F429442

General Info

Members Datasets Scaffolds Average Seq Length
382 264 764 359

Family's Representative Sequence

Representative Sequence 3300053731|Ga0500609_005221|Ga0500609_005221_14_1297
Length 427
Sequence LAAEITVAGTSAASARAAVKPIAMGLMGYVSWGKFLAADLRPACIEGQDVVRRGRNHDDGRDRRTQMRDGIEEDAPQPAEKTHRPRLVYPFETAPETGSGQAVEVAPGVLWLRQPLGGSLGFINVWAIADGEGWAVVDTGLQTRETSQAWRAAFAGALGGRPVTRVIVTHLHPDHVGLAGWIARKFDVRLWMTRLEYFQCRMLVADTGREAPEDGVRFFRAAGWDEEAIENYKARFGGFGKMIYQLPDSYRRMSDGEVFRIGDHDWRVVTGQGHSPDHACLWCEALGVLISGDQVLPRISSNVSVFPTEPDADPLSDWLTSLAKVKAVVPDTVLVLPAHNDPFRGLHARIDGLISGHERGLGRLAGKLAEPKRAVDVFGALFARPIGPDLLGMATGEALAHLNCLIGRGLATREADADGVNWYRAAD

Samples

Sample ID Description Type Environment
1 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
2 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
5 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
6 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
7 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
8 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
9 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
10 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
37 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
38 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
43 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
44 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
45 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
47 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
48 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
51 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
52 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
53 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
54 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
55 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
56 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
57 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
58 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
59 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
60 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
61 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
62 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
63 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
64 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
65 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
66 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
68 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
69 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
70 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
72 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
111 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
114 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
115 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
116 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
117 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
118 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
119 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
120 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
121 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
122 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
123 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
124 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
125 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
126 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
127 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
128 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
129 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
130 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
131 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
132 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
133 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
134 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
135 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
136 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
137 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
138 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
139 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
140 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
141 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
142 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
143 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
144 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
145 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
146 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
147 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
148 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
149 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
150 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
151 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
152 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
153 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
154 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
155 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
156 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
157 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
158 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
159 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
160 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
161 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
162 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
163 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
164 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
165 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
166 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
167 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
168 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
169 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
170 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
171 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
172 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
173 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
174 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
175 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
176 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
177 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
178 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
179 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
180 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
181 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
182 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
183 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
184 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
185 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
186 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
187 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
188 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
189 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
190 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
191 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
192 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
193 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
194 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
195 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
196 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
203 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
204 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
207 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
208 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
209 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
210 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
211 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
212 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
213 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
214 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
215 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
216 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
217 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
218 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
219 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
220 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
221 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
222 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
223 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
224 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
225 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
226 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
227 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
228 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
229 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
230 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
231 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
232 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
233 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
234 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
235 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
236 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
237 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
238 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
239 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
240 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
241 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
242 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
243 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
244 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
245 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
246 2643221583 Caulobacter sp. Root655 Isolate Unclassified
247 2643221584 Caulobacter sp. Root656 Isolate Unclassified
248 2643221640 Caulobacter sp. Root342 Isolate Unclassified
249 2643221642 Caulobacter sp. Root343 Isolate Unclassified
250 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
251 2721755523 Delftia sp. HK171 Isolate Unclassified
252 2791355048 Caulobacter flavus CGMCC1 15093 Isolate Rhizosphere
253 2818991435 Caulobacter henricii 536 Isolate Unclassified
254 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
255 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
256 2843744320 Caulobacter flavus RHGG3 Isolate Unclassified
257 2849560528 Caulobacter zeae 410 Isolate Unclassified
258 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
259 2851153111 Caulobacter radicis 736 Isolate Unclassified
260 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
261 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
262 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
263 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere
264 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.67
Metatranscriptomes 0
Isolates 7.33

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 19.63
Nodule 0.26
Rhizoplane 1.83
Rhizosphere 68.59
Stem 0
Stem Tuber 0
Unclassified 0.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500609_005221 3300053731 Bacteria 1775
2 JGI25151J46595_10027206 3300003187 Bacteria 2297
3 rootH1_10075064 3300003316 Bacteria 3407
4 Ga0055537_1001821 3300003773 Bacteria 7720
5 Ga0055536_1005879 3300003781 Bacteria 5883
6 Ga0055536_1007387 3300003781 Bacteria 4930
7 Ga0055528_1011312 3300003790 Bacteria 3556
8 Ga0055530_10001961 3300003791 Bacteria 14011
9 Ga0055530_10006896 3300003791 Bacteria 4922
10 Ga0055530_10009055 3300003791 Bacteria 3878
11 Ga0055531_10000294 3300003794 Bacteria 49839
12 Ga0055531_10002505 3300003794 Bacteria 12241
13 Ga0055531_10005505 3300003794 Bacteria 7401
14 Ga0065165_1001609 3300005262 Bacteria 23073
15 Ga0065715_10108713 3300005293 Bacteria 2704
16 Ga0070676_10008515 3300005328 Bacteria 5528
17 Ga0070676_10187176 3300005328 Bacteria 1349
18 Ga0070670_100191092 3300005331 Bacteria 1778
19 Ga0070666_10012824 3300005335 Bacteria 5299
20 Ga0070666_10115763 3300005335 Bacteria 1856
21 Ga0070668_100002149 3300005347 Bacteria 14431
22 Ga0070668_100103209 3300005347 Bacteria 2262
23 Ga0070669_100009764 3300005353 Bacteria 6835
24 Ga0070669_100288148 3300005353 Bacteria 1317
25 Ga0070675_100023636 3300005354 Bacteria 4917
26 Ga0070675_100190335 3300005354 Bacteria 1777
27 Ga0070671_100187427 3300005355 Bacteria 1753
28 Ga0070674_100019926 3300005356 Bacteria 4273
29 Ga0070674_100239649 3300005356 Bacteria 1419
30 Ga0070673_100016502 3300005364 Bacteria 5224
31 Ga0070673_100040895 3300005364 Bacteria 3560
32 Ga0070673_100381012 3300005364 Bacteria 1257
33 Ga0070659_100000638 3300005366 Bacteria 25690
34 Ga0070667_100012934 3300005367 Bacteria 6899
35 Ga0070667_100034758 3300005367 Bacteria 4219
36 Ga0070667_100329053 3300005367 Bacteria 1380
37 Ga0070709_10002785 3300005434 Bacteria 9446
38 Ga0070709_10003111 3300005434 Bacteria 8901
39 Ga0070714_100003242 3300005435 Bacteria 12104
40 Ga0070713_100112526 3300005436 Bacteria 2375
41 Ga0070678_100064601 3300005456 Bacteria 2713
42 Ga0070681_10004566 3300005458 Bacteria 13210
43 Ga0068867_100012086 3300005459 Bacteria 6097
44 Ga0068867_100173063 3300005459 Bacteria 1711
45 Ga0070707_100240338 3300005468 Bacteria 1763
46 Ga0070699_100035004 3300005518 Bacteria 4340
47 Ga0070684_100118385 3300005535 Bacteria 2381
48 Ga0068853_100068942 3300005539 Bacteria 3076
49 Ga0070672_100017237 3300005543 Bacteria 5193
50 Ga0068856_100127141 3300005614 Bacteria 2552
51 Ga0068852_100045437 3300005616 Bacteria 3735
52 Ga0068864_100000184 3300005618 Bacteria 57553
53 Ga0068864_100401002 3300005618 Bacteria 1303
54 Ga0068866_10080270 3300005718 Bacteria 1750
55 Ga0068851_10076438 3300005834 Bacteria 1741
56 Ga0068870_10042252 3300005840 Bacteria 2373
57 Ga0068863_100000037 3300005841 Bacteria 162638
58 Ga0068863_100023501 3300005841 Bacteria 5885
59 Ga0068858_100000029 3300005842 Bacteria 144691
60 Ga0068858_100027599 3300005842 Bacteria 5273
61 Ga0068858_100097588 3300005842 Bacteria 2739
62 Ga0068858_100158975 3300005842 Bacteria 2127
63 Ga0068860_100011673 3300005843 Bacteria 8661
64 Ga0068860_100042768 3300005843 Bacteria 4324
65 Ga0068860_100075343 3300005843 Bacteria 3209
66 Ga0081455_10002231 3300005937 Bacteria 23076
67 Ga0081455_10121519 3300005937 Unclassified 2057
68 Ga0070716_100084550 3300006173 Bacteria 1903
69 Ga0070716_100154221 3300006173 Bacteria 1481
70 Ga0075369_10002599 3300006186 Bacteria 6466
71 Ga0097621_100096339 3300006237 Bacteria 2483
72 Ga0068871_100055933 3300006358 Bacteria 3205
73 Ga0068871_100132250 3300006358 Bacteria 2116
74 Ga0068871_100321308 3300006358 Bacteria 1363
75 Ga0068865_100242505 3300006881 Bacteria 1419
76 Ga0105250_10001003 3300009092 Bacteria 16365
77 Ga0105240_10021033 3300009093 Bacteria 8684
78 Ga0105240_10034146 3300009093 Bacteria 6564
79 Ga0105243_10019292 3300009148 Bacteria 5168
80 Ga0105243_10052661 3300009148 Bacteria 3225
81 Ga0105243_10136108 3300009148 Bacteria 2090
82 Ga0105248_10002503 3300009177 Bacteria 20441
83 Ga0105248_10005277 3300009177 Bacteria 14221
84 Ga0105248_10049402 3300009177 Bacteria 4718
85 Ga0105248_10126437 3300009177 Bacteria 2883
86 Ga0105237_10180967 3300009545 Bacteria 2108
87 Ga0105238_10009338 3300009551 Bacteria 9821
88 Ga0105249_10035233 3300009553 Bacteria 4538
89 Ga0105239_10171076 3300010375 Bacteria 2429
90 Ga0157373_10004960 3300013100 Bacteria 10004
91 Ga0157373_10004981 3300013100 Bacteria 9981
92 Ga0157378_10070409 3300013297 Bacteria 3140
93 Ga0157378_10172341 3300013297 Bacteria 2030
94 Ga0163162_10201380 3300013306 Bacteria 2120
95 Ga0157375_10004025 3300013308 Bacteria 12753
96 Ga0157375_10010602 3300013308 Bacteria 8116
97 Ga0157375_10167124 3300013308 Bacteria 2345
98 Ga0157380_10206889 3300014326 Bacteria 1745
99 Ga0157379_10028902 3300014968 Bacteria 4931
100 Ga0163161_10015829 3300017792 Bacteria 5259
101 Ga0163161_10052907 3300017792 Bacteria 2943
102 Ga0209565_1002312 3300025263 Bacteria 6979
103 Ga0209673_1000956 3300025273 Bacteria 36077
104 Ga0209675_1026948 3300025291 Bacteria 1421
105 Ga0209676_1000295 3300025292 Bacteria 100711
106 Ga0209676_1000392 3300025292 Bacteria 79950
107 Ga0209025_1000034 3300025294 Bacteria 413205
108 Ga0209564_1005502 3300025295 Bacteria 7191
109 Ga0209564_1022862 3300025295 Bacteria 2192
110 Ga0209564_1030824 3300025295 Bacteria 1654
111 Ga0209758_1002021 3300025297 Bacteria 21830
112 Ga0209758_1002093 3300025297 Bacteria 21212
113 Ga0209758_1002321 3300025297 Bacteria 19671
114 Ga0209050_1000169 3300025298 Bacteria 151269
115 Ga0209050_1000362 3300025298 Bacteria 87030
116 Ga0209050_1000411 3300025298 Bacteria 79805
117 Ga0209050_1016622 3300025298 Bacteria 2995
118 Ga0209256_1001797 3300025299 Bacteria 20230
119 Ga0209256_1009424 3300025299 Bacteria 4285
120 Ga0209256_1016604 3300025299 Bacteria 2498
121 Ga0209051_1008972 3300025303 Bacteria 5213
122 Ga0209051_1035296 3300025303 Bacteria 1862
123 Ga0209257_1000186 3300025304 Bacteria 154365
124 Ga0209257_1000287 3300025304 Bacteria 111624
125 Ga0209257_1000513 3300025304 Bacteria 67348
126 Ga0209257_1015911 3300025304 Bacteria 3085
127 Ga0207697_10014173 3300025315 Bacteria 3313
128 Ga0207656_10080591 3300025321 Bacteria 1462
129 Ga0207696_1005987 3300025711 Bacteria 4964
130 Ga0207682_10072516 3300025893 Bacteria 1461
131 Ga0207680_10001591 3300025903 Bacteria 10719
132 Ga0207645_10002590 3300025907 Bacteria 14103
133 Ga0207645_10028015 3300025907 Bacteria 3637
134 Ga0207643_10037434 3300025908 Bacteria 2723
135 Ga0207654_10161529 3300025911 Bacteria 1448
136 Ga0207707_10019424 3300025912 Bacteria 5932
137 Ga0207695_10028714 3300025913 Bacteria 6158
138 Ga0207695_10063631 3300025913 Bacteria 3802
139 Ga0207671_10012792 3300025914 Bacteria 6726
140 Ga0207693_10027934 3300025915 Bacteria 4460
141 Ga0207662_10029791 3300025918 Bacteria 3164
142 Ga0207681_10013224 3300025923 Bacteria 5103
143 Ga0207681_10042779 3300025923 Bacteria 3028
144 Ga0207650_10032504 3300025925 Bacteria 3773
145 Ga0207659_10201990 3300025926 Bacteria 1588
146 Ga0207644_10070576 3300025931 Bacteria 2554
147 Ga0207644_10187067 3300025931 Bacteria 1626
148 Ga0207690_10007625 3300025932 Bacteria 6419
149 Ga0207706_10022610 3300025933 Bacteria 5644
150 Ga0207709_10000117 3300025935 Bacteria 122667
151 Ga0207704_10182434 3300025938 Bacteria 1518
152 Ga0207665_10036405 3300025939 Bacteria 3273
153 Ga0207665_10211383 3300025939 Bacteria 1417
154 Ga0207691_10004132 3300025940 Bacteria 14107
155 Ga0207691_10188173 3300025940 Bacteria 1802
156 Ga0207711_10002385 3300025941 Bacteria 16806
157 Ga0207711_10013130 3300025941 Bacteria 6878
158 Ga0207711_10037700 3300025941 Bacteria 4108
159 Ga0207651_10045966 3300025960 Bacteria 2932
160 Ga0207651_10255657 3300025960 Bacteria 1435
161 Ga0207668_10007666 3300025972 Bacteria 6423
162 Ga0207668_10141927 3300025972 Bacteria 1848
163 Ga0207658_10032907 3300025986 Bacteria 3694
164 Ga0207677_10312993 3300026023 Bacteria 1302
165 Ga0207703_10001132 3300026035 Bacteria 25162
166 Ga0207703_10018046 3300026035 Bacteria 5511
167 Ga0207703_10157761 3300026035 Bacteria 1985
168 Ga0207639_10004978 3300026041 Bacteria 8950
169 Ga0207639_10063341 3300026041 Bacteria 2863
170 Ga0207641_10000034 3300026088 Bacteria 217752
171 Ga0207641_10020039 3300026088 Bacteria 5491
172 Ga0207641_10310064 3300026088 Bacteria 1493
173 Ga0207648_10030350 3300026089 Bacteria 4788
174 Ga0207648_10111242 3300026089 Bacteria 2405
175 Ga0207676_10000202 3300026095 Bacteria 51825
176 Ga0207675_100013729 3300026118 Bacteria 7556
177 Ga0207683_10010678 3300026121 Bacteria 7827
178 Ga0207683_10206081 3300026121 Bacteria 1788
179 Ga0207698_10010643 3300026142 Bacteria 5928
180 Ga0209281_1000017 3300027111 Bacteria 583251
181 Ga0268266_10007591 3300028379 Bacteria 9765
182 Ga0268264_10003268 3300028381 Bacteria 14016
183 Ga0268264_10040007 3300028381 Bacteria 3873
184 Ga0307515_10001984 3300028794 Bacteria 45309
185 Ga0307515_10028766 3300028794 Bacteria 9428
186 Ga0307515_10034147 3300028794 Bacteria 8342
187 Ga0307515_10279923 3300028794 Bacteria 1376
188 Ga0265338_10030764 3300028800 Bacteria 5278
189 Ga0265327_10038876 3300031251 Bacteria 2591
190 Ga0307513_10022399 3300031456 Bacteria 7428
191 Ga0316576_10129068 3300031727 Bacteria 1901
192 Ga0307406_10308345 3300031901 Bacteria 1219
193 Ga0373962_0020719 3300035242 Bacteria 1728
194 Ga0373931_0024727 3300035691 Bacteria 3045
195 Ga0373931_0026463 3300035691 Bacteria 2952
196 Ga0373933_0075224 3300035724 Bacteria 2062
197 Ga0395905_0063944 3300037471 Bacteria 3443
198 Ga0395905_0168322 3300037471 Bacteria 2059
199 Ga0436364_1483951 3300037853 Bacteria 2108
200 Ga0436365_0552749 3300039437 Bacteria 4014
201 Ga0436360_0178850 3300039438 Bacteria 3300
202 Ga0436360_1269109 3300039438 Bacteria 6797
203 Ga0436361_0494642 3300039447 Bacteria 4722
204 Ga0436363_0245691 3300039450 Bacteria 19430
205 Ga0436363_0770688 3300039450 Bacteria 2089
206 Ga0439436_0007045 3300041404 Bacteria 3458
207 Ga0439447_003725 3300041407 Bacteria 5374
208 Ga0439466_0002921 3300041411 Bacteria 6681
209 Ga0439452_001033 3300042010 Bacteria 12320
210 Ga0439446_0009972 3300042156 Bacteria 2550
211 Ga0439434_0001950 3300042435 Bacteria 5969
212 Ga0451577_0417160 3300042876 Bacteria 1219
213 Ga0495627_000767 3300046453 Bacteria 23863
214 Ga0495629_0014297 3300046459 Bacteria 5712
215 Ga0495629_0023118 3300046459 Bacteria 4430
216 Ga0495629_0047483 3300046459 Bacteria 3012
217 Ga0495638_0000588 3300046460 Bacteria 41034
218 Ga0495638_0000935 3300046460 Bacteria 29593
219 Ga0495638_0001800 3300046460 Bacteria 18662
220 Ga0495638_0009943 3300046460 Bacteria 6632
221 Ga0495638_0018273 3300046460 Bacteria 4659
222 Ga0495638_0069225 3300046460 Bacteria 2163
223 Ga0495653_0000941 3300046463 Bacteria 22423
224 Ga0495650_0000403 3300046471 Bacteria 71792
225 Ga0495580_0004445 3300046472 Bacteria 11782
226 Ga0495607_0074675 3300046501 Bacteria 1881
227 Ga0495583_0000013 3300046506 Bacteria 323372
228 Ga0495606_0003858 3300046507 Bacteria 15477
229 Ga0495606_0090787 3300046507 Bacteria 1879
230 Ga0495610_0001820 3300046512 Bacteria 18544
231 Ga0495610_0007872 3300046512 Bacteria 7003
232 Ga0495616_0000053 3300046513 Bacteria 104389
233 Ga0495616_0023862 3300046513 Bacteria 3287
234 Ga0495628_0025637 3300046516 Bacteria 4816
235 Ga0495630_0001098 3300046517 Bacteria 18589
236 Ga0495631_0001009 3300046518 Bacteria 17474
237 Ga0495632_0034569 3300046519 Bacteria 2585
238 Ga0495637_0011003 3300046520 Bacteria 4358
239 Ga0495643_0053919 3300046522 Bacteria 2154
240 Ga0495648_0000372 3300046524 Bacteria 49423
241 Ga0495648_0061846 3300046524 Bacteria 2221
242 Ga0495652_0037071 3300046529 Bacteria 4233
243 Ga0495654_0000708 3300046530 Bacteria 26141
244 Ga0495654_0028019 3300046530 Bacteria 2883
245 Ga0495665_0000231 3300046531 Bacteria 28113
246 Ga0495586_0157030 3300046535 Bacteria 1282
247 Ga0495597_0024774 3300046542 Bacteria 2767
248 Ga0495645_0055350 3300046543 Bacteria 2880
249 Ga0495622_0001122 3300046557 Bacteria 13993
250 Ga0495668_0000034 3300046616 Bacteria 254171
251 Ga0495668_0007404 3300046616 Bacteria 7022
252 Ga0495668_0025801 3300046616 Bacteria 3337
253 Ga0495668_0055076 3300046616 Bacteria 2196
254 Ga0495668_0093240 3300046616 Bacteria 1649
255 Ga0495634_0125991 3300046642 Bacteria 1637
256 Ga0495625_0003383 3300046660 Bacteria 15983
257 Ga0495625_0003474 3300046660 Bacteria 15651
258 Ga0495625_0007762 3300046660 Bacteria 9263
259 Ga0495625_0012396 3300046660 Bacteria 6908
260 Ga0495625_0163933 3300046660 Bacteria 1487
261 Ga0495659_0014199 3300046664 Bacteria 2605
262 Ga0495623_0003753 3300046679 Bacteria 10017
263 Ga0495646_0111402 3300046680 Bacteria 1558
264 Ga0495658_0001907 3300046683 Bacteria 10644
265 Ga0495624_0009372 3300046690 Bacteria 6782
266 Ga0495589_0020889 3300046794 Bacteria 3347
267 Ga0495660_0004878 3300046810 Bacteria 8080
268 Ga0495604_0032033 3300047317 Bacteria 4168
269 Ga0495674_0155968 3300047319 Bacteria 1912
270 Ga0495672_0000805 3300047320 Bacteria 33720
271 Ga0495672_0001210 3300047320 Bacteria 26025
272 Ga0495680_0001557 3300047322 Bacteria 24541
273 Ga0495675_0191921 3300047444 Bacteria 1246
274 Ga0495679_009102 3300047446 Bacteria 3999
275 Ga0495673_0000025 3300047469 Bacteria 512352
276 Ga0495673_0001279 3300047469 Bacteria 20632
277 Ga0495673_0001381 3300047469 Bacteria 19535
278 Ga0495681_0044712 3300047470 Bacteria 2125
279 Ga0495686_0002973 3300047472 Bacteria 15100
280 Ga0495686_0033906 3300047472 Bacteria 3291
281 Ga0495593_0003087 3300047673 Bacteria 10017
282 Ga0495602_0002823 3300048088 Bacteria 17771
283 Ga0496100_0143155 3300048903 Bacteria 1697
284 Ga0496101_0030144 3300048904 Bacteria 3801
285 Ga0496106_0003982 3300048909 Bacteria 11040
286 Ga0496107_0000063 3300048910 Bacteria 52938
287 Ga0496108_0285725 3300048911 Bacteria 1436
288 Ga0496113_0050552 3300048916 Bacteria 3100
289 Ga0496115_0003942 3300048918 Bacteria 10698
290 Ga0496117_0035425 3300048920 Bacteria 3746
291 Ga0496118_0008005 3300048921 Bacteria 11044
292 Ga0496119_0015272 3300048922 Bacteria 5931
293 Ga0496121_0001066 3300048924 Bacteria 48544
294 Ga0496121_0012160 3300048924 Bacteria 9445
295 Ga0496121_0031296 3300048924 Bacteria 4863
296 Ga0496124_0000605 3300048927 Bacteria 60259
297 Ga0496124_0009385 3300048927 Bacteria 10080
298 Ga0496125_0048767 3300048928 Bacteria 3527
299 Ga0496126_0001325 3300048929 Bacteria 39349
300 Ga0496126_0001478 3300048929 Bacteria 36532
301 Ga0496126_0076150 3300048929 Bacteria 2977
302 Ga0495678_012626 3300049459 Bacteria 3998
303 Ga0501032_0142747 3300049569 Bacteria 1577
304 Ga0501036_0343203 3300049572 Bacteria 1247
305 Ga0501037_0155202 3300049573 Bacteria 1634
306 Ga0501043_0216305 3300049579 Bacteria 1484
307 Ga0501046_0000752 3300049580 Bacteria 31319
308 Ga0501047_0000298 3300049581 Bacteria 57038
309 Ga0501047_0384940 3300049581 Bacteria 1237
310 Ga0501070_0000024 3300049586 Bacteria 159781
311 Ga0501070_0116399 3300049586 Bacteria 2208
312 Ga0501080_0002003 3300049742 Bacteria 17586
313 Ga0501035_0000785 3300049822 Bacteria 34007
314 Ga0501044_0001752 3300049823 Bacteria 25329
315 Ga0501044_0095463 3300049823 Bacteria 2996
316 Ga0501044_0155578 3300049823 Bacteria 2266
317 Ga0501044_0387969 3300049823 Bacteria 1311
318 Ga0501045_0001157 3300049824 Bacteria 17488
319 Ga0500635_0000045 3300053080 Bacteria 87314
320 Ga0500578_0000102 3300053086 Bacteria 99108
321 Ga0500644_0000399 3300053088 Bacteria 20662
322 Ga0500646_0002663 3300053090 Bacteria 4619
323 Ga0500583_0032005 3300053092 Bacteria 2318
324 Ga0500651_0049440 3300053093 Bacteria 2640
325 Ga0500566_0009618 3300053094 Bacteria 5713
326 Ga0500641_0045127 3300053096 Bacteria 1794
327 Ga0500556_0004114 3300053104 Bacteria 4169
328 Ga0500562_005452 3300053108 Bacteria 3194
329 Ga0500569_001069 3300053109 Bacteria 4991
330 Ga0500594_0000123 3300053118 Bacteria 21627
331 Ga0500595_003056 3300053119 Bacteria 7954
332 Ga0500608_000037 3300053122 Bacteria 60499
333 Ga0500608_003033 3300053122 Bacteria 6220
334 Ga0500614_000425 3300053123 Bacteria 11002
335 Ga0500618_000319 3300053125 Bacteria 35375
336 Ga0500642_0029632 3300053130 Bacteria 2270
337 Ga0500559_0000153 3300053136 Bacteria 54641
338 Ga0500559_0001051 3300053136 Bacteria 16839
339 Ga0500559_0007502 3300053136 Bacteria 4824
340 Ga0500559_0030845 3300053136 Bacteria 2299
341 Ga0500564_000173 3300053138 Bacteria 17097
342 Ga0500590_004834 3300053148 Bacteria 6423
343 Ga0500616_0029608 3300053153 Bacteria 3011
344 Ga0500622_0000611 3300053156 Bacteria 32433
345 Ga0500622_0051212 3300053156 Bacteria 2125
346 Ga0500627_0000848 3300053158 Bacteria 8174
347 Ga0500639_081347 3300053163 Bacteria 1631
348 Ga0500636_0007900 3300053177 Bacteria 6153
349 Ga0500636_0019813 3300053177 Unclassified 3978
350 Ga0500637_0025739 3300053178 Bacteria 3236
351 Ga0500576_045888 3300053725 Bacteria 1954
352 Ga0500625_016052 3300053729 Bacteria 3483
353 Ga0500645_001763 3300053730 Bacteria 10485
354 Ga0500596_003285 3300053735 Bacteria 3096
355 2501077310 2501025502 Bacteria 9641094
356 2511086630 2510917013 Bacteria 9951648
357 2511121745 2510917020 Bacteria 5657507
358 2585148966 2582581279 Bacteria 4980720
359 2585151626 2582581280 Bacteria 5994497
360 2585195500 2582581293 Bacteria 5907401
361 2587918901 2585428106 Bacteria 5179711
362 2643749212 2643221545 Bacteria 5083237
363 2643781330 2643221552 Bacteria 5708754
364 2643922910 2643221583 Bacteria 5218014
365 2643927089 2643221584 Bacteria 5511711
366 2644227672 2643221640 Bacteria 5258820
367 2644236810 2643221642 Bacteria 5357871
368 2644509013 2643221691 Bacteria 5093099
369 2722881900 2721755523 Bacteria 6430384
370 2792459152 2791355048 Bacteria 5832535
371 2819536316 2818991435 Bacteria 5433759
372 2819644571 2818991454 Bacteria 5563326
373 2839144848 2839138175 Bacteria 6549354
374 2843744926 2843744320 Bacteria 5659202
375 2849564349 2849560528 Bacteria 5393480
376 2849573861 2849573788 Bacteria 5421256
377 2851154730 2851153111 Bacteria 5542585
378 2857508618 2857504554 Bacteria 5369913
379 2883091312 2883087390 Bacteria 9532701
380 2884961412 2884960567 Bacteria 5437054
381 2898334205 2898329390 Bacteria 5168154
382 2928531656 2928531327 Bacteria 5101314
383 Ga0500609_005221
384 JGI25151J46595_10027206
385 rootH1_10075064
386 Ga0055537_1001821
387 Ga0055536_1005879
388 Ga0055536_1007387
389 Ga0055528_1011312
390 Ga0055530_10001961
391 Ga0055530_10006896
392 Ga0055530_10009055
393 Ga0055531_10000294
394 Ga0055531_10002505
395 Ga0055531_10005505
396 Ga0065165_1001609
397 Ga0065715_10108713
398 Ga0070676_10008515
399 Ga0070676_10187176
400 Ga0070670_100191092
401 Ga0070666_10012824
402 Ga0070666_10115763
403 Ga0070668_100002149
404 Ga0070668_100103209
405 Ga0070669_100009764
406 Ga0070669_100288148
407 Ga0070675_100023636
408 Ga0070675_100190335
409 Ga0070671_100187427
410 Ga0070674_100019926
411 Ga0070674_100239649
412 Ga0070673_100016502
413 Ga0070673_100040895
414 Ga0070673_100381012
415 Ga0070659_100000638
416 Ga0070667_100012934
417 Ga0070667_100034758
418 Ga0070667_100329053
419 Ga0070709_10002785
420 Ga0070709_10003111
421 Ga0070714_100003242
422 Ga0070713_100112526
423 Ga0070678_100064601
424 Ga0070681_10004566
425 Ga0068867_100012086
426 Ga0068867_100173063
427 Ga0070707_100240338
428 Ga0070699_100035004
429 Ga0070684_100118385
430 Ga0068853_100068942
431 Ga0070672_100017237
432 Ga0068856_100127141
433 Ga0068852_100045437
434 Ga0068864_100000184
435 Ga0068864_100401002
436 Ga0068866_10080270
437 Ga0068851_10076438
438 Ga0068870_10042252
439 Ga0068863_100000037
440 Ga0068863_100023501
441 Ga0068858_100000029
442 Ga0068858_100027599
443 Ga0068858_100097588
444 Ga0068858_100158975
445 Ga0068860_100011673
446 Ga0068860_100042768
447 Ga0068860_100075343
448 Ga0081455_10002231
449 Ga0081455_10121519
450 Ga0070716_100084550
451 Ga0070716_100154221
452 Ga0075369_10002599
453 Ga0097621_100096339
454 Ga0068871_100055933
455 Ga0068871_100132250
456 Ga0068871_100321308
457 Ga0068865_100242505
458 Ga0105250_10001003
459 Ga0105240_10021033
460 Ga0105240_10034146
461 Ga0105243_10019292
462 Ga0105243_10052661
463 Ga0105243_10136108
464 Ga0105248_10002503
465 Ga0105248_10005277
466 Ga0105248_10049402
467 Ga0105248_10126437
468 Ga0105237_10180967
469 Ga0105238_10009338
470 Ga0105249_10035233
471 Ga0105239_10171076
472 Ga0157373_10004960
473 Ga0157373_10004981
474 Ga0157378_10070409
475 Ga0157378_10172341
476 Ga0163162_10201380
477 Ga0157375_10004025
478 Ga0157375_10010602
479 Ga0157375_10167124
480 Ga0157380_10206889
481 Ga0157379_10028902
482 Ga0163161_10015829
483 Ga0163161_10052907
484 Ga0209565_1002312
485 Ga0209673_1000956
486 Ga0209675_1026948
487 Ga0209676_1000295
488 Ga0209676_1000392
489 Ga0209025_1000034
490 Ga0209564_1005502
491 Ga0209564_1022862
492 Ga0209564_1030824
493 Ga0209758_1002021
494 Ga0209758_1002093
495 Ga0209758_1002321
496 Ga0209050_1000169
497 Ga0209050_1000362
498 Ga0209050_1000411
499 Ga0209050_1016622
500 Ga0209256_1001797
501 Ga0209256_1009424
502 Ga0209256_1016604
503 Ga0209051_1008972
504 Ga0209051_1035296
505 Ga0209257_1000186
506 Ga0209257_1000287
507 Ga0209257_1000513
508 Ga0209257_1015911
509 Ga0207697_10014173
510 Ga0207656_10080591
511 Ga0207696_1005987
512 Ga0207682_10072516
513 Ga0207680_10001591
514 Ga0207645_10002590
515 Ga0207645_10028015
516 Ga0207643_10037434
517 Ga0207654_10161529
518 Ga0207707_10019424
519 Ga0207695_10028714
520 Ga0207695_10063631
521 Ga0207671_10012792
522 Ga0207693_10027934
523 Ga0207662_10029791
524 Ga0207681_10013224
525 Ga0207681_10042779
526 Ga0207650_10032504
527 Ga0207659_10201990
528 Ga0207644_10070576
529 Ga0207644_10187067
530 Ga0207690_10007625
531 Ga0207706_10022610
532 Ga0207709_10000117
533 Ga0207704_10182434
534 Ga0207665_10036405
535 Ga0207665_10211383
536 Ga0207691_10004132
537 Ga0207691_10188173
538 Ga0207711_10002385
539 Ga0207711_10013130
540 Ga0207711_10037700
541 Ga0207651_10045966
542 Ga0207651_10255657
543 Ga0207668_10007666
544 Ga0207668_10141927
545 Ga0207658_10032907
546 Ga0207677_10312993
547 Ga0207703_10001132
548 Ga0207703_10018046
549 Ga0207703_10157761
550 Ga0207639_10004978
551 Ga0207639_10063341
552 Ga0207641_10000034
553 Ga0207641_10020039
554 Ga0207641_10310064
555 Ga0207648_10030350
556 Ga0207648_10111242
557 Ga0207676_10000202
558 Ga0207675_100013729
559 Ga0207683_10010678
560 Ga0207683_10206081
561 Ga0207698_10010643
562 Ga0209281_1000017
563 Ga0268266_10007591
564 Ga0268264_10003268
565 Ga0268264_10040007
566 Ga0307515_10001984
567 Ga0307515_10028766
568 Ga0307515_10034147
569 Ga0307515_10279923
570 Ga0265338_10030764
571 Ga0265327_10038876
572 Ga0307513_10022399
573 Ga0316576_10129068
574 Ga0307406_10308345
575 Ga0373962_0020719
576 Ga0373931_0024727
577 Ga0373931_0026463
578 Ga0373933_0075224
579 Ga0395905_0063944
580 Ga0395905_0168322
581 Ga0436364_1483951
582 Ga0436365_0552749
583 Ga0436360_0178850
584 Ga0436360_1269109
585 Ga0436361_0494642
586 Ga0436363_0245691
587 Ga0436363_0770688
588 Ga0439436_0007045
589 Ga0439447_003725
590 Ga0439466_0002921
591 Ga0439452_001033
592 Ga0439446_0009972
593 Ga0439434_0001950
594 Ga0451577_0417160
595 Ga0495627_000767
596 Ga0495629_0014297
597 Ga0495629_0023118
598 Ga0495629_0047483
599 Ga0495638_0000588
600 Ga0495638_0000935
601 Ga0495638_0001800
602 Ga0495638_0009943
603 Ga0495638_0018273
604 Ga0495638_0069225
605 Ga0495653_0000941
606 Ga0495650_0000403
607 Ga0495580_0004445
608 Ga0495607_0074675
609 Ga0495583_0000013
610 Ga0495606_0003858
611 Ga0495606_0090787
612 Ga0495610_0001820
613 Ga0495610_0007872
614 Ga0495616_0000053
615 Ga0495616_0023862
616 Ga0495628_0025637
617 Ga0495630_0001098
618 Ga0495631_0001009
619 Ga0495632_0034569
620 Ga0495637_0011003
621 Ga0495643_0053919
622 Ga0495648_0000372
623 Ga0495648_0061846
624 Ga0495652_0037071
625 Ga0495654_0000708
626 Ga0495654_0028019
627 Ga0495665_0000231
628 Ga0495586_0157030
629 Ga0495597_0024774
630 Ga0495645_0055350
631 Ga0495622_0001122
632 Ga0495668_0000034
633 Ga0495668_0007404
634 Ga0495668_0025801
635 Ga0495668_0055076
636 Ga0495668_0093240
637 Ga0495634_0125991
638 Ga0495625_0003383
639 Ga0495625_0003474
640 Ga0495625_0007762
641 Ga0495625_0012396
642 Ga0495625_0163933
643 Ga0495659_0014199
644 Ga0495623_0003753
645 Ga0495646_0111402
646 Ga0495658_0001907
647 Ga0495624_0009372
648 Ga0495589_0020889
649 Ga0495660_0004878
650 Ga0495604_0032033
651 Ga0495674_0155968
652 Ga0495672_0000805
653 Ga0495672_0001210
654 Ga0495680_0001557
655 Ga0495675_0191921
656 Ga0495679_009102
657 Ga0495673_0000025
658 Ga0495673_0001279
659 Ga0495673_0001381
660 Ga0495681_0044712
661 Ga0495686_0002973
662 Ga0495686_0033906
663 Ga0495593_0003087
664 Ga0495602_0002823
665 Ga0496100_0143155
666 Ga0496101_0030144
667 Ga0496106_0003982
668 Ga0496107_0000063
669 Ga0496108_0285725
670 Ga0496113_0050552
671 Ga0496115_0003942
672 Ga0496117_0035425
673 Ga0496118_0008005
674 Ga0496119_0015272
675 Ga0496121_0001066
676 Ga0496121_0012160
677 Ga0496121_0031296
678 Ga0496124_0000605
679 Ga0496124_0009385
680 Ga0496125_0048767
681 Ga0496126_0001325
682 Ga0496126_0001478
683 Ga0496126_0076150
684 Ga0495678_012626
685 Ga0501032_0142747
686 Ga0501036_0343203
687 Ga0501037_0155202
688 Ga0501043_0216305
689 Ga0501046_0000752
690 Ga0501047_0000298
691 Ga0501047_0384940
692 Ga0501070_0000024
693 Ga0501070_0116399
694 Ga0501080_0002003
695 Ga0501035_0000785
696 Ga0501044_0001752
697 Ga0501044_0095463
698 Ga0501044_0155578
699 Ga0501044_0387969
700 Ga0501045_0001157
701 Ga0500635_0000045
702 Ga0500578_0000102
703 Ga0500644_0000399
704 Ga0500646_0002663
705 Ga0500583_0032005
706 Ga0500651_0049440
707 Ga0500566_0009618
708 Ga0500641_0045127
709 Ga0500556_0004114
710 Ga0500562_005452
711 Ga0500569_001069
712 Ga0500594_0000123
713 Ga0500595_003056
714 Ga0500608_000037
715 Ga0500608_003033
716 Ga0500614_000425
717 Ga0500618_000319
718 Ga0500642_0029632
719 Ga0500559_0000153
720 Ga0500559_0001051
721 Ga0500559_0007502
722 Ga0500559_0030845
723 Ga0500564_000173
724 Ga0500590_004834
725 Ga0500616_0029608
726 Ga0500622_0000611
727 Ga0500622_0051212
728 Ga0500627_0000848
729 Ga0500639_081347
730 Ga0500636_0007900
731 Ga0500636_0019813
732 Ga0500637_0025739
733 Ga0500576_045888
734 Ga0500625_016052
735 Ga0500645_001763
736 Ga0500596_003285
737 2501077310
738 2511086630
739 2511121745
740 2585148966
741 2585151626
742 2585195500
743 2587918901
744 2643749212
745 2643781330
746 2643922910
747 2643927089
748 2644227672
749 2644236810
750 2644509013
751 2722881900
752 2792459152
753 2819536316
754 2819644571
755 2839144848
756 2843744926
757 2849564349
758 2849573861
759 2851154730
760 2857508618
761 2883091312
762 2884961412
763 2898334205
764 2928531656

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF21221

B_lactamase-like_C

Metallo-beta-lactamase-like, C-terminal domain

367

411

0.94

PF00753

Lactamase_B

Metallo-beta-lactamase superfamily

118

339

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
5u8o-assembly1.cif.gz_B crystal structure of beta-lactamase domain protein, from burkholderia multivorans 0.939 15 356
6ao1-assembly2.cif.gz_B crystal structure of a beta-lactamase from burkholderia phymatum 0.9323 15 354
6ao1-assembly4.cif.gz_D crystal structure of a beta-lactamase from burkholderia phymatum 0.9287 15 354
5u8o-assembly2.cif.gz_C crystal structure of beta-lactamase domain protein, from burkholderia multivorans 0.9287 14 355
5i0p-assembly1.cif.gz_A crystal structure of a beta-lactamase domain protein from burkholderia ambifaria 0.9285 15 355
ID Description Score Start End Superfamily
2zo4A01 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8792 30 292 3.60.15.10
2zo4A01 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8726 30 292 3.60.15.10
af_Q9VKV4_199_284_2.20.70.10 Mainly Beta;Single Sheet;Ubiquitin Ligase Nedd4; Chain: W;; 0.8083 318 356 2.20.70.10
af_I6XHY3_12_197_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8001 24 268 3.60.15.10
3e6mE00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.7974 285 358 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A6P2S3D3-F1-model_v4 Metallo-beta-lactamase superfamily protein 0.9799 15 354
AF-A0A0V8SZP0-F1-model_v4 deleted 0.9794 241 355
AF-A0A3N5F6K1-F1-model_v4 MBL fold metallo-hydrolase 0.9788 6 354 GO:0016787
AF-A0A352S7C1-F1-model_v4 MBL fold metallo-hydrolase 0.9788 95 355 GO:0016787
AF-A0A0S8DT54-F1-model_v4 MBL fold metallo-hydrolase 0.9787 14 355 GO:0016787

Map