F429524

General Info

Members Datasets Scaffolds Average Seq Length
383 173 766 776

Family's Representative Sequence

Representative Sequence 3300005563|Ga0068855_100015623|Ga0068855_1000156234
Length 813
Sequence MTDTQPASAPPPTRTLARRIYAILLLAIGLLLTVGGIYLLSLGGSPYYFFAGLAVAISGALVWRGDRNGARLYGAMLIATLAWSLWEAGIDGWALMPRLVGPFIFGLGFLLPAISRGLTDHNAEPRSWQGWRGFGAGLGGALILGLLVHIAIGGDLPDPMFQTGTTTAAEIAADNPIPTDPRAGEWLHYGNDQGGSRYSPLAQLTPANVAGLEVAWTVHVGGIVGNPMEKLEVTPLKVGDSLYVCTGYNDILSIDAESGQINWRYRAGVDQKKVITAVCRGVAYYQVPGATGLCAARIIGTTGDGRLIAIDAATGAPCPGFGTNGQTSLFTGLGKVDAGYYTVTSAPTIARGKIVIGGSVLDGQYWGEPSGVIRAYDAITGKFAWAFDMGRPNEHGEPGPGQTYTHSTPNSWSPMSADDNLGLIYVPTGNSTPDYYGGKRRPFDDQYSSSVVALDANTGAVRWSFQTTHHDIWDYDLASQPTLVDIRTSSGIQPALIQPTKRGELFLLDRRTGHPLATVEERPAPQGGVGDGDWLSPTQPFSTGMPSFSGPAFRERDMWGLTPLDQLYCRIAFRKARYDGPLTPIGPNRPSVVFPGYVGGVDWGSVAVDPVRQLMIVNSSRVANLDQLLTRKQADAAGIKPYGQGHASNIAGAGAQEGTPYAADVRPFFSPLWVPCNKPPYGMIAAVDLVTRKLVWAEPFGTARGSGPFGIPSLLPVTMGVPNTGGSVLTRGGLAFIGASQDRGFRAYDTATGKELWHAVLPGGGNATPMTYWSAKSKRQFVVIAAGGFVYLGAKQSDAIVAYALPRSAAKKP

Samples

Sample ID Description Type Environment
1 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
7 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
8 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
9 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
10 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
11 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
12 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
13 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
16 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
55 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
56 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
57 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
58 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
59 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
62 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
68 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
72 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
78 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
79 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
80 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
81 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
120 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
124 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
125 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
126 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
127 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
128 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
129 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
130 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
131 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
132 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
133 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
134 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
135 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
136 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
137 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
138 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
139 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
140 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
141 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
142 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
143 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
144 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
145 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
146 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
147 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
148 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
149 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
150 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
151 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
152 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
153 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
155 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
156 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
157 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
158 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
159 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
160 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
161 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
162 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
163 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
164 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
165 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
166 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
167 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
168 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
169 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
170 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
171 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
172 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
173 2919709256 Sphingobium xenophagum 4256 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.74
Metatranscriptomes 0
Isolates 0.26

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.13
Nodule 0
Rhizoplane 1.04
Rhizosphere 91.12
Stem 0
Stem Tuber 0
Unclassified 0.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068855_100015623 3300005563 Bacteria 9134
2 JGI24736J21556_1000039 3300001904 Bacteria 21072
3 JGI24736J21556_1000241 3300001904 Bacteria 9959
4 JGI24752J21851_1000324 3300001976 Bacteria 6632
5 JGI24740J21852_10008649 3300001979 Bacteria 4042
6 JGI24739J22299_10001790 3300001989 Bacteria 8181
7 JGI24739J22299_10006675 3300001989 Bacteria 4342
8 JGI24737J22298_10004658 3300001990 Bacteria 4770
9 JGI24735J21928_10000190 3300002067 Bacteria 21738
10 JGI24735J21928_10001082 3300002067 Bacteria 9762
11 JGI24750J21931_1000387 3300002070 Bacteria 7505
12 JGI24748J21848_1000048 3300002074 Bacteria 56138
13 JGI24738J21930_10003541 3300002075 Bacteria 3923
14 JGI24749J21850_1000708 3300002076 Unclassified 4804
15 JGI24034J26672_10000007 3300002239 Bacteria 224370
16 Ga0065712_10068846 3300005290 Bacteria 8804
17 Ga0065712_10069133 3300005290 Bacteria 7946
18 Ga0070658_10000244 3300005327 Bacteria 48413
19 Ga0070676_10003802 3300005328 Bacteria 7920
20 Ga0070690_100000022 3300005330 Bacteria 72853
21 Ga0070690_100000788 3300005330 Bacteria 16087
22 Ga0070690_100025086 3300005330 Bacteria 3670
23 Ga0070670_100000585 3300005331 Bacteria 28789
24 Ga0070670_100000738 3300005331 Bacteria 25408
25 Ga0068869_100002112 3300005334 Bacteria 11948
26 Ga0068869_100006515 3300005334 Bacteria 7413
27 Ga0070666_10000017 3300005335 Bacteria 190526
28 Ga0070660_100008824 3300005339 Bacteria 7067
29 Ga0070689_100000555 3300005340 Bacteria 22356
30 Ga0070689_100002121 3300005340 Bacteria 12888
31 Ga0070687_100007526 3300005343 Bacteria 4547
32 Ga0070661_100001303 3300005344 Bacteria 17519
33 Ga0070669_100000117 3300005353 Bacteria 74010
34 Ga0070669_100008615 3300005353 Bacteria 7277
35 Ga0070675_100002990 3300005354 Bacteria 12769
36 Ga0070671_100001824 3300005355 Bacteria 16213
37 Ga0070671_100033472 3300005355 Bacteria 4251
38 Ga0070673_100000874 3300005364 Bacteria 16961
39 Ga0070673_100003585 3300005364 Bacteria 9698
40 Ga0070688_100002476 3300005365 Bacteria 9342
41 Ga0070688_100013867 3300005365 Bacteria 4558
42 Ga0070659_100012636 3300005366 Bacteria 6262
43 Ga0070667_100000571 3300005367 Bacteria 36480
44 Ga0070667_100001260 3300005367 Bacteria 22983
45 Ga0070705_100015385 3300005440 Bacteria 3955
46 Ga0070705_100025172 3300005440 Bacteria 3224
47 Ga0070662_100004897 3300005457 Bacteria 8500
48 Ga0070681_10075324 3300005458 Bacteria 3335
49 Ga0070685_10000126 3300005466 Bacteria 48870
50 Ga0070698_100007329 3300005471 Bacteria 11942
51 Ga0070697_100015220 3300005536 Bacteria 6038
52 Ga0068853_100009230 3300005539 Bacteria 7947
53 Ga0068853_100020654 3300005539 Bacteria 5476
54 Ga0070672_100048414 3300005543 Bacteria 3303
55 Ga0070686_100000014 3300005544 Bacteria 166729
56 Ga0070686_100000521 3300005544 Bacteria 23054
57 Ga0070686_100005624 3300005544 Bacteria 6944
58 Ga0070665_100000042 3300005548 Bacteria 292582
59 Ga0070665_100001503 3300005548 Bacteria 27131
60 Ga0070665_100009930 3300005548 Bacteria 9628
61 Ga0068855_100001754 3300005563 Bacteria 27072
62 Ga0070664_100001883 3300005564 Bacteria 16838
63 Ga0068857_100061239 3300005577 Bacteria 3344
64 Ga0068854_100002582 3300005578 Bacteria 11220
65 Ga0068854_100011689 3300005578 Bacteria 5726
66 Ga0068854_100018035 3300005578 Bacteria 4732
67 Ga0068854_100059406 3300005578 Bacteria 2763
68 Ga0068856_100022842 3300005614 Bacteria 6084
69 Ga0070702_100002562 3300005615 Bacteria 7896
70 Ga0068852_100000492 3300005616 Bacteria 25824
71 Ga0068852_100018285 3300005616 Bacteria 5521
72 Ga0068859_100001116 3300005617 Bacteria 27403
73 Ga0068859_100002627 3300005617 Bacteria 18279
74 Ga0068859_100012686 3300005617 Bacteria 8473
75 Ga0068859_100020954 3300005617 Bacteria 6561
76 Ga0068859_100024499 3300005617 Bacteria 6055
77 Ga0068859_100025006 3300005617 Bacteria 5994
78 Ga0068859_100039313 3300005617 Bacteria 4745
79 Ga0068864_100000063 3300005618 Bacteria 119845
80 Ga0068864_100000532 3300005618 Bacteria 32652
81 Ga0068864_100009833 3300005618 Bacteria 7885
82 Ga0068861_100000013 3300005719 Bacteria 80820
83 Ga0068861_100000516 3300005719 Bacteria 22581
84 Ga0068861_100002055 3300005719 Bacteria 13047
85 Ga0068861_100002936 3300005719 Bacteria 11254
86 Ga0068861_100008160 3300005719 Bacteria 7204
87 Ga0068863_100000062 3300005841 Bacteria 119845
88 Ga0068863_100000068 3300005841 Bacteria 117128
89 Ga0068863_100000631 3300005841 Bacteria 35733
90 Ga0068863_100001597 3300005841 Bacteria 22386
91 Ga0068863_100003560 3300005841 Bacteria 15368
92 Ga0068863_100038550 3300005841 Bacteria 4546
93 Ga0068858_100000104 3300005842 Bacteria 88260
94 Ga0068858_100003658 3300005842 Bacteria 15221
95 Ga0068858_100015516 3300005842 Bacteria 7163
96 Ga0068860_100000062 3300005843 Bacteria 190526
97 Ga0068860_100014781 3300005843 Bacteria 7634
98 Ga0068860_100069836 3300005843 Bacteria 3339
99 Ga0068862_100000069 3300005844 Bacteria 122535
100 Ga0068862_100000208 3300005844 Bacteria 65480
101 Ga0068862_100000539 3300005844 Bacteria 39582
102 Ga0068862_100000654 3300005844 Bacteria 35733
103 Ga0068862_100003214 3300005844 Bacteria 14161
104 Ga0068862_100005145 3300005844 Bacteria 10997
105 Ga0068862_100006609 3300005844 Bacteria 9617
106 Ga0068862_100008538 3300005844 Bacteria 8475
107 Ga0068862_100011841 3300005844 Bacteria 7202
108 Ga0081455_10000076 3300005937 Bacteria 105979
109 Ga0081455_10000940 3300005937 Bacteria 37224
110 Ga0075428_100000982 3300006844 Bacteria 30234
111 Ga0075428_100001605 3300006844 Bacteria 24176
112 Ga0075428_100009373 3300006844 Bacteria 10860
113 Ga0075428_100020187 3300006844 Bacteria 7379
114 Ga0075430_100000566 3300006846 Bacteria 28123
115 Ga0075430_100001955 3300006846 Bacteria 16932
116 Ga0075430_100015284 3300006846 Bacteria 6536
117 Ga0075430_100027647 3300006846 Bacteria 4819
118 Ga0075431_100000252 3300006847 Bacteria 40784
119 Ga0075431_100049401 3300006847 Bacteria 4337
120 Ga0075433_10013453 3300006852 Bacteria 6653
121 Ga0075433_10026325 3300006852 Bacteria 4923
122 Ga0075429_100000217 3300006880 Bacteria 38727
123 Ga0075429_100002806 3300006880 Bacteria 14744
124 Ga0075429_100011711 3300006880 Bacteria 7607
125 Ga0097620_100001116 3300006931 Bacteria 27403
126 Ga0097620_100002627 3300006931 Bacteria 18279
127 Ga0097620_100012686 3300006931 Bacteria 8473
128 Ga0097620_100020954 3300006931 Bacteria 6561
129 Ga0097620_100024499 3300006931 Bacteria 6055
130 Ga0097620_100025006 3300006931 Bacteria 5994
131 Ga0097620_100039313 3300006931 Bacteria 4745
132 Ga0075435_100011980 3300007076 Bacteria 6405
133 Ga0105251_10001797 3300009011 Bacteria 17820
134 Ga0105251_10002443 3300009011 Bacteria 14608
135 Ga0105251_10002501 3300009011 Bacteria 14380
136 Ga0105240_10001185 3300009093 Bacteria 45610
137 Ga0105240_10007151 3300009093 Bacteria 16260
138 Ga0105240_10009178 3300009093 Bacteria 14027
139 Ga0105240_10026574 3300009093 Bacteria 7595
140 Ga0105240_10039471 3300009093 Bacteria 6045
141 Ga0105240_10086484 3300009093 Bacteria 3839
142 Ga0111539_10001424 3300009094 Bacteria 31864
143 Ga0111539_10003537 3300009094 Bacteria 20603
144 Ga0111539_10006800 3300009094 Bacteria 14712
145 Ga0111539_10008647 3300009094 Bacteria 12923
146 Ga0111539_10074289 3300009094 Bacteria 4005
147 Ga0114129_10002967 3300009147 Bacteria 23745
148 Ga0114129_10014141 3300009147 Bacteria 11370
149 Ga0114129_10025783 3300009147 Bacteria 8326
150 Ga0114129_10042567 3300009147 Bacteria 6393
151 Ga0114129_10068972 3300009147 Bacteria 4929
152 Ga0114129_10076948 3300009147 Bacteria 4643
153 Ga0105248_10000536 3300009177 Bacteria 43208
154 Ga0105248_10002276 3300009177 Bacteria 21259
155 Ga0105248_10004061 3300009177 Bacteria 16178
156 Ga0105248_10005129 3300009177 Bacteria 14458
157 Ga0105248_10011127 3300009177 Bacteria 9928
158 Ga0105248_10015751 3300009177 Bacteria 8333
159 Ga0105237_10001356 3300009545 Bacteria 32409
160 Ga0105237_10100557 3300009545 Bacteria 2883
161 Ga0105238_10008700 3300009551 Bacteria 10155
162 Ga0105238_10008925 3300009551 Bacteria 10035
163 Ga0105238_10023512 3300009551 Bacteria 6280
164 Ga0105238_10104047 3300009551 Bacteria 2820
165 Ga0105249_10000012 3300009553 Bacteria 292640
166 Ga0105249_10000160 3300009553 Bacteria 81883
167 Ga0105249_10000184 3300009553 Bacteria 71944
168 Ga0105249_10000399 3300009553 Bacteria 41954
169 Ga0105239_10000151 3300010375 Bacteria 99979
170 Ga0157373_10008210 3300013100 Bacteria 7765
171 Ga0157369_10009144 3300013105 Bacteria 11338
172 Ga0163162_10003638 3300013306 Bacteria 14776
173 Ga0163162_10035956 3300013306 Bacteria 4934
174 Ga0157372_10019703 3300013307 Bacteria 7271
175 Ga0157372_10038833 3300013307 Bacteria 5253
176 Ga0157375_10078234 3300013308 Bacteria 3340
177 Ga0163163_10004475 3300014325 Bacteria 11923
178 Ga0157380_10000336 3300014326 Bacteria 28018
179 Ga0157379_10019265 3300014968 Bacteria 6025
180 Ga0157376_10040570 3300014969 Bacteria 3805
181 Ga0163161_10000025 3300017792 Bacteria 201127
182 Ga0207713_1004139 3300025735 Bacteria 9545
183 Ga0207713_1004846 3300025735 Bacteria 8628
184 Ga0207680_10000012 3300025903 Bacteria 293810
185 Ga0207647_10001097 3300025904 Bacteria 20881
186 Ga0207645_10021671 3300025907 Bacteria 4188
187 Ga0207705_10000224 3300025909 Bacteria 56164
188 Ga0207654_10006593 3300025911 Bacteria 5836
189 Ga0207654_10009738 3300025911 Bacteria 4889
190 Ga0207695_10000512 3300025913 Bacteria 82557
191 Ga0207695_10007899 3300025913 Bacteria 13428
192 Ga0207695_10019439 3300025913 Bacteria 7823
193 Ga0207695_10023718 3300025913 Bacteria 6923
194 Ga0207695_10027833 3300025913 Bacteria 6285
195 Ga0207671_10001120 3300025914 Bacteria 32314
196 Ga0207662_10018641 3300025918 Bacteria 3942
197 Ga0207662_10032253 3300025918 Bacteria 3048
198 Ga0207657_10007554 3300025919 Bacteria 11142
199 Ga0207681_10000249 3300025923 Bacteria 41036
200 Ga0207694_10005797 3300025924 Bacteria 9464
201 Ga0207694_10006292 3300025924 Bacteria 9065
202 Ga0207694_10016229 3300025924 Bacteria 5620
203 Ga0207694_10029853 3300025924 Bacteria 4162
204 Ga0207694_10067623 3300025924 Bacteria 2789
205 Ga0207650_10000197 3300025925 Bacteria 69480
206 Ga0207650_10000290 3300025925 Bacteria 50898
207 Ga0207659_10005025 3300025926 Bacteria 8019
208 Ga0207644_10001065 3300025931 Bacteria 17530
209 Ga0207706_10011811 3300025933 Bacteria 7953
210 Ga0207706_10014406 3300025933 Bacteria 7166
211 Ga0207706_10016074 3300025933 Bacteria 6764
212 Ga0207706_10020632 3300025933 Bacteria 5922
213 Ga0207706_10036402 3300025933 Bacteria 4371
214 Ga0207670_10003318 3300025936 Bacteria 8532
215 Ga0207691_10012136 3300025940 Bacteria 8260
216 Ga0207711_10000017 3300025941 Bacteria 441730
217 Ga0207711_10000128 3300025941 Bacteria 79596
218 Ga0207711_10008790 3300025941 Bacteria 8447
219 Ga0207711_10030521 3300025941 Bacteria 4546
220 Ga0207689_10005252 3300025942 Bacteria 11618
221 Ga0207689_10005390 3300025942 Bacteria 11448
222 Ga0207679_10006485 3300025945 Bacteria 7399
223 Ga0207679_10015043 3300025945 Bacteria 5101
224 Ga0207667_10000642 3300025949 Bacteria 45282
225 Ga0207667_10000645 3300025949 Bacteria 45224
226 Ga0207667_10010810 3300025949 Bacteria 10643
227 Ga0207667_10012251 3300025949 Bacteria 9901
228 Ga0207667_10015307 3300025949 Bacteria 8721
229 Ga0207651_10001983 3300025960 Bacteria 9624
230 Ga0207712_10000021 3300025961 Bacteria 292649
231 Ga0207712_10000059 3300025961 Bacteria 137849
232 Ga0207712_10000222 3300025961 Bacteria 56073
233 Ga0207712_10000531 3300025961 Bacteria 31280
234 Ga0207712_10045658 3300025961 Bacteria 3035
235 Ga0207668_10000998 3300025972 Bacteria 16936
236 Ga0207640_10001422 3300025981 Bacteria 12958
237 Ga0207640_10003891 3300025981 Bacteria 8060
238 Ga0207640_10006550 3300025981 Bacteria 6394
239 Ga0207640_10026358 3300025981 Bacteria 3528
240 Ga0207658_10000133 3300025986 Bacteria 78402
241 Ga0207658_10002781 3300025986 Bacteria 12588
242 Ga0207658_10003918 3300025986 Bacteria 10463
243 Ga0207703_10000136 3300026035 Bacteria 89612
244 Ga0207703_10002599 3300026035 Bacteria 15584
245 Ga0207703_10021961 3300026035 Bacteria 4998
246 Ga0207639_10001943 3300026041 Bacteria 13872
247 Ga0207639_10010334 3300026041 Bacteria 6463
248 Ga0207678_10026157 3300026067 Bacteria 5092
249 Ga0207678_10030074 3300026067 Bacteria 4742
250 Ga0207708_10015820 3300026075 Bacteria 5661
251 Ga0207702_10029191 3300026078 Bacteria 4587
252 Ga0207702_10042617 3300026078 Bacteria 3808
253 Ga0207641_10000022 3300026088 Bacteria 279334
254 Ga0207641_10000037 3300026088 Bacteria 206551
255 Ga0207641_10000701 3300026088 Bacteria 36082
256 Ga0207641_10002671 3300026088 Bacteria 16290
257 Ga0207641_10007346 3300026088 Bacteria 9173
258 Ga0207641_10017763 3300026088 Bacteria 5828
259 Ga0207648_10002549 3300026089 Bacteria 19533
260 Ga0207676_10000056 3300026095 Bacteria 124484
261 Ga0207676_10000421 3300026095 Bacteria 35747
262 Ga0207676_10001393 3300026095 Bacteria 17980
263 Ga0207676_10001652 3300026095 Bacteria 16425
264 Ga0207676_10008546 3300026095 Bacteria 7277
265 Ga0207674_10005096 3300026116 Bacteria 15686
266 Ga0207674_10027958 3300026116 Bacteria 5959
267 Ga0207674_10069002 3300026116 Bacteria 3556
268 Ga0207675_100000054 3300026118 Bacteria 82248
269 Ga0207675_100000088 3300026118 Bacteria 71728
270 Ga0207675_100001931 3300026118 Bacteria 20686
271 Ga0207675_100003854 3300026118 Bacteria 14580
272 Ga0207675_100105076 3300026118 Bacteria 2661
273 Ga0207698_10000005 3300026142 Bacteria 295687
274 Ga0207428_10002599 3300027907 Bacteria 18039
275 Ga0268266_10000054 3300028379 Bacteria 292717
276 Ga0268266_10000718 3300028379 Bacteria 44682
277 Ga0268266_10030492 3300028379 Bacteria 4582
278 Ga0268265_10000044 3300028380 Bacteria 182545
279 Ga0268265_10000092 3300028380 Bacteria 114086
280 Ga0268265_10000225 3300028380 Bacteria 65493
281 Ga0268265_10000604 3300028380 Bacteria 36082
282 Ga0268265_10001795 3300028380 Bacteria 17206
283 Ga0268265_10002038 3300028380 Bacteria 15846
284 Ga0268265_10003512 3300028380 Bacteria 11221
285 Ga0268265_10013761 3300028380 Bacteria 5506
286 Ga0268265_10032249 3300028380 Bacteria 3794
287 Ga0268264_10000074 3300028381 Bacteria 259555
288 Ga0268264_10000691 3300028381 Bacteria 39209
289 Ga0268264_10001924 3300028381 Bacteria 18728
290 Ga0268264_10015505 3300028381 Bacteria 6247
291 Ga0268264_10024280 3300028381 Bacteria 4949
292 Ga0307513_10007371 3300031456 Bacteria 14276
293 Ga0307509_10000114 3300031507 Bacteria 116573
294 Ga0307408_100077666 3300031548 Bacteria 2473
295 Ga0307406_10008813 3300031901 Bacteria 5638
296 Ga0307412_10009939 3300031911 Bacteria 5473
297 Ga0307412_10015953 3300031911 Bacteria 4463
298 Ga0307412_10019040 3300031911 Bacteria 4146
299 Ga0307412_10047846 3300031911 Bacteria 2810
300 Ga0307416_100054804 3300032002 Bacteria 3207
301 Ga0307414_10003450 3300032004 Bacteria 8435
302 Ga0373939_0009600 3300035114 Bacteria 2404
303 Ga0395905_0001165 3300037471 Bacteria 32811
304 Ga0451576_0009000 3300045051 Bacteria 11632
305 Ga0495590_0004389 3300046457 Bacteria 5700
306 Ga0495653_0003457 3300046463 Bacteria 12699
307 Ga0495607_0006172 3300046501 Bacteria 8470
308 Ga0495606_0001774 3300046507 Bacteria 27620
309 Ga0495630_0010258 3300046517 Bacteria 6760
310 Ga0495654_0001325 3300046530 Bacteria 17289
311 Ga0495668_0001488 3300046616 Bacteria 22433
312 Ga0495649_0000021 3300046694 Bacteria 180395
313 Ga0496102_0042971 3300048905 Bacteria 4096
314 Ga0496103_0001982 3300048906 Bacteria 13238
315 Ga0496103_0010274 3300048906 Bacteria 5536
316 Ga0496111_0069492 3300048914 Bacteria 2561
317 Ga0496116_0009846 3300048919 Bacteria 8092
318 Ga0496117_0004416 3300048920 Bacteria 15530
319 Ga0496117_0008150 3300048920 Bacteria 10009
320 Ga0496117_0009486 3300048920 Bacteria 9047
321 Ga0496117_0010846 3300048920 Bacteria 8223
322 Ga0496118_0000253 3300048921 Bacteria 94328
323 Ga0496118_0001477 3300048921 Bacteria 35201
324 Ga0496118_0003310 3300048921 Bacteria 20440
325 Ga0496118_0003379 3300048921 Bacteria 20168
326 Ga0496121_0002580 3300048924 Bacteria 27413
327 Ga0496122_0009903 3300048925 Bacteria 9930
328 Ga0496123_0023952 3300048926 Bacteria 4657
329 Ga0496124_0036331 3300048927 Bacteria 4299
330 Ga0496125_0000635 3300048928 Bacteria 58654
331 Ga0496126_0024033 3300048929 Bacteria 5890
332 Ga0501047_0017479 3300049581 Bacteria 6870
333 Ga0501223_000047 3300049663 Bacteria 41715
334 Ga0501223_000482 3300049663 Bacteria 9601
335 Ga0501224_000017 3300049664 Bacteria 81060
336 Ga0501224_000091 3300049664 Bacteria 9640
337 Ga0501233_000215 3300049668 Bacteria 8608
338 Ga0501233_000339 3300049668 Bacteria 7267
339 Ga0501225_0000007 3300049705 Bacteria 107771
340 Ga0501225_0000848 3300049705 Bacteria 9512
341 Ga0501234_001376 3300049707 Bacteria 3819
342 Ga0501226_000040 3300049853 Bacteria 60590
343 Ga0501226_000195 3300049853 Bacteria 9640
344 nmdc:mga05p37_12511_c1 3300050507 Bacteria 10130
345 nmdc:mga05p37_129498_c1 3300050507 Bacteria 3096
346 nmdc:mga05p37_1706_c1 3300050507 Bacteria 25587
347 nmdc:mga05p37_40605_c1 3300050507 Bacteria 5714
348 nmdc:mga05p37_43477_c1 3300050507 Bacteria 5527
349 nmdc:mga05p37_5727_c1 3300050507 Bacteria 14612
350 nmdc:mga05p37_9107_c2 3300050507 Bacteria 11372
351 nmdc:mga09592_1177_c1 3300050508 Bacteria 20876
352 nmdc:mga09592_145_c1 3300050508 Bacteria 47800
353 nmdc:mga09592_51262_c1 3300050508 Bacteria 3482
354 nmdc:mga09592_78514_c1 3300050508 Bacteria 2809
355 nmdc:mga0qj67_2838_c1 3300050509 Bacteria 12423
356 nmdc:mga0qj67_28835_c1 3300050509 Bacteria 4309
357 nmdc:mga0qj67_573_c1 3300050509 Bacteria 25116
358 nmdc:mga06r32_1203_c1 3300050510 Bacteria 23298
359 nmdc:mga06r32_1326_c1 3300050510 Bacteria 22324
360 nmdc:mga06r32_40_c1 3300050510 Bacteria 79168
361 nmdc:mga06r32_4877_c1 3300050510 Bacteria 12084
362 nmdc:mga06r32_584_c1 3300050510 Bacteria 31769
363 nmdc:mga06r32_8_c1 3300050510 Bacteria 120971
364 nmdc:mga08y16_11501_c1 3300050511 Bacteria 9299
365 nmdc:mga08y16_12605_c1 3300050511 Bacteria 8893
366 nmdc:mga08y16_148_c1 3300050511 Bacteria 60964
367 nmdc:mga08y16_154246_c1 3300050511 Bacteria 2387
368 nmdc:mga08y16_22529_c1 3300050511 Bacteria 6651
369 nmdc:mga08x19_28677_c1 3300050514 Bacteria 3488
370 nmdc:mga0a205_19637_c1 3300050515 Bacteria 6374
371 Ga0500643_000141 3300053087 Bacteria 72511
372 Ga0500643_000188 3300053087 Bacteria 59049
373 Ga0500592_000026 3300053116 Bacteria 49457
374 Ga0500592_000073 3300053116 Bacteria 25395
375 Ga0500592_000656 3300053116 Bacteria 5692
376 Ga0500604_0004710 3300053151 Bacteria 3612
377 Ga0500604_0005063 3300053151 Bacteria 3487
378 Ga0500622_0000294 3300053156 Bacteria 51192
379 Ga0500622_0004082 3300053156 Bacteria 9361
380 Ga0500627_0000377 3300053158 Bacteria 12135
381 Ga0500627_0001231 3300053158 Bacteria 7053
382 Ga0500611_001418 3300053727 Bacteria 2627
383 2919710107 2919709256 Bacteria 4318106
384 Ga0068855_100015623
385 JGI24736J21556_1000039
386 JGI24736J21556_1000241
387 JGI24752J21851_1000324
388 JGI24740J21852_10008649
389 JGI24739J22299_10001790
390 JGI24739J22299_10006675
391 JGI24737J22298_10004658
392 JGI24735J21928_10000190
393 JGI24735J21928_10001082
394 JGI24750J21931_1000387
395 JGI24748J21848_1000048
396 JGI24738J21930_10003541
397 JGI24749J21850_1000708
398 JGI24034J26672_10000007
399 Ga0065712_10068846
400 Ga0065712_10069133
401 Ga0070658_10000244
402 Ga0070676_10003802
403 Ga0070690_100000022
404 Ga0070690_100000788
405 Ga0070690_100025086
406 Ga0070670_100000585
407 Ga0070670_100000738
408 Ga0068869_100002112
409 Ga0068869_100006515
410 Ga0070666_10000017
411 Ga0070660_100008824
412 Ga0070689_100000555
413 Ga0070689_100002121
414 Ga0070687_100007526
415 Ga0070661_100001303
416 Ga0070669_100000117
417 Ga0070669_100008615
418 Ga0070675_100002990
419 Ga0070671_100001824
420 Ga0070671_100033472
421 Ga0070673_100000874
422 Ga0070673_100003585
423 Ga0070688_100002476
424 Ga0070688_100013867
425 Ga0070659_100012636
426 Ga0070667_100000571
427 Ga0070667_100001260
428 Ga0070705_100015385
429 Ga0070705_100025172
430 Ga0070662_100004897
431 Ga0070681_10075324
432 Ga0070685_10000126
433 Ga0070698_100007329
434 Ga0070697_100015220
435 Ga0068853_100009230
436 Ga0068853_100020654
437 Ga0070672_100048414
438 Ga0070686_100000014
439 Ga0070686_100000521
440 Ga0070686_100005624
441 Ga0070665_100000042
442 Ga0070665_100001503
443 Ga0070665_100009930
444 Ga0068855_100001754
445 Ga0070664_100001883
446 Ga0068857_100061239
447 Ga0068854_100002582
448 Ga0068854_100011689
449 Ga0068854_100018035
450 Ga0068854_100059406
451 Ga0068856_100022842
452 Ga0070702_100002562
453 Ga0068852_100000492
454 Ga0068852_100018285
455 Ga0068859_100001116
456 Ga0068859_100002627
457 Ga0068859_100012686
458 Ga0068859_100020954
459 Ga0068859_100024499
460 Ga0068859_100025006
461 Ga0068859_100039313
462 Ga0068864_100000063
463 Ga0068864_100000532
464 Ga0068864_100009833
465 Ga0068861_100000013
466 Ga0068861_100000516
467 Ga0068861_100002055
468 Ga0068861_100002936
469 Ga0068861_100008160
470 Ga0068863_100000062
471 Ga0068863_100000068
472 Ga0068863_100000631
473 Ga0068863_100001597
474 Ga0068863_100003560
475 Ga0068863_100038550
476 Ga0068858_100000104
477 Ga0068858_100003658
478 Ga0068858_100015516
479 Ga0068860_100000062
480 Ga0068860_100014781
481 Ga0068860_100069836
482 Ga0068862_100000069
483 Ga0068862_100000208
484 Ga0068862_100000539
485 Ga0068862_100000654
486 Ga0068862_100003214
487 Ga0068862_100005145
488 Ga0068862_100006609
489 Ga0068862_100008538
490 Ga0068862_100011841
491 Ga0081455_10000076
492 Ga0081455_10000940
493 Ga0075428_100000982
494 Ga0075428_100001605
495 Ga0075428_100009373
496 Ga0075428_100020187
497 Ga0075430_100000566
498 Ga0075430_100001955
499 Ga0075430_100015284
500 Ga0075430_100027647
501 Ga0075431_100000252
502 Ga0075431_100049401
503 Ga0075433_10013453
504 Ga0075433_10026325
505 Ga0075429_100000217
506 Ga0075429_100002806
507 Ga0075429_100011711
508 Ga0097620_100001116
509 Ga0097620_100002627
510 Ga0097620_100012686
511 Ga0097620_100020954
512 Ga0097620_100024499
513 Ga0097620_100025006
514 Ga0097620_100039313
515 Ga0075435_100011980
516 Ga0105251_10001797
517 Ga0105251_10002443
518 Ga0105251_10002501
519 Ga0105240_10001185
520 Ga0105240_10007151
521 Ga0105240_10009178
522 Ga0105240_10026574
523 Ga0105240_10039471
524 Ga0105240_10086484
525 Ga0111539_10001424
526 Ga0111539_10003537
527 Ga0111539_10006800
528 Ga0111539_10008647
529 Ga0111539_10074289
530 Ga0114129_10002967
531 Ga0114129_10014141
532 Ga0114129_10025783
533 Ga0114129_10042567
534 Ga0114129_10068972
535 Ga0114129_10076948
536 Ga0105248_10000536
537 Ga0105248_10002276
538 Ga0105248_10004061
539 Ga0105248_10005129
540 Ga0105248_10011127
541 Ga0105248_10015751
542 Ga0105237_10001356
543 Ga0105237_10100557
544 Ga0105238_10008700
545 Ga0105238_10008925
546 Ga0105238_10023512
547 Ga0105238_10104047
548 Ga0105249_10000012
549 Ga0105249_10000160
550 Ga0105249_10000184
551 Ga0105249_10000399
552 Ga0105239_10000151
553 Ga0157373_10008210
554 Ga0157369_10009144
555 Ga0163162_10003638
556 Ga0163162_10035956
557 Ga0157372_10019703
558 Ga0157372_10038833
559 Ga0157375_10078234
560 Ga0163163_10004475
561 Ga0157380_10000336
562 Ga0157379_10019265
563 Ga0157376_10040570
564 Ga0163161_10000025
565 Ga0207713_1004139
566 Ga0207713_1004846
567 Ga0207680_10000012
568 Ga0207647_10001097
569 Ga0207645_10021671
570 Ga0207705_10000224
571 Ga0207654_10006593
572 Ga0207654_10009738
573 Ga0207695_10000512
574 Ga0207695_10007899
575 Ga0207695_10019439
576 Ga0207695_10023718
577 Ga0207695_10027833
578 Ga0207671_10001120
579 Ga0207662_10018641
580 Ga0207662_10032253
581 Ga0207657_10007554
582 Ga0207681_10000249
583 Ga0207694_10005797
584 Ga0207694_10006292
585 Ga0207694_10016229
586 Ga0207694_10029853
587 Ga0207694_10067623
588 Ga0207650_10000197
589 Ga0207650_10000290
590 Ga0207659_10005025
591 Ga0207644_10001065
592 Ga0207706_10011811
593 Ga0207706_10014406
594 Ga0207706_10016074
595 Ga0207706_10020632
596 Ga0207706_10036402
597 Ga0207670_10003318
598 Ga0207691_10012136
599 Ga0207711_10000017
600 Ga0207711_10000128
601 Ga0207711_10008790
602 Ga0207711_10030521
603 Ga0207689_10005252
604 Ga0207689_10005390
605 Ga0207679_10006485
606 Ga0207679_10015043
607 Ga0207667_10000642
608 Ga0207667_10000645
609 Ga0207667_10010810
610 Ga0207667_10012251
611 Ga0207667_10015307
612 Ga0207651_10001983
613 Ga0207712_10000021
614 Ga0207712_10000059
615 Ga0207712_10000222
616 Ga0207712_10000531
617 Ga0207712_10045658
618 Ga0207668_10000998
619 Ga0207640_10001422
620 Ga0207640_10003891
621 Ga0207640_10006550
622 Ga0207640_10026358
623 Ga0207658_10000133
624 Ga0207658_10002781
625 Ga0207658_10003918
626 Ga0207703_10000136
627 Ga0207703_10002599
628 Ga0207703_10021961
629 Ga0207639_10001943
630 Ga0207639_10010334
631 Ga0207678_10026157
632 Ga0207678_10030074
633 Ga0207708_10015820
634 Ga0207702_10029191
635 Ga0207702_10042617
636 Ga0207641_10000022
637 Ga0207641_10000037
638 Ga0207641_10000701
639 Ga0207641_10002671
640 Ga0207641_10007346
641 Ga0207641_10017763
642 Ga0207648_10002549
643 Ga0207676_10000056
644 Ga0207676_10000421
645 Ga0207676_10001393
646 Ga0207676_10001652
647 Ga0207676_10008546
648 Ga0207674_10005096
649 Ga0207674_10027958
650 Ga0207674_10069002
651 Ga0207675_100000054
652 Ga0207675_100000088
653 Ga0207675_100001931
654 Ga0207675_100003854
655 Ga0207675_100105076
656 Ga0207698_10000005
657 Ga0207428_10002599
658 Ga0268266_10000054
659 Ga0268266_10000718
660 Ga0268266_10030492
661 Ga0268265_10000044
662 Ga0268265_10000092
663 Ga0268265_10000225
664 Ga0268265_10000604
665 Ga0268265_10001795
666 Ga0268265_10002038
667 Ga0268265_10003512
668 Ga0268265_10013761
669 Ga0268265_10032249
670 Ga0268264_10000074
671 Ga0268264_10000691
672 Ga0268264_10001924
673 Ga0268264_10015505
674 Ga0268264_10024280
675 Ga0307513_10007371
676 Ga0307509_10000114
677 Ga0307408_100077666
678 Ga0307406_10008813
679 Ga0307412_10009939
680 Ga0307412_10015953
681 Ga0307412_10019040
682 Ga0307412_10047846
683 Ga0307416_100054804
684 Ga0307414_10003450
685 Ga0373939_0009600
686 Ga0395905_0001165
687 Ga0451576_0009000
688 Ga0495590_0004389
689 Ga0495653_0003457
690 Ga0495607_0006172
691 Ga0495606_0001774
692 Ga0495630_0010258
693 Ga0495654_0001325
694 Ga0495668_0001488
695 Ga0495649_0000021
696 Ga0496102_0042971
697 Ga0496103_0001982
698 Ga0496103_0010274
699 Ga0496111_0069492
700 Ga0496116_0009846
701 Ga0496117_0004416
702 Ga0496117_0008150
703 Ga0496117_0009486
704 Ga0496117_0010846
705 Ga0496118_0000253
706 Ga0496118_0001477
707 Ga0496118_0003310
708 Ga0496118_0003379
709 Ga0496121_0002580
710 Ga0496122_0009903
711 Ga0496123_0023952
712 Ga0496124_0036331
713 Ga0496125_0000635
714 Ga0496126_0024033
715 Ga0501047_0017479
716 Ga0501223_000047
717 Ga0501223_000482
718 Ga0501224_000017
719 Ga0501224_000091
720 Ga0501233_000215
721 Ga0501233_000339
722 Ga0501225_0000007
723 Ga0501225_0000848
724 Ga0501234_001376
725 Ga0501226_000040
726 Ga0501226_000195
727 nmdc:mga05p37_12511_c1
728 nmdc:mga05p37_129498_c1
729 nmdc:mga05p37_1706_c1
730 nmdc:mga05p37_40605_c1
731 nmdc:mga05p37_43477_c1
732 nmdc:mga05p37_5727_c1
733 nmdc:mga05p37_9107_c2
734 nmdc:mga09592_1177_c1
735 nmdc:mga09592_145_c1
736 nmdc:mga09592_51262_c1
737 nmdc:mga09592_78514_c1
738 nmdc:mga0qj67_2838_c1
739 nmdc:mga0qj67_28835_c1
740 nmdc:mga0qj67_573_c1
741 nmdc:mga06r32_1203_c1
742 nmdc:mga06r32_1326_c1
743 nmdc:mga06r32_40_c1
744 nmdc:mga06r32_4877_c1
745 nmdc:mga06r32_584_c1
746 nmdc:mga06r32_8_c1
747 nmdc:mga08y16_11501_c1
748 nmdc:mga08y16_12605_c1
749 nmdc:mga08y16_148_c1
750 nmdc:mga08y16_154246_c1
751 nmdc:mga08y16_22529_c1
752 nmdc:mga08x19_28677_c1
753 nmdc:mga0a205_19637_c1
754 Ga0500643_000141
755 Ga0500643_000188
756 Ga0500592_000026
757 Ga0500592_000073
758 Ga0500592_000656
759 Ga0500604_0004710
760 Ga0500604_0005063
761 Ga0500622_0000294
762 Ga0500622_0004082
763 Ga0500627_0000377
764 Ga0500627_0001231
765 Ga0500611_001418
766 2919710107

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01011

PQQ

PQQ enzyme repeat

446

477

0.89

PF13360

PQQ_2

PQQ-like domain

213

397

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
7tt4-assembly1.cif.gz_B bamabcde bound to substrate espp class 6 0.8054 176 781
6y7o-assembly3.cif.gz_C the complex between the eight-bladed symmetrical designer protein tako8 and the silicotungstic acid keggin (sta) 0.7905 213 485
7tt4-assembly1.cif.gz_B bamabcde bound to substrate espp class 6 0.7861 176 781
2yms-assembly1.cif.gz_A structure and assembly of a b-propeller with nine blades and a new conserved repetitive sequence motif 0.7859 214 359
7tt1-assembly1.cif.gz_B bamabcde bound to substrate espp class 4 0.778 190 781
ID Description Score Start End Superfamily
af_P15877_153_794_2.140.10.10 Mainly Beta;8 Propeller;Methanol Dehydrogenase; Chain A;Quinoprotein alcohol dehydrogenase-like superfamily 0.9065 146 785 2.140.10.10
af_P15877_153_794_2.140.10.10 Mainly Beta;8 Propeller;Methanol Dehydrogenase; Chain A;Quinoprotein alcohol dehydrogenase-like superfamily 0.9024 146 785 2.140.10.10
af_Q60259_9_76_2.40.10.480 Mainly Beta;Beta Barrel;Thrombin, subunit H; 0.8298 218 302 2.40.10.480
af_Q4L235_966_1098_2.40.128.630 Mainly Beta;Beta Barrel;Lipocalin; 0.8295 190 350 2.40.128.630
af_Q55E07_784_923_2.40.128.630 Mainly Beta;Beta Barrel;Lipocalin; 0.801 280 479 2.40.128.630
ID Description Score Start End GO Terms
AF-A0A6L4A549-F1-model_v4 deleted 0.9874 675 785
AF-A0A4Q3XIB7-F1-model_v4 Membrane-bound PQQ-dependent dehydrogenase, glucose/quinate/shikimate family 0.9866 650 786
AF-A0A2L0STJ1-F1-model_v4 deleted 0.9835 648 786
AF-A0A4U9HK64-F1-model_v4 Quinoprotein glucose dehydrogenase (EC 1.1.5.2) 0.9829 377 479 GO:0008876
GO:0030288
AF-A0A6L4A549-F1-model_v4 deleted 0.9698 675 785

Map