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
211 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
212 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
213 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
214 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
215 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
216 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
217 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
218 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
219 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
220 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
221 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
222 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
223 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
224 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
225 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
226 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
227 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
228 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
229 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
230 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
231 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
232 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
233 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
234 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
235 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
236 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
237 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
238 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
239 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
240 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
241 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
242 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
243 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
244 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
245 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
246 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
247 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
248 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
249 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
250 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
251 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
252 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
253 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
254 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
255 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
256 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
257 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
258 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
259 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
260 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
261 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
262 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
263 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
264 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
265 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
266 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
267 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
268 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
269 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
270 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
271 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
272 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
273 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
274 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
275 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
276 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
277 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
278 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
279 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
280 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
281 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
282 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
283 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
284 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
285 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
286 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
287 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
288 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
289 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
290 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
291 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
292 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
293 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
294 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
295 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
296 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
297 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
298 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
299 2906610324
300 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
301 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
302 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
303 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
304 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
305 2922425934
306 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
307 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
308 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
309 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
310 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
311 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
312 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
313 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
314 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
315 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
316 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
317 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
318 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
319 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
320 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
321 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
322 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
323 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
324 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
325 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
326 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
327 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
328 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
329 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
330 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
331 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
332 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
333 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
334 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
335 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
336 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
337 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 73.75
Metatranscriptomes 0
Isolates 26.25

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.1
Nodule 19.32
Rhizoplane 4.7
Rhizosphere 47
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081455_10043241 3300005937 Bacteria 3944
2 JGI24737J22298_10065399 3300001990 Bacteria 1090
3 JGI25406J46586_10002719 3300003203 Bacteria 8341
4 JGI25153J46596_10001817 3300003215 Bacteria 12646
5 JGI25153J46596_10003039 3300003215 Bacteria 9480
6 JGI25153J46596_10003439 3300003215 Bacteria 8864
7 JGI25153J46596_10007650 3300003215 Bacteria 5269
8 rootH1_10148004 3300003316 Bacteria 1378
9 JGI25160J50197_1001066 3300003354 Bacteria 14063
10 JGI25160J50197_1002120 3300003354 Bacteria 9421
11 Ga0055539_1007175 3300003752 Bacteria 1413
12 Ga0055531_10006411 3300003794 Bacteria 6688
13 Ga0065165_1006189 3300005262 Bacteria 6384
14 Ga0065165_1041322 3300005262 Bacteria 1370
15 Ga0065707_10018930 3300005295 Bacteria 1394
16 Ga0070666_10236860 3300005335 Bacteria 1290
17 Ga0068868_100612412 3300005338 Bacteria 966
18 Ga0070661_100223350 3300005344 Bacteria 1445
19 Ga0070668_100034137 3300005347 Bacteria 3876
20 Ga0070669_100060620 3300005353 Bacteria 2780
21 Ga0070675_100209332 3300005354 Bacteria 1695
22 Ga0070671_100006731 3300005355 Bacteria 9196
23 Ga0070667_100126099 3300005367 Bacteria 2231
24 Ga0070709_10000546 3300005434 Bacteria 22073
25 Ga0070709_10219951 3300005434 Bacteria 1354
26 Ga0070714_100010805 3300005435 Bacteria 7229
27 Ga0070713_100056579 3300005436 Bacteria 3263
28 Ga0070710_10001828 3300005437 Bacteria 10031
29 Ga0070711_100003633 3300005439 Bacteria 9014
30 Ga0070662_100061735 3300005457 Bacteria 2737
31 Ga0068867_100376578 3300005459 Bacteria 1191
32 Ga0070693_100335320 3300005547 Bacteria 1031
33 Ga0068855_100118378 3300005563 Bacteria 3034
34 Ga0068855_100137510 3300005563 Bacteria 2787
35 Ga0068855_100550464 3300005563 Bacteria 1249
36 Ga0068857_100155645 3300005577 Bacteria 2072
37 Ga0068856_100143351 3300005614 Bacteria 2397
38 Ga0068852_100050588 3300005616 Bacteria 3561
39 Ga0068852_100157000 3300005616 Bacteria 2120
40 Ga0068859_100265332 3300005617 Bacteria 1809
41 Ga0068858_100109736 3300005842 Bacteria 2576
42 Ga0068860_100116881 3300005843 Bacteria 2552
43 Ga0068862_100207356 3300005844 Bacteria 1770
44 Ga0081455_10007855 3300005937 Bacteria 11171
45 Ga0081540_1000374 3300005983 Bacteria 44794
46 Ga0081539_10004407 3300005985 Bacteria 15588
47 Ga0070717_10299373 3300006028 Bacteria 1430
48 Ga0075368_10011700 3300006042 Bacteria 3197
49 Ga0075363_100015525 3300006048 Bacteria 3745
50 Ga0075364_10204863 3300006051 Bacteria 1337
51 Ga0070716_100004958 3300006173 Bacteria 6409
52 Ga0070716_100117882 3300006173 Bacteria 1657
53 Ga0070712_100050266 3300006175 Bacteria 2899
54 Ga0075366_10004205 3300006195 Bacteria 7716
55 Ga0075366_10143824 3300006195 Bacteria 1442
56 Ga0075428_100546174 3300006844 Bacteria 1239
57 Ga0075428_100546975 3300006844 Bacteria 1238
58 Ga0068865_100577671 3300006881 Bacteria 947
59 Ga0097620_100265335 3300006931 Bacteria 1809
60 Ga0099825_1013975 3300006941 Bacteria 7642
61 Ga0099823_1018712 3300006944 Bacteria 6667
62 Ga0099794_10106967 3300007265 Bacteria 1399
63 Ga0099794_10121681 3300007265 Bacteria 1313
64 Ga0105240_10024919 3300009093 Bacteria 7874
65 Ga0105240_10591587 3300009093 Bacteria 1223
66 Ga0111539_10055833 3300009094 Bacteria 4695
67 Ga0105245_10195521 3300009098 Bacteria 1940
68 Ga0105247_10019801 3300009101 Bacteria 4042
69 Ga0105247_10024476 3300009101 Bacteria 3639
70 Ga0105243_10288012 3300009148 Bacteria 1483
71 Ga0105241_10273834 3300009174 Bacteria 1439
72 Ga0105237_10056635 3300009545 Bacteria 3923
73 Ga0105238_10089884 3300009551 Bacteria 3058
74 Ga0105239_10036072 3300010375 Bacteria 5429
75 Ga0105239_10970261 3300010375 Bacteria 977
76 Ga0105246_10013110 3300011119 Bacteria 5187
77 Ga0105246_10575556 3300011119 Bacteria 969
78 Ga0157370_10014273 3300013104 Bacteria 8132
79 Ga0157369_10015321 3300013105 Bacteria 8645
80 Ga0157369_10124492 3300013105 Bacteria 2734
81 Ga0157374_10118442 3300013296 Bacteria 2553
82 Ga0157378_10680593 3300013297 Bacteria 1047
83 Ga0163162_10612971 3300013306 Bacteria 1214
84 Ga0157372_10087265 3300013307 Bacteria 3540
85 Ga0163163_10064024 3300014325 Bacteria 3648
86 Ga0157380_10620254 3300014326 Bacteria 1073
87 Ga0157379_10243572 3300014968 Bacteria 1631
88 Ga0157376_10622516 3300014969 Bacteria 1077
89 Ga0163161_10095284 3300017792 Bacteria 2208
90 Ga0214544_1000016 3300021320 Bacteria 204278
91 Ga0214542_1000016 3300021321 Bacteria 210332
92 Ga0214545_1000008 3300021324 Bacteria 215190
93 Ga0214543_1000043 3300021327 Bacteria 160517
94 Ga0213873_10110350 3300021358 Bacteria 799
95 Ga0213876_10026250 3300021384 Bacteria 3072
96 Ga0213876_10059951 3300021384 Bacteria 2008
97 Ga0209563_101467 3300025230 Bacteria 6221
98 Ga0209677_100587 3300025253 Bacteria 19818
99 Ga0209148_1000504 3300025254 Bacteria 39653
100 Ga0209233_1048634 3300025261 Bacteria 874
101 Ga0209455_1008447 3300025272 Bacteria 2797
102 Ga0209564_1002162 3300025295 Bacteria 16567
103 Ga0209758_1000069 3300025297 Bacteria 286161
104 Ga0209758_1000253 3300025297 Bacteria 107937
105 Ga0209758_1000397 3300025297 Bacteria 75408
106 Ga0209758_1001933 3300025297 Bacteria 22492
107 Ga0209758_1060953 3300025297 Bacteria 1246
108 Ga0209256_1006099 3300025299 Bacteria 6543
109 Ga0209256_1021343 3300025299 Bacteria 1992
110 Ga0207426_1000886 3300025302 Bacteria 30736
111 Ga0207426_1006444 3300025302 Bacteria 5111
112 Ga0209051_1039169 3300025303 Bacteria 1715
113 Ga0209257_1004855 3300025304 Bacteria 9940
114 Ga0209257_1042170 3300025304 Bacteria 1348
115 Ga0207656_10118207 3300025321 Bacteria 1231
116 Ga0207692_10000323 3300025898 Bacteria 16534
117 Ga0207710_10028249 3300025900 Bacteria 2434
118 Ga0207688_10214373 3300025901 Bacteria 1158
119 Ga0207647_10021967 3300025904 Bacteria 4246
120 Ga0207699_10000309 3300025906 Bacteria 26099
121 Ga0207699_10030379 3300025906 Bacteria 3022
122 Ga0207705_10253194 3300025909 Bacteria 1343
123 Ga0207654_10014346 3300025911 Bacteria 4092
124 Ga0207695_10045566 3300025913 Bacteria 4654
125 Ga0207671_10039647 3300025914 Bacteria 3488
126 Ga0207693_10035221 3300025915 Bacteria 3947
127 Ga0207657_10063674 3300025919 Bacteria 3151
128 Ga0207649_10036559 3300025920 Bacteria 2959
129 Ga0207700_10050087 3300025928 Bacteria 3111
130 Ga0207664_10008224 3300025929 Bacteria 7262
131 Ga0207644_10065455 3300025931 Bacteria 2643
132 Ga0207706_10219978 3300025933 Bacteria 1663
133 Ga0207709_10112055 3300025935 Bacteria 1826
134 Ga0207669_10404955 3300025937 Bacteria 1070
135 Ga0207665_10010426 3300025939 Bacteria 6104
136 Ga0207665_10150552 3300025939 Bacteria 1666
137 Ga0207711_10464693 3300025941 Bacteria 1178
138 Ga0207667_10195521 3300025949 Bacteria 2075
139 Ga0207668_10119071 3300025972 Bacteria 1996
140 Ga0207658_10052076 3300025986 Bacteria 3020
141 Ga0207703_10050720 3300026035 Bacteria 3360
142 Ga0207678_10035147 3300026067 Bacteria 4363
143 Ga0207678_10381688 3300026067 Bacteria 1218
144 Ga0207674_10104389 3300026116 Bacteria 2812
145 Ga0207698_10085244 3300026142 Bacteria 2564
146 Ga0207698_10211552 3300026142 Bacteria 1745
147 Ga0209389_1000071 3300027296 Bacteria 97411
148 Ga0209489_101361 3300027361 Bacteria 50193
149 Ga0209700_100011 3300027363 Bacteria 362159
150 Ga0209588_1076290 3300027671 Bacteria 1083
151 Ga0209813_10005215 3300027866 Bacteria 3143
152 Ga0207428_10064466 3300027907 Bacteria 2892
153 Ga0268265_10031901 3300028380 Bacteria 3810
154 Ga0265319_1015192 3300028563 Bacteria 2994
155 Ga0265334_10030865 3300028573 Bacteria 2143
156 Ga0265323_10006684 3300028653 Bacteria 4833
157 Ga0265338_10003095 3300028800 Bacteria 23864
158 Ga0265324_10011207 3300029957 Bacteria 3426
159 Ga0265320_10043446 3300031240 Bacteria 2221
160 Ga0265329_10011883 3300031242 Bacteria 3153
161 Ga0265340_10048800 3300031247 Bacteria 2057
162 Ga0265313_10085476 3300031595 Bacteria 1425
163 Ga0307508_10451683 3300031616 Bacteria 878
164 Ga0265342_10052554 3300031712 Bacteria 2428
165 Ga0265342_10084687 3300031712 Bacteria 1825
166 Ga0373926_0008071 3300035083 Bacteria 3506
167 Ga0373923_0007894 3300035111 Bacteria 3764
168 Ga0373954_0015273 3300035118 Bacteria 3432
169 Ga0373943_0012811 3300035170 Bacteria 3780
170 Ga0373946_0088018 3300035171 Bacteria 1371
171 Ga0373955_0033144 3300035172 Bacteria 2718
172 Ga0373924_0033190 3300035410 Bacteria 2082
173 Ga0373935_0020819 3300035692 Bacteria 4012
174 Ga0373927_0044749 3300035695 Bacteria 2863
175 Ga0373947_0019572 3300035725 Bacteria 3903
176 Ga0373937_0078732 3300036401 Bacteria 3046
177 Ga0373925_0012529 3300037068 Bacteria 6143
178 Ga0395900_0063574 3300037418 Bacteria 3794
179 Ga0395898_0090181 3300037466 Bacteria 2950
180 Ga0395905_0011979 3300037471 Bacteria 8362
181 Ga0395905_0578735 3300037471 Bacteria 1024
182 Ga0395901_0355127 3300038443 Bacteria 1512
183 Ga0436365_0008290 3300039437 Bacteria 15439
184 Ga0436365_0876009 3300039437 Bacteria 3660
185 Ga0436365_1916758 3300039437 Bacteria 1427
186 Ga0436363_0201429 3300039450 Bacteria 982
187 Ga0436363_0350100 3300039450 Bacteria 798
188 Ga0436363_0771435 3300039450 Bacteria 1460
189 Ga0436362_0047340 3300039453 Bacteria 5483
190 Ga0439453_0000331 3300041408 Bacteria 4964
191 Ga0451797_0689165 3300041453 Bacteria 2174
192 Ga0451795_0093959 3300041456 Bacteria 1987
193 Ga0451804_0669540 3300041463 Bacteria 1429
194 Ga0451807_2725667 3300041486 Bacteria 1099
195 Ga0451851_0483257 3300041507 Bacteria 894
196 Ga0466972_0033612 3300044658 Bacteria 2515
197 Ga0466965_0111361 3300044683 Bacteria 1407
198 Ga0466968_0012313 3300044735 Bacteria 3346
199 Ga0466960_0066517 3300044901 Bacteria 1783
200 Ga0495629_0060467 3300046459 Bacteria 2648
201 Ga0495651_0052053 3300046462 Bacteria 3155
202 Ga0495580_0026703 3300046472 Bacteria 4206
203 Ga0495639_0017393 3300046475 Bacteria 3122
204 Ga0495664_0029820 3300046477 Bacteria 3193
205 Ga0495584_0119192 3300046491 Bacteria 1336
206 Ga0495584_0130878 3300046491 Bacteria 1273
207 Ga0495594_0056224 3300046499 Bacteria 2171
208 Ga0495596_0047712 3300046500 Bacteria 1680
209 Ga0495616_0035054 3300046513 Bacteria 2600
210 Ga0495618_0020228 3300046514 Bacteria 4099
211 Ga0495628_0444487 3300046516 Bacteria 942
212 Ga0495630_0008615 3300046517 Bacteria 7320
213 Ga0495652_0086952 3300046529 Bacteria 2565
214 Ga0495652_0220941 3300046529 Bacteria 1424
215 Ga0495640_0035629 3300046533 Bacteria 3521
216 Ga0495597_0019320 3300046542 Bacteria 3189
217 Ga0495645_0083895 3300046543 Bacteria 2283
218 Ga0495667_0133971 3300046559 Bacteria 1597
219 Ga0495668_0037187 3300046616 Bacteria 2724
220 Ga0495634_0044187 3300046642 Bacteria 3016
221 Ga0495635_0051877 3300046663 Bacteria 2826
222 Ga0495646_0096413 3300046680 Bacteria 1701
223 Ga0495647_0161335 3300046681 Bacteria 966
224 Ga0495658_0032162 3300046683 Bacteria 2863
225 Ga0495613_0198399 3300046689 Bacteria 1416
226 Ga0495624_0120892 3300046690 Bacteria 1608
227 Ga0495600_0128154 3300046809 Bacteria 1650
228 Ga0495660_0043493 3300046810 Bacteria 2477
229 Ga0495674_0022521 3300047319 Bacteria 5811
230 Ga0495687_009588 3300047443 Bacteria 5396
231 Ga0495684_0011096 3300047471 Bacteria 6964
232 Ga0495593_0006174 3300047673 Bacteria 7049
233 Ga0496100_0109653 3300048903 Bacteria 1915
234 Ga0496102_0037647 3300048905 Bacteria 4364
235 Ga0496103_0011564 3300048906 Bacteria 5233
236 Ga0496104_0000199 3300048907 Bacteria 53404
237 Ga0496105_0027731 3300048908 Bacteria 4629
238 Ga0496106_0176042 3300048909 Bacteria 1697
239 Ga0496107_0302080 3300048910 Bacteria 1191
240 Ga0496108_0008778 3300048911 Bacteria 8194
241 Ga0496108_0299815 3300048911 Bacteria 1400
242 Ga0496109_0347439 3300048912 Bacteria 1401
243 Ga0496110_0417615 3300048913 Bacteria 1223
244 Ga0496112_0059239 3300048915 Bacteria 3772
245 Ga0496114_0013556 3300048917 Bacteria 6540
246 Ga0496114_0313053 3300048917 Bacteria 1387
247 Ga0496118_0046512 3300048921 Bacteria 3375
248 Ga0496119_0040354 3300048922 Bacteria 2986
249 Ga0496121_0098845 3300048924 Bacteria 2257
250 Ga0496122_0109652 3300048925 Bacteria 1816
251 Ga0496124_0043964 3300048927 Bacteria 3836
252 Ga0496125_0000406 3300048928 Bacteria 80645
253 Ga0496125_0062084 3300048928 Bacteria 2991
254 Ga0496125_0084118 3300048928 Bacteria 2417
255 Ga0496126_0050072 3300048929 Bacteria 3809
256 Ga0496126_0212762 3300048929 Bacteria 1627
257 Ga0495682_0049714 3300049460 Bacteria 1528
258 nmdc:mga03n38_19581_c1 3300050490 Bacteria 2692
259 nmdc:mga00v17_32498_c1 3300050491 Bacteria 3085
260 nmdc:mga06z11_33402_c1 3300050494 Bacteria 2517
261 nmdc:mga04h51_5353_c1 3300050495 Bacteria 3268
262 nmdc:mga07m45_153066_c1 3300050496 Bacteria 1338
263 nmdc:mga07m45_16707_c1 3300050496 Bacteria 3930
264 nmdc:mga08y16_128805_c1 3300050511 Bacteria 2632
265 nmdc:mga08y16_99358_c1 3300050511 Bacteria 3030
266 nmdc:mga0sz30_103651_c1 3300050516 Bacteria 1244
267 Ga0495601_0160140 3300053077 Bacteria 1471
268 Ga0500610_0106982 3300053079 Bacteria 1442
269 Ga0495619_0127439 3300053085 Bacteria 1748
270 Ga0500566_0009176 3300053094 Bacteria 5850
271 Ga0500641_0026463 3300053096 Bacteria 2252
272 Ga0500557_000172 3300053105 Bacteria 13024
273 Ga0500597_061902 3300053120 Bacteria 1609
274 Ga0500618_021310 3300053125 Bacteria 1583
275 Ga0500642_0000444 3300053130 Bacteria 13305
276 Ga0500619_077750 3300053154 Bacteria 1111
277 Ga0500627_0075961 3300053158 Bacteria 1494
278 Ga0500638_106306 3300053162 Bacteria 1302
279 Ga0500636_0047866 3300053177 Bacteria 2518
280 Ga0500625_002466 3300053729 Bacteria 6947
281 Ga0500609_013639 3300053731 Bacteria 1100
282 2507505365 2507262055 Bacteria 8048963
283 2508539254 2508501009 Bacteria 7784016
284 2508695575 2508501042 Bacteria 8719808
285 2511397163 2511231028 Bacteria 8046582
286 2513624009 2513237092 Bacteria 8341956
287 2513651422 2513237095 Bacteria 8976980
288 2513703457 2513237102 Bacteria 7703324
289 2513863308 2513237137 Bacteria 9558895
290 2513873436 2513237139 Bacteria 8737671
291 2513922595 2513237145 Bacteria 8979722
292 2514014765 2513237161 Bacteria 8871253
293 2515627558 2515154112 Bacteria 8294334
294 2517107198 2517093001 Bacteria 9002274
295 2517888946 2517572143 Bacteria 9484767
296 2524537380 2524023228 Bacteria 10118060
297 2617373850 2617270741 Bacteria 8201522
298 2793062142 2791355196 Bacteria 7323613
299 2805920783 2802429603 Bacteria 8777136
300 2818237769 2816332527 Bacteria 8933356
301 2824623881 2824617872 Bacteria 8814715
302 2824631688 2824626560 Bacteria 8813858
303 2824640269 2824635225 Bacteria 8785348
304 2824647875 2824644064 Bacteria 8743947
305 2824683073 2824679649 Bacteria 8248951
306 2824699727 2824696289 Bacteria 8335049
307 2824709182 2824704595 Bacteria 9667483
308 2824718028 2824714736 Bacteria 8717648
309 2824727868 2824723954 Bacteria 8758240
310 2824735105 2824732956 Bacteria 7810675
311 2824748607 2824746037 Bacteria 7911610
312 2824760970 2824753945 Bacteria 9787441
313 2824771619 2824763712 Bacteria 9792355
314 2824779798 2824773399 Bacteria 8360218
315 2838124609 2838122688 Bacteria 8803140
316 2841945297 2841941048 Bacteria 8688029
317 2841952085 2841949485 Bacteria 8680857
318 2841966033 2841957949 Bacteria 8652217
319 2841970529 2841966195 Bacteria 8673214
320 2841981778 2841974524 Bacteria 8931498
321 2841985056 2841983080 Bacteria 8395090
322 2842043412 2842038055 Bacteria 8002051
323 2842052598 2842045827 Bacteria 8006841
324 2847931167 2847930680 Bacteria 9342022
325 2847942251 2847939898 Bacteria 8606328
326 2849083120 2849076700 Bacteria 7039503
327 2857512019 2857509624 Bacteria 7472071
328 2874594538 2874590934 Bacteria 8299676
329 2874613341 2874612657 Bacteria 8252029
330 2874624883 2874620515 Bacteria 8290088
331 2874649911 2874645413 Bacteria 8214782
332 2876774030 2876771140 Bacteria 8287509
333 2876821910 2876818435 Bacteria 8274608
334 2879078246 2879074833 Bacteria 8279565
335 2879086003 2879083081 Bacteria 8587928
336 2879128400 2879127579 Bacteria 8294491
337 2879143655 2879142872 Bacteria 8267021
338 2881365231 2881364244 Bacteria 7710352
339 2885370918 2885366525 Bacteria 8326213
340 2888379491 2888378607 Bacteria 9652610
341 2888390592 2888388044 Bacteria 7304136
342 2903751383 2903748898 Bacteria 9972761
343 2904670162 2904666416 Bacteria 8226587
344 2904713279 2904711408 Bacteria 9771557
345 2906613998
346 2906641383 2906635258 Bacteria 8601019
347 2906648880 2906643746 Bacteria 8722424
348 2906668738 2906660503 Bacteria 8595048
349 2908776367 2908775508 Bacteria 8092255
350 2922398958 2922393267 Bacteria 8285685
351 2922434114
352 2935615608 2935608549 Bacteria 8203142
353 2935656434 2935648319 Bacteria 8801166
354 2935665263 2935656913 Bacteria 8965014
355 2935825591 2935819856 Bacteria 8261050
356 2935853355 2935847175 Bacteria 8228321
357 2935914827 2935908558 Bacteria 8568796
358 2935918803 2935916978 Bacteria 9113783
359 2935931480 2935926038 Bacteria 8601059
360 2935940077 2935934488 Bacteria 8602579
361 2935947576 2935942939 Bacteria 8599779
362 2935956348 2935951376 Bacteria 8602333
363 2935973141 2935967501 Bacteria 8603075
364 2935980612 2935975950 Bacteria 8347125
365 2935991956 2935984226 Bacteria 8302647
366 2936019283 2936011229 Bacteria 8801034
367 2936027907 2936019824 Bacteria 8804134
368 2936036690 2936028420 Bacteria 8965941
369 2936054728 2936046547 Bacteria 8903709
370 2936060322 2936055302 Bacteria 8785755
371 3005475176 3005474847 Bacteria 9259049
372 3005489103 3005483717 Bacteria 7877331
373 3005509069 3005506211 Bacteria 6943378
374 3005591611 3005587118 Bacteria 7794411
375 3005711090 3005710791 Bacteria 7622528
376 8006936108 8006933436 Bacteria 10410654
377 8006976035 8006973647 Bacteria 10679141
378 8019623071 8019619141 Bacteria 9218857
379 8019640578 8019638758 Bacteria 9062356
380 8019666866 8019659431 Bacteria 8577854
381 8019676625 8019668869 Bacteria 8791617
382 8019679368 8019678201 Bacteria 8863603
383 8019696145 8019687851 Bacteria 8712826
384 Ga0081455_10043241
385 JGI24737J22298_10065399
386 JGI25406J46586_10002719
387 JGI25153J46596_10001817
388 JGI25153J46596_10003039
389 JGI25153J46596_10003439
390 JGI25153J46596_10007650
391 rootH1_10148004
392 JGI25160J50197_1001066
393 JGI25160J50197_1002120
394 Ga0055539_1007175
395 Ga0055531_10006411
396 Ga0065165_1006189
397 Ga0065165_1041322
398 Ga0065707_10018930
399 Ga0070666_10236860
400 Ga0068868_100612412
401 Ga0070661_100223350
402 Ga0070668_100034137
403 Ga0070669_100060620
404 Ga0070675_100209332
405 Ga0070671_100006731
406 Ga0070667_100126099
407 Ga0070709_10000546
408 Ga0070709_10219951
409 Ga0070714_100010805
410 Ga0070713_100056579
411 Ga0070710_10001828
412 Ga0070711_100003633
413 Ga0070662_100061735
414 Ga0068867_100376578
415 Ga0070693_100335320
416 Ga0068855_100118378
417 Ga0068855_100137510
418 Ga0068855_100550464
419 Ga0068857_100155645
420 Ga0068856_100143351
421 Ga0068852_100050588
422 Ga0068852_100157000
423 Ga0068859_100265332
424 Ga0068858_100109736
425 Ga0068860_100116881
426 Ga0068862_100207356
427 Ga0081455_10007855
428 Ga0081540_1000374
429 Ga0081539_10004407
430 Ga0070717_10299373
431 Ga0075368_10011700
432 Ga0075363_100015525
433 Ga0075364_10204863
434 Ga0070716_100004958
435 Ga0070716_100117882
436 Ga0070712_100050266
437 Ga0075366_10004205
438 Ga0075366_10143824
439 Ga0075428_100546174
440 Ga0075428_100546975
441 Ga0068865_100577671
442 Ga0097620_100265335
443 Ga0099825_1013975
444 Ga0099823_1018712
445 Ga0099794_10106967
446 Ga0099794_10121681
447 Ga0105240_10024919
448 Ga0105240_10591587
449 Ga0111539_10055833
450 Ga0105245_10195521
451 Ga0105247_10019801
452 Ga0105247_10024476
453 Ga0105243_10288012
454 Ga0105241_10273834
455 Ga0105237_10056635
456 Ga0105238_10089884
457 Ga0105239_10036072
458 Ga0105239_10970261
459 Ga0105246_10013110
460 Ga0105246_10575556
461 Ga0157370_10014273
462 Ga0157369_10015321
463 Ga0157369_10124492
464 Ga0157374_10118442
465 Ga0157378_10680593
466 Ga0163162_10612971
467 Ga0157372_10087265
468 Ga0163163_10064024
469 Ga0157380_10620254
470 Ga0157379_10243572
471 Ga0157376_10622516
472 Ga0163161_10095284
473 Ga0214544_1000016
474 Ga0214542_1000016
475 Ga0214545_1000008
476 Ga0214543_1000043
477 Ga0213873_10110350
478 Ga0213876_10026250
479 Ga0213876_10059951
480 Ga0209563_101467
481 Ga0209677_100587
482 Ga0209148_1000504
483 Ga0209233_1048634
484 Ga0209455_1008447
485 Ga0209564_1002162
486 Ga0209758_1000069
487 Ga0209758_1000253
488 Ga0209758_1000397
489 Ga0209758_1001933
490 Ga0209758_1060953
491 Ga0209256_1006099
492 Ga0209256_1021343
493 Ga0207426_1000886
494 Ga0207426_1006444
495 Ga0209051_1039169
496 Ga0209257_1004855
497 Ga0209257_1042170
498 Ga0207656_10118207
499 Ga0207692_10000323
500 Ga0207710_10028249
501 Ga0207688_10214373
502 Ga0207647_10021967
503 Ga0207699_10000309
504 Ga0207699_10030379
505 Ga0207705_10253194
506 Ga0207654_10014346
507 Ga0207695_10045566
508 Ga0207671_10039647
509 Ga0207693_10035221
510 Ga0207657_10063674
511 Ga0207649_10036559
512 Ga0207700_10050087
513 Ga0207664_10008224
514 Ga0207644_10065455
515 Ga0207706_10219978
516 Ga0207709_10112055
517 Ga0207669_10404955
518 Ga0207665_10010426
519 Ga0207665_10150552
520 Ga0207711_10464693
521 Ga0207667_10195521
522 Ga0207668_10119071
523 Ga0207658_10052076
524 Ga0207703_10050720
525 Ga0207678_10035147
526 Ga0207678_10381688
527 Ga0207674_10104389
528 Ga0207698_10085244
529 Ga0207698_10211552
530 Ga0209389_1000071
531 Ga0209489_101361
532 Ga0209700_100011
533 Ga0209588_1076290
534 Ga0209813_10005215
535 Ga0207428_10064466
536 Ga0268265_10031901
537 Ga0265319_1015192
538 Ga0265334_10030865
539 Ga0265323_10006684
540 Ga0265338_10003095
541 Ga0265324_10011207
542 Ga0265320_10043446
543 Ga0265329_10011883
544 Ga0265340_10048800
545 Ga0265313_10085476
546 Ga0307508_10451683
547 Ga0265342_10052554
548 Ga0265342_10084687
549 Ga0373926_0008071
550 Ga0373923_0007894
551 Ga0373954_0015273
552 Ga0373943_0012811
553 Ga0373946_0088018
554 Ga0373955_0033144
555 Ga0373924_0033190
556 Ga0373935_0020819
557 Ga0373927_0044749
558 Ga0373947_0019572
559 Ga0373937_0078732
560 Ga0373925_0012529
561 Ga0395900_0063574
562 Ga0395898_0090181
563 Ga0395905_0011979
564 Ga0395905_0578735
565 Ga0395901_0355127
566 Ga0436365_0008290
567 Ga0436365_0876009
568 Ga0436365_1916758
569 Ga0436363_0201429
570 Ga0436363_0350100
571 Ga0436363_0771435
572 Ga0436362_0047340
573 Ga0439453_0000331
574 Ga0451797_0689165
575 Ga0451795_0093959
576 Ga0451804_0669540
577 Ga0451807_2725667
578 Ga0451851_0483257
579 Ga0466972_0033612
580 Ga0466965_0111361
581 Ga0466968_0012313
582 Ga0466960_0066517
583 Ga0495629_0060467
584 Ga0495651_0052053
585 Ga0495580_0026703
586 Ga0495639_0017393
587 Ga0495664_0029820
588 Ga0495584_0119192
589 Ga0495584_0130878
590 Ga0495594_0056224
591 Ga0495596_0047712
592 Ga0495616_0035054
593 Ga0495618_0020228
594 Ga0495628_0444487
595 Ga0495630_0008615
596 Ga0495652_0086952
597 Ga0495652_0220941
598 Ga0495640_0035629
599 Ga0495597_0019320
600 Ga0495645_0083895
601 Ga0495667_0133971
602 Ga0495668_0037187
603 Ga0495634_0044187
604 Ga0495635_0051877
605 Ga0495646_0096413
606 Ga0495647_0161335
607 Ga0495658_0032162
608 Ga0495613_0198399
609 Ga0495624_0120892
610 Ga0495600_0128154
611 Ga0495660_0043493
612 Ga0495674_0022521
613 Ga0495687_009588
614 Ga0495684_0011096
615 Ga0495593_0006174
616 Ga0496100_0109653
617 Ga0496102_0037647
618 Ga0496103_0011564
619 Ga0496104_0000199
620 Ga0496105_0027731
621 Ga0496106_0176042
622 Ga0496107_0302080
623 Ga0496108_0008778
624 Ga0496108_0299815
625 Ga0496109_0347439
626 Ga0496110_0417615
627 Ga0496112_0059239
628 Ga0496114_0013556
629 Ga0496114_0313053
630 Ga0496118_0046512
631 Ga0496119_0040354
632 Ga0496121_0098845
633 Ga0496122_0109652
634 Ga0496124_0043964
635 Ga0496125_0000406
636 Ga0496125_0062084
637 Ga0496125_0084118
638 Ga0496126_0050072
639 Ga0496126_0212762
640 Ga0495682_0049714
641 nmdc:mga03n38_19581_c1
642 nmdc:mga00v17_32498_c1
643 nmdc:mga06z11_33402_c1
644 nmdc:mga04h51_5353_c1
645 nmdc:mga07m45_153066_c1
646 nmdc:mga07m45_16707_c1
647 nmdc:mga08y16_128805_c1
648 nmdc:mga08y16_99358_c1
649 nmdc:mga0sz30_103651_c1
650 Ga0495601_0160140
651 Ga0500610_0106982
652 Ga0495619_0127439
653 Ga0500566_0009176
654 Ga0500641_0026463
655 Ga0500557_000172
656 Ga0500597_061902
657 Ga0500618_021310
658 Ga0500642_0000444
659 Ga0500619_077750
660 Ga0500627_0075961
661 Ga0500638_106306
662 Ga0500636_0047866
663 Ga0500625_002466
664 Ga0500609_013639
665 2507505365
666 2508539254
667 2508695575
668 2511397163
669 2513624009
670 2513651422
671 2513703457
672 2513863308
673 2513873436
674 2513922595
675 2514014765
676 2515627558
677 2517107198
678 2517888946
679 2524537380
680 2617373850
681 2793062142
682 2805920783
683 2818237769
684 2824623881
685 2824631688
686 2824640269
687 2824647875
688 2824683073
689 2824699727
690 2824709182
691 2824718028
692 2824727868
693 2824735105
694 2824748607
695 2824760970
696 2824771619
697 2824779798
698 2838124609
699 2841945297
700 2841952085
701 2841966033
702 2841970529
703 2841981778
704 2841985056
705 2842043412
706 2842052598
707 2847931167
708 2847942251
709 2849083120
710 2857512019
711 2874594538
712 2874613341
713 2874624883
714 2874649911
715 2876774030
716 2876821910
717 2879078246
718 2879086003
719 2879128400
720 2879143655
721 2881365231
722 2885370918
723 2888379491
724 2888390592
725 2903751383
726 2904670162
727 2904713279
728 2906613998
729 2906641383
730 2906648880
731 2906668738
732 2908776367
733 2922398958
734 2922434114
735 2935615608
736 2935656434
737 2935665263
738 2935825591
739 2935853355
740 2935914827
741 2935918803
742 2935931480
743 2935940077
744 2935947576
745 2935956348
746 2935973141
747 2935980612
748 2935991956
749 2936019283
750 2936027907
751 2936036690
752 2936054728
753 2936060322
754 3005475176
755 3005489103
756 3005509069
757 3005591611
758 3005711090
759 8006936108
760 8006976035
761 8019623071
762 8019640578
763 8019666866
764 8019676625
765 8019679368
766 8019696145

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01790

LGT

Prolipoprotein diacylglyceryl transferase

47

210

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
8dkx-assembly1.cif.gz_P cryo-em structure of cystinosin n288k mutant in a cytosol-open state at ph7.5 0.3283 16 236
5lnx-assembly1.cif.gz_C crystal structure of mmgc, an acyl-coa dehydrogenase from bacillus subtilis. 0.3252 113 236
6pzt-assembly1.cif.gz_A cryo-em structure of human nkcc1 0.3208 86 235
8fho-assembly1.cif.gz_A cryo-em structure of human ncc (class 1) 0.3202 89 235
1ukw-assembly1.cif.gz_A crystal structure of medium-chain acyl-coa dehydrogenase from thermus thermophilus hb8 0.3132 111 236
ID Description Score Start End Superfamily
af_A3BWJ9_6_100_1.20.1280.290 Mainly Alpha;Up-down Bundle;Monooxygenase; 0.4652 161 242 1.20.1280.290
af_G5EEQ9_4_113_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.4509 111 236 1.20.120.550
af_G5EEQ9_4_113_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.4369 111 236 1.20.120.550
af_Q3KQJ0_93_231_1.10.10.1740 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like 0.4318 99 236 1.10.10.1740
af_P0ADJ8_1_145_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4217 22 129 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A840GFD2-F1-model_v4 Prolipoprotein diacylglyceryltransferase 0.9128 14 250 GO:0005886
GO:0008961
GO:0042158
AF-H0SN82-F1-model_v4 Diacylglyceryl transferase 0.9075 14 250 GO:0005886
GO:0008961
GO:0042158
AF-A0A840GFD2-F1-model_v4 Prolipoprotein diacylglyceryltransferase 0.9055 14 250 GO:0005886
GO:0008961
GO:0042158
AF-H0SN82-F1-model_v4 Diacylglyceryl transferase 0.8965 14 250 GO:0005886
GO:0008961
GO:0042158
AF-A0A5C6TX00-F1-model_v4 Prolipoprotein diacylglyceryl transferase 0.8892 51 236 GO:0005886
GO:0008961
GO:0042158

Map