F429431

General Info

Members Datasets Scaffolds Average Seq Length
382 183 764 154

Family's Representative Sequence

Representative Sequence 3300049822|Ga0501035_0968550|Ga0501035_0968550_173_631
Length 152
Sequence VLQISYADYEALRAHGEETYPHECCGVLLGKSVDGSGNRVQQLVRAGNTRTDSAHNRYNIAPQELVKIQRQARGLGLDIVGFYHSHPDHPAQWSPTDFAEAHWLGCSYIITSVDNGKAALTNSFLLTGTTEEDKKFEDEAIEIEIAEAQASK

Samples

Sample ID Description Type Environment
1 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
2 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
18 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
32 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
33 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
34 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
36 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
37 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
38 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
39 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
40 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
41 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
42 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
43 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
44 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
45 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
46 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
47 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
48 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
49 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
50 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
51 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
52 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
53 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
54 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
55 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
56 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
57 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
58 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
59 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
60 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
61 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
62 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
63 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
93 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
94 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
95 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
96 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
97 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
98 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
99 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
100 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
101 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
102 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
103 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
104 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
105 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
106 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
107 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
108 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
109 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
110 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
111 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
112 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
113 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
114 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
115 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
116 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
117 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
118 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
119 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
120 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
121 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
122 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
123 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
124 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
125 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
126 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
127 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
128 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
129 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
130 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
131 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
132 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
133 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
134 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
135 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
136 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
137 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
138 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
139 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
140 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
141 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
142 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
143 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
144 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
145 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
146 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
147 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
148 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
149 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
150 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
151 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
152 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
153 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
154 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
155 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
156 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
168 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
169 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
170 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
171 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
172 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
173 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
174 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
175 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
176 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
178 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
179 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
180 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
181 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
182 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
183 2884215851 Edaphobacter sp. 12200R-103 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.86
Metatranscriptomes 2.88
Isolates 0.26

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.31
Nodule 0
Rhizoplane 2.36
Rhizosphere 94.24
Stem 0
Stem Tuber 0
Unclassified 3.93

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501035_0968550 3300049822 Bacteria 670
2 LJNas_1000290 3300000546 Bacteria 8770
3 Ga0070658_10000048 3300005327 Bacteria 122132
4 Ga0070658_10000739 3300005327 Bacteria 27999
5 Ga0070658_10086827 3300005327 Bacteria 2574
6 Ga0070658_10144229 3300005327 Bacteria 1990
7 Ga0070658_10954958 3300005327 Bacteria 745
8 Ga0070658_11144274 3300005327 Bacteria 677
9 Ga0070683_100112053 3300005329 Bacteria 2574
10 Ga0070666_11096399 3300005335 Bacteria 592
11 Ga0070680_100089004 3300005336 Bacteria 2554
12 Ga0070680_101014670 3300005336 Bacteria 717
13 Ga0070680_101775923 3300005336 Bacteria 534
14 Ga0068868_101316687 3300005338 Bacteria 671
15 Ga0070660_100003188 3300005339 Bacteria 11274
16 Ga0070660_100050755 3300005339 Bacteria 3192
17 Ga0070660_100095187 3300005339 Bacteria 2354
18 Ga0070660_100293556 3300005339 Bacteria 1332
19 Ga0070660_100308539 3300005339 Bacteria 1298
20 Ga0070660_100467866 3300005339 Bacteria 1047
21 Ga0070661_100007768 3300005344 Bacteria 7399
22 Ga0070661_100052788 3300005344 Bacteria 2975
23 Ga0070671_100219760 3300005355 Bacteria 1612
24 Ga0070659_100006571 3300005366 Bacteria 8395
25 Ga0070659_100020412 3300005366 Bacteria 5031
26 Ga0070659_100170901 3300005366 Bacteria 1780
27 Ga0070659_100241117 3300005366 Bacteria 1496
28 Ga0070659_100531209 3300005366 Bacteria 1005
29 Ga0070714_100076384 3300005435 Bacteria 2908
30 Ga0070714_100325247 3300005435 Bacteria 1439
31 Ga0070714_101223541 3300005435 Bacteria 733
32 Ga0070714_102049671 3300005435 Bacteria 558
33 Ga0070713_100777672 3300005436 Bacteria 917
34 Ga0070711_101865896 3300005439 Bacteria 528
35 Ga0070663_100041149 3300005455 Bacteria 3239
36 Ga0070663_100119407 3300005455 Bacteria 1990
37 Ga0070663_100393813 3300005455 Bacteria 1131
38 Ga0070663_101051958 3300005455 Bacteria 710
39 Ga0070663_101815982 3300005455 Bacteria 547
40 Ga0070681_10059820 3300005458 Bacteria 3789
41 Ga0070681_10210693 3300005458 Bacteria 1859
42 Ga0070681_10420713 3300005458 Bacteria 1248
43 Ga0070681_10686867 3300005458 Bacteria 939
44 Ga0068867_100847951 3300005459 Bacteria 818
45 Ga0070699_101392729 3300005518 Unclassified 643
46 Ga0070679_100001115 3300005530 Bacteria 23419
47 Ga0070679_100250127 3300005530 Bacteria 1729
48 Ga0070679_100279379 3300005530 Bacteria 1623
49 Ga0070684_100149327 3300005535 Bacteria 2116
50 Ga0068853_100000054 3300005539 Bacteria 80837
51 Ga0068853_100027135 3300005539 Bacteria 4812
52 Ga0068853_100079904 3300005539 Bacteria 2860
53 Ga0070696_100576942 3300005546 Bacteria 904
54 Ga0070665_100094029 3300005548 Bacteria 3003
55 Ga0070665_100241731 3300005548 Bacteria 1806
56 Ga0070665_100349705 3300005548 Bacteria 1483
57 Ga0070665_101559721 3300005548 Bacteria 668
58 Ga0068855_100056958 3300005563 Bacteria 4583
59 Ga0068855_100063532 3300005563 Bacteria 4308
60 Ga0068855_100169583 3300005563 Bacteria 2472
61 Ga0068855_100203109 3300005563 Bacteria 2230
62 Ga0068855_100571873 3300005563 Bacteria 1221
63 Ga0070664_100328930 3300005564 Bacteria 1386
64 Ga0070664_101852523 3300005564 Bacteria 572
65 Ga0068857_100074459 3300005577 Bacteria 3025
66 Ga0068857_100102659 3300005577 Bacteria 2567
67 Ga0068854_100000309 3300005578 Bacteria 32186
68 Ga0068854_100095876 3300005578 Bacteria 2215
69 Ga0068854_101917965 3300005578 Bacteria 545
70 Ga0068856_100071567 3300005614 Bacteria 3433
71 Ga0068856_100172065 3300005614 Bacteria 2178
72 Ga0068856_100237739 3300005614 Bacteria 1837
73 Ga0068856_101261043 3300005614 Bacteria 755
74 Ga0068856_101594723 3300005614 Bacteria 666
75 Ga0068852_100022499 3300005616 Bacteria 5056
76 Ga0068852_100065319 3300005616 Bacteria 3174
77 Ga0068864_101029603 3300005618 Bacteria 817
78 Ga0068851_10492180 3300005834 Bacteria 734
79 Ga0081540_1019553 3300005983 Bacteria 4108
80 Ga0070717_10334715 3300006028 Unclassified 1351
81 Ga0097621_100696265 3300006237 Bacteria 935
82 Ga0075436_100004760 3300006914 Bacteria 9317
83 Ga0105240_10014726 3300009093 Bacteria 10668
84 Ga0105240_10134104 3300009093 Bacteria 2966
85 Ga0105240_10226555 3300009093 Bacteria 2175
86 Ga0105240_10298628 3300009093 Bacteria 1843
87 Ga0105240_10298765 3300009093 Bacteria 1843
88 Ga0105240_10328893 3300009093 Bacteria 1740
89 Ga0105240_10688572 3300009093 Bacteria 1117
90 Ga0105243_10030816 3300009148 Bacteria 4132
91 Ga0105248_10384777 3300009177 Bacteria 1580
92 Ga0105237_10032065 3300009545 Bacteria 5321
93 Ga0105237_10085579 3300009545 Bacteria 3142
94 Ga0105237_10342312 3300009545 Bacteria 1500
95 Ga0105237_10433415 3300009545 Unclassified 1320
96 Ga0105238_10020200 3300009551 Bacteria 6780
97 Ga0105238_10093823 3300009551 Bacteria 2989
98 Ga0105238_10366349 3300009551 Bacteria 1431
99 Ga0105238_10392894 3300009551 Bacteria 1379
100 Ga0105238_10527216 3300009551 Bacteria 1184
101 Ga0105238_10531146 3300009551 Bacteria 1180
102 Ga0105249_10027118 3300009553 Bacteria 5168
103 Ga0157373_10079480 3300013100 Bacteria 2313
104 Ga0157371_10094171 3300013102 Bacteria 2122
105 Ga0157371_11176235 3300013102 Bacteria 590
106 Ga0157370_10017416 3300013104 Bacteria 7249
107 Ga0157370_10023139 3300013104 Bacteria 6176
108 Ga0157370_10056338 3300013104 Bacteria 3741
109 Ga0157370_10157463 3300013104 Bacteria 2113
110 Ga0157370_10267255 3300013104 Bacteria 1580
111 Ga0157370_10374941 3300013104 Bacteria 1311
112 Ga0157370_10398822 3300013104 Bacteria 1266
113 Ga0157370_10439460 3300013104 Bacteria 1200
114 Ga0157370_10644137 3300013104 Bacteria 969
115 Ga0157370_10741962 3300013104 Bacteria 895
116 Ga0157369_10039804 3300013105 Bacteria 5136
117 Ga0157369_10055403 3300013105 Bacteria 4280
118 Ga0157369_10071685 3300013105 Bacteria 3718
119 Ga0157369_10188695 3300013105 Bacteria 2167
120 Ga0157369_10317376 3300013105 Bacteria 1620
121 Ga0157369_10360859 3300013105 Bacteria 1509
122 Ga0157369_10370301 3300013105 Bacteria 1487
123 Ga0157369_10534071 3300013105 Bacteria 1213
124 Ga0157374_10147937 3300013296 Bacteria 2282
125 Ga0157374_10242633 3300013296 Bacteria 1772
126 Ga0157374_10251849 3300013296 Bacteria 1738
127 Ga0157374_11311293 3300013296 Bacteria 746
128 Ga0163162_10172373 3300013306 Bacteria 2288
129 Ga0163162_10445584 3300013306 Bacteria 1427
130 Ga0157372_10060742 3300013307 Bacteria 4229
131 Ga0157372_10216510 3300013307 Bacteria 2220
132 Ga0157372_10251256 3300013307 Bacteria 2052
133 Ga0157372_10501141 3300013307 Bacteria 1416
134 Ga0157372_10516074 3300013307 Bacteria 1393
135 Ga0157372_10527997 3300013307 Bacteria 1376
136 Ga0157372_10795720 3300013307 Bacteria 1099
137 Ga0157372_11098643 3300013307 Bacteria 920
138 Ga0157375_10491543 3300013308 Bacteria 1392
139 Ga0157375_11912448 3300013308 Bacteria 704
140 Ga0163163_10162770 3300014325 Bacteria 2277
141 Ga0157377_10982595 3300014745 Unclassified 638
142 Ga0157376_10110824 3300014969 Bacteria 2415
143 Ga0182007_10295425 3300015262 Unclassified 593
144 Ga0206356_10047631 3300020070 Bacteria 2308
145 Ga0206355_1039326 3300020076 Bacteria 950
146 Ga0206355_1558010 3300020076 Bacteria 814
147 Ga0206350_10995694 3300020080 Bacteria 1210
148 Ga0206350_11116707 3300020080 Bacteria 1947
149 Ga0206354_10700057 3300020081 Bacteria 734
150 Ga0154015_1282369 3300020610 Bacteria 821
151 Ga0154015_1366716 3300020610 Bacteria 1999
152 Ga0154015_1631924 3300020610 Bacteria 924
153 Ga0154015_1683514 3300020610 Bacteria 3015
154 Ga0213872_10001914 3300021361 Bacteria 12747
155 Ga0213872_10020974 3300021361 Bacteria 3008
156 Ga0213872_10035840 3300021361 Bacteria 2268
157 Ga0213872_10046782 3300021361 Bacteria 1968
158 Ga0213872_10060945 3300021361 Unclassified 1706
159 Ga0213872_10148427 3300021361 Bacteria 1025
160 Ga0213872_10373511 3300021361 Bacteria 582
161 Ga0213871_10029187 3300021441 Bacteria 1428
162 Ga0213871_10065393 3300021441 Bacteria 1019
163 Ga0224712_10006463 3300022467 Bacteria 3345
164 Ga0209233_1011653 3300025261 Bacteria 2585
165 Ga0207647_10027354 3300025904 Bacteria 3718
166 Ga0207647_10090168 3300025904 Bacteria 1829
167 Ga0207705_10010755 3300025909 Bacteria 6644
168 Ga0207705_10083431 3300025909 Bacteria 2331
169 Ga0207705_10085583 3300025909 Bacteria 2303
170 Ga0207705_10116207 3300025909 Bacteria 1981
171 Ga0207705_10218430 3300025909 Bacteria 1447
172 Ga0207707_10064881 3300025912 Bacteria 3180
173 Ga0207695_10103898 3300025913 Bacteria 2832
174 Ga0207695_10470195 3300025913 Bacteria 1140
175 Ga0207695_10567900 3300025913 Bacteria 1016
176 Ga0207695_11001528 3300025913 Bacteria 715
177 Ga0207671_10754419 3300025914 Bacteria 773
178 Ga0207657_10004332 3300025919 Bacteria 15034
179 Ga0207657_10009712 3300025919 Bacteria 9648
180 Ga0207657_10266078 3300025919 Bacteria 1364
181 Ga0207657_10266546 3300025919 Bacteria 1362
182 Ga0207649_10140920 3300025920 Bacteria 1650
183 Ga0207649_10490087 3300025920 Bacteria 933
184 Ga0207652_10001392 3300025921 Bacteria 21499
185 Ga0207652_10137719 3300025921 Bacteria 2181
186 Ga0207652_10600312 3300025921 Bacteria 987
187 Ga0207652_11050079 3300025921 Bacteria 714
188 Ga0207694_10007796 3300025924 Bacteria 8109
189 Ga0207694_10261349 3300025924 Bacteria 1418
190 Ga0207694_11083024 3300025924 Bacteria 678
191 Ga0207700_10018876 3300025928 Bacteria 4646
192 Ga0207700_10444780 3300025928 Unclassified 1141
193 Ga0207664_10141604 3300025929 Bacteria 2035
194 Ga0207690_10015400 3300025932 Bacteria 4633
195 Ga0207690_10024243 3300025932 Bacteria 3798
196 Ga0207690_10113252 3300025932 Bacteria 1957
197 Ga0207690_10971753 3300025932 Bacteria 706
198 Ga0207709_10054260 3300025935 Bacteria 2470
199 Ga0207711_10328571 3300025941 Bacteria 1414
200 Ga0207661_10066301 3300025944 Bacteria 2933
201 Ga0207661_10142000 3300025944 Bacteria 2067
202 Ga0207679_11732024 3300025945 Bacteria 572
203 Ga0207667_10002527 3300025949 Bacteria 22775
204 Ga0207667_10005759 3300025949 Bacteria 15126
205 Ga0207667_10029399 3300025949 Bacteria 5959
206 Ga0207667_10029994 3300025949 Bacteria 5890
207 Ga0207667_10047243 3300025949 Bacteria 4557
208 Ga0207667_10124027 3300025949 Bacteria 2661
209 Ga0207667_10403751 3300025949 Bacteria 1391
210 Ga0207712_10014161 3300025961 Bacteria 5120
211 Ga0207668_10238531 3300025972 Bacteria 1470
212 Ga0207640_10000023 3300025981 Bacteria 160979
213 Ga0207640_10043007 3300025981 Bacteria 2884
214 Ga0207677_11370286 3300026023 Unclassified 651
215 Ga0207639_10000034 3300026041 Bacteria 154355
216 Ga0207639_10029309 3300026041 Bacteria 4028
217 Ga0207639_10088397 3300026041 Bacteria 2472
218 Ga0207678_10002890 3300026067 Bacteria 15595
219 Ga0207678_10014437 3300026067 Bacteria 6945
220 Ga0207678_10030004 3300026067 Bacteria 4747
221 Ga0207678_10352779 3300026067 Bacteria 1269
222 Ga0207678_10999731 3300026067 Bacteria 740
223 Ga0207702_10037790 3300026078 Bacteria 4042
224 Ga0207702_10392949 3300026078 Bacteria 1336
225 Ga0207702_11178126 3300026078 Bacteria 760
226 Ga0207702_11186251 3300026078 Bacteria 758
227 Ga0207648_11226103 3300026089 Unclassified 705
228 Ga0207676_10569227 3300026095 Bacteria 1085
229 Ga0207674_10020359 3300026116 Bacteria 7167
230 Ga0207674_10209606 3300026116 Bacteria 1898
231 Ga0207698_10021344 3300026142 Bacteria 4476
232 Ga0207698_10088678 3300026142 Bacteria 2523
233 Ga0207698_10131942 3300026142 Bacteria 2136
234 Ga0207698_11277319 3300026142 Bacteria 749
235 Ga0268266_10009107 3300028379 Bacteria 8765
236 Ga0268266_10303092 3300028379 Bacteria 1491
237 Ga0265338_10208622 3300028800 Bacteria 1468
238 Ga0307510_10017195 3300033180 Bacteria 8534
239 Ga0307510_10161433 3300033180 Bacteria 1837
240 Ga0373953_0166119 3300035117 Bacteria 949
241 Ga0373954_0084406 3300035118 Bacteria 1520
242 Ga0373947_0188794 3300035725 Archaea 1344
243 Ga0373937_0012532 3300036401 Bacteria 7459
244 Ga0395900_0232392 3300037418 Bacteria 1854
245 Ga0395898_0035619 3300037466 Bacteria 4947
246 Ga0436360_0211308 3300039438 Bacteria 1183
247 Ga0436360_0685612 3300039438 Bacteria 2788
248 Ga0436360_0758151 3300039438 Bacteria 2445
249 Ga0436360_0866539 3300039438 Bacteria 681
250 Ga0436360_1003989 3300039438 Bacteria 610
251 Ga0436360_1133703 3300039438 Unclassified 1425
252 Ga0436361_0043720 3300039447 Bacteria 516
253 Ga0436361_0105476 3300039447 Bacteria 597
254 Ga0436361_0151607 3300039447 Bacteria 2565
255 Ga0436361_0243478 3300039447 Bacteria 884
256 Ga0436361_0344103 3300039447 Bacteria 1290
257 Ga0436361_0355782 3300039447 Bacteria 1033
258 Ga0436361_0542132 3300039447 Bacteria 888
259 Ga0436361_0654851 3300039447 Bacteria 12254
260 Ga0436361_0692615 3300039447 Bacteria 14640
261 Ga0436361_1139719 3300039447 Unclassified 2425
262 Ga0439448_0012037 3300042005 Bacteria 2583
263 Ga0466966_0027965 3300044684 Bacteria 3675
264 Ga0466966_0605242 3300044684 Unclassified 660
265 Ga0466963_0053616 3300044694 Bacteria 2678
266 Ga0466963_0574709 3300044694 Bacteria 796
267 Ga0466959_0023147 3300045049 Bacteria 4597
268 Ga0466959_0143089 3300045049 Bacteria 1689
269 Ga0451576_0144796 3300045051 Bacteria 2478
270 Ga0466958_0149835 3300045836 Bacteria 1471
271 Ga0466958_0217356 3300045836 Unclassified 1219
272 Ga0466967_0082431 3300045976 Bacteria 2907
273 Ga0466967_0890159 3300045976 Bacteria 885
274 Ga0495617_030890 3300046452 Bacteria 1800
275 Ga0495603_0009648 3300046455 Bacteria 5838
276 Ga0495629_0104643 3300046459 Bacteria 1974
277 Ga0495638_0237166 3300046460 Bacteria 1012
278 Ga0495638_0448800 3300046460 Bacteria 659
279 Ga0495650_0000038 3300046471 Bacteria 377530
280 Ga0495650_0008809 3300046471 Bacteria 5831
281 Ga0495580_0180632 3300046472 Bacteria 1457
282 Ga0495582_0021032 3300046473 Bacteria 3573
283 Ga0495585_0004271 3300046492 Bacteria 9307
284 Ga0495594_0000717 3300046499 Bacteria 17054
285 Ga0495594_0008776 3300046499 Bacteria 5211
286 Ga0495583_0024950 3300046506 Bacteria 2995
287 Ga0495583_0031837 3300046506 Bacteria 2552
288 Ga0495583_0086645 3300046506 Bacteria 1354
289 Ga0495583_0198911 3300046506 Bacteria 815
290 Ga0495628_0576530 3300046516 Unclassified 806
291 Ga0495644_0000021 3300046523 Bacteria 80239
292 Ga0495648_0059831 3300046524 Bacteria 2270
293 Ga0495648_0461837 3300046524 Bacteria 553
294 Ga0495652_0565846 3300046529 Bacteria 779
295 Ga0495645_0138264 3300046543 Bacteria 1702
296 Ga0495622_0008749 3300046557 Bacteria 4691
297 Ga0495633_0231620 3300046558 Bacteria 844
298 Ga0495668_0040115 3300046616 Bacteria 2612
299 Ga0495611_0024131 3300046648 Bacteria 2644
300 Ga0495625_0003043 3300046660 Bacteria 17192
301 Ga0495625_0007483 3300046660 Bacteria 9496
302 Ga0495625_0042062 3300046660 Bacteria 3323
303 Ga0495635_0224919 3300046663 Bacteria 1268
304 Ga0495661_0039497 3300046665 Bacteria 2933
305 Ga0495623_0240673 3300046679 Bacteria 1022
306 Ga0495669_0007986 3300046684 Bacteria 4441
307 Ga0495613_0002777 3300046689 Bacteria 13143
308 Ga0495670_0013416 3300046691 Bacteria 4032
309 Ga0495649_0267081 3300046694 Bacteria 876
310 Ga0495581_0077269 3300047315 Bacteria 1926
311 Ga0495672_0002291 3300047320 Bacteria 17753
312 Ga0495672_0120711 3300047320 Bacteria 1394
313 Ga0495676_0477593 3300047321 Bacteria 820
314 Ga0495685_094341 3300047447 Bacteria 990
315 Ga0495673_0221679 3300047469 Bacteria 699
316 Ga0495681_0143839 3300047470 Bacteria 1005
317 Ga0495684_0540255 3300047471 Bacteria 795
318 Ga0495686_0010830 3300047472 Bacteria 6463
319 Ga0495686_0034806 3300047472 Bacteria 3241
320 Ga0495602_0574934 3300048088 Bacteria 778
321 Ga0495614_0008204 3300048089 Bacteria 4645
322 Ga0496100_0907757 3300048903 Bacteria 692
323 Ga0496103_0188024 3300048906 Bacteria 1328
324 Ga0496104_0072656 3300048907 Bacteria 3271
325 Ga0496104_0330817 3300048907 Bacteria 1437
326 Ga0496105_0345298 3300048908 Bacteria 1189
327 Ga0496108_0245286 3300048911 Bacteria 1558
328 Ga0496108_0827859 3300048911 Bacteria 797
329 Ga0496110_0321340 3300048913 Bacteria 1410
330 Ga0496112_0188436 3300048915 Bacteria 2025
331 Ga0496120_0206326 3300048923 Bacteria 948
332 Ga0496126_0000215 3300048929 Bacteria 127753
333 Ga0496126_0003413 3300048929 Bacteria 20084
334 Ga0496126_0009197 3300048929 Bacteria 10539
335 Ga0496126_0171528 3300048929 Bacteria 1848
336 Ga0496126_0558846 3300048929 Bacteria 907
337 Ga0495682_0034928 3300049460 Bacteria 1853
338 Ga0495682_0055684 3300049460 Bacteria 1434
339 Ga0501031_0023672 3300049568 Bacteria 4003
340 Ga0501032_0020688 3300049569 Bacteria 4580
341 Ga0501032_0188580 3300049569 Bacteria 1348
342 Ga0501032_0389354 3300049569 Bacteria 896
343 Ga0501033_0000858 3300049570 Bacteria 27803
344 Ga0501034_0003472 3300049571 Bacteria 17925
345 Ga0501036_0001180 3300049572 Bacteria 19880
346 Ga0501036_0584158 3300049572 Bacteria 927
347 Ga0501036_1194119 3300049572 Bacteria 620
348 Ga0501037_0048706 3300049573 Bacteria 3103
349 Ga0501038_0000539 3300049574 Bacteria 33243
350 Ga0501038_0114365 3300049574 Bacteria 2232
351 Ga0501039_0063383 3300049575 Bacteria 2864
352 Ga0501043_0002505 3300049579 Bacteria 15532
353 Ga0501043_0202775 3300049579 Bacteria 1539
354 Ga0501046_0000298 3300049580 Bacteria 50044
355 Ga0501047_0000629 3300049581 Bacteria 37204
356 Ga0501047_0115901 3300049581 Bacteria 2561
357 Ga0501067_0261573 3300049583 Bacteria 963
358 Ga0501068_0867223 3300049584 Bacteria 593
359 Ga0501069_0071751 3300049585 Bacteria 1941
360 Ga0501069_0366615 3300049585 Bacteria 850
361 Ga0501070_0117072 3300049586 Bacteria 2201
362 Ga0501070_0175023 3300049586 Bacteria 1767
363 Ga0501072_1162068 3300049588 Bacteria 600
364 Ga0501073_0048432 3300049589 Bacteria 2983
365 Ga0501074_0151922 3300049590 Bacteria 1655
366 Ga0501080_0023938 3300049742 Bacteria 5660
367 Ga0501083_0956611 3300049744 Bacteria 557
368 Ga0501035_0004556 3300049822 Bacteria 13154
369 Ga0501035_0083225 3300049822 Bacteria 2823
370 Ga0501035_0847758 3300049822 Bacteria 727
371 Ga0501035_1417326 3300049822 Unclassified 532
372 Ga0501044_0009866 3300049823 Bacteria 10380
373 Ga0501044_0062542 3300049823 Bacteria 3805
374 Ga0501044_0204180 3300049823 Bacteria 1933
375 Ga0501045_0379998 3300049824 Bacteria 1051
376 nmdc:mga08x19_4480_c1 3300050514 Bacteria 8278
377 Ga0495601_0376499 3300053077 Bacteria 922
378 Ga0500651_0000356 3300053093 Bacteria 25601
379 Ga0500595_000101 3300053119 Bacteria 58785
380 Ga0500595_023613 3300053119 Bacteria 2158
381 Ga0500661_001481 3300055283 Bacteria 4407
382 2884215856 2884215851 Bacteria 4554841
383 Ga0501035_0968550
384 LJNas_1000290
385 Ga0070658_10000048
386 Ga0070658_10000739
387 Ga0070658_10086827
388 Ga0070658_10144229
389 Ga0070658_10954958
390 Ga0070658_11144274
391 Ga0070683_100112053
392 Ga0070666_11096399
393 Ga0070680_100089004
394 Ga0070680_101014670
395 Ga0070680_101775923
396 Ga0068868_101316687
397 Ga0070660_100003188
398 Ga0070660_100050755
399 Ga0070660_100095187
400 Ga0070660_100293556
401 Ga0070660_100308539
402 Ga0070660_100467866
403 Ga0070661_100007768
404 Ga0070661_100052788
405 Ga0070671_100219760
406 Ga0070659_100006571
407 Ga0070659_100020412
408 Ga0070659_100170901
409 Ga0070659_100241117
410 Ga0070659_100531209
411 Ga0070714_100076384
412 Ga0070714_100325247
413 Ga0070714_101223541
414 Ga0070714_102049671
415 Ga0070713_100777672
416 Ga0070711_101865896
417 Ga0070663_100041149
418 Ga0070663_100119407
419 Ga0070663_100393813
420 Ga0070663_101051958
421 Ga0070663_101815982
422 Ga0070681_10059820
423 Ga0070681_10210693
424 Ga0070681_10420713
425 Ga0070681_10686867
426 Ga0068867_100847951
427 Ga0070699_101392729
428 Ga0070679_100001115
429 Ga0070679_100250127
430 Ga0070679_100279379
431 Ga0070684_100149327
432 Ga0068853_100000054
433 Ga0068853_100027135
434 Ga0068853_100079904
435 Ga0070696_100576942
436 Ga0070665_100094029
437 Ga0070665_100241731
438 Ga0070665_100349705
439 Ga0070665_101559721
440 Ga0068855_100056958
441 Ga0068855_100063532
442 Ga0068855_100169583
443 Ga0068855_100203109
444 Ga0068855_100571873
445 Ga0070664_100328930
446 Ga0070664_101852523
447 Ga0068857_100074459
448 Ga0068857_100102659
449 Ga0068854_100000309
450 Ga0068854_100095876
451 Ga0068854_101917965
452 Ga0068856_100071567
453 Ga0068856_100172065
454 Ga0068856_100237739
455 Ga0068856_101261043
456 Ga0068856_101594723
457 Ga0068852_100022499
458 Ga0068852_100065319
459 Ga0068864_101029603
460 Ga0068851_10492180
461 Ga0081540_1019553
462 Ga0070717_10334715
463 Ga0097621_100696265
464 Ga0075436_100004760
465 Ga0105240_10014726
466 Ga0105240_10134104
467 Ga0105240_10226555
468 Ga0105240_10298628
469 Ga0105240_10298765
470 Ga0105240_10328893
471 Ga0105240_10688572
472 Ga0105243_10030816
473 Ga0105248_10384777
474 Ga0105237_10032065
475 Ga0105237_10085579
476 Ga0105237_10342312
477 Ga0105237_10433415
478 Ga0105238_10020200
479 Ga0105238_10093823
480 Ga0105238_10366349
481 Ga0105238_10392894
482 Ga0105238_10527216
483 Ga0105238_10531146
484 Ga0105249_10027118
485 Ga0157373_10079480
486 Ga0157371_10094171
487 Ga0157371_11176235
488 Ga0157370_10017416
489 Ga0157370_10023139
490 Ga0157370_10056338
491 Ga0157370_10157463
492 Ga0157370_10267255
493 Ga0157370_10374941
494 Ga0157370_10398822
495 Ga0157370_10439460
496 Ga0157370_10644137
497 Ga0157370_10741962
498 Ga0157369_10039804
499 Ga0157369_10055403
500 Ga0157369_10071685
501 Ga0157369_10188695
502 Ga0157369_10317376
503 Ga0157369_10360859
504 Ga0157369_10370301
505 Ga0157369_10534071
506 Ga0157374_10147937
507 Ga0157374_10242633
508 Ga0157374_10251849
509 Ga0157374_11311293
510 Ga0163162_10172373
511 Ga0163162_10445584
512 Ga0157372_10060742
513 Ga0157372_10216510
514 Ga0157372_10251256
515 Ga0157372_10501141
516 Ga0157372_10516074
517 Ga0157372_10527997
518 Ga0157372_10795720
519 Ga0157372_11098643
520 Ga0157375_10491543
521 Ga0157375_11912448
522 Ga0163163_10162770
523 Ga0157377_10982595
524 Ga0157376_10110824
525 Ga0182007_10295425
526 Ga0206356_10047631
527 Ga0206355_1039326
528 Ga0206355_1558010
529 Ga0206350_10995694
530 Ga0206350_11116707
531 Ga0206354_10700057
532 Ga0154015_1282369
533 Ga0154015_1366716
534 Ga0154015_1631924
535 Ga0154015_1683514
536 Ga0213872_10001914
537 Ga0213872_10020974
538 Ga0213872_10035840
539 Ga0213872_10046782
540 Ga0213872_10060945
541 Ga0213872_10148427
542 Ga0213872_10373511
543 Ga0213871_10029187
544 Ga0213871_10065393
545 Ga0224712_10006463
546 Ga0209233_1011653
547 Ga0207647_10027354
548 Ga0207647_10090168
549 Ga0207705_10010755
550 Ga0207705_10083431
551 Ga0207705_10085583
552 Ga0207705_10116207
553 Ga0207705_10218430
554 Ga0207707_10064881
555 Ga0207695_10103898
556 Ga0207695_10470195
557 Ga0207695_10567900
558 Ga0207695_11001528
559 Ga0207671_10754419
560 Ga0207657_10004332
561 Ga0207657_10009712
562 Ga0207657_10266078
563 Ga0207657_10266546
564 Ga0207649_10140920
565 Ga0207649_10490087
566 Ga0207652_10001392
567 Ga0207652_10137719
568 Ga0207652_10600312
569 Ga0207652_11050079
570 Ga0207694_10007796
571 Ga0207694_10261349
572 Ga0207694_11083024
573 Ga0207700_10018876
574 Ga0207700_10444780
575 Ga0207664_10141604
576 Ga0207690_10015400
577 Ga0207690_10024243
578 Ga0207690_10113252
579 Ga0207690_10971753
580 Ga0207709_10054260
581 Ga0207711_10328571
582 Ga0207661_10066301
583 Ga0207661_10142000
584 Ga0207679_11732024
585 Ga0207667_10002527
586 Ga0207667_10005759
587 Ga0207667_10029399
588 Ga0207667_10029994
589 Ga0207667_10047243
590 Ga0207667_10124027
591 Ga0207667_10403751
592 Ga0207712_10014161
593 Ga0207668_10238531
594 Ga0207640_10000023
595 Ga0207640_10043007
596 Ga0207677_11370286
597 Ga0207639_10000034
598 Ga0207639_10029309
599 Ga0207639_10088397
600 Ga0207678_10002890
601 Ga0207678_10014437
602 Ga0207678_10030004
603 Ga0207678_10352779
604 Ga0207678_10999731
605 Ga0207702_10037790
606 Ga0207702_10392949
607 Ga0207702_11178126
608 Ga0207702_11186251
609 Ga0207648_11226103
610 Ga0207676_10569227
611 Ga0207674_10020359
612 Ga0207674_10209606
613 Ga0207698_10021344
614 Ga0207698_10088678
615 Ga0207698_10131942
616 Ga0207698_11277319
617 Ga0268266_10009107
618 Ga0268266_10303092
619 Ga0265338_10208622
620 Ga0307510_10017195
621 Ga0307510_10161433
622 Ga0373953_0166119
623 Ga0373954_0084406
624 Ga0373947_0188794
625 Ga0373937_0012532
626 Ga0395900_0232392
627 Ga0395898_0035619
628 Ga0436360_0211308
629 Ga0436360_0685612
630 Ga0436360_0758151
631 Ga0436360_0866539
632 Ga0436360_1003989
633 Ga0436360_1133703
634 Ga0436361_0043720
635 Ga0436361_0105476
636 Ga0436361_0151607
637 Ga0436361_0243478
638 Ga0436361_0344103
639 Ga0436361_0355782
640 Ga0436361_0542132
641 Ga0436361_0654851
642 Ga0436361_0692615
643 Ga0436361_1139719
644 Ga0439448_0012037
645 Ga0466966_0027965
646 Ga0466966_0605242
647 Ga0466963_0053616
648 Ga0466963_0574709
649 Ga0466959_0023147
650 Ga0466959_0143089
651 Ga0451576_0144796
652 Ga0466958_0149835
653 Ga0466958_0217356
654 Ga0466967_0082431
655 Ga0466967_0890159
656 Ga0495617_030890
657 Ga0495603_0009648
658 Ga0495629_0104643
659 Ga0495638_0237166
660 Ga0495638_0448800
661 Ga0495650_0000038
662 Ga0495650_0008809
663 Ga0495580_0180632
664 Ga0495582_0021032
665 Ga0495585_0004271
666 Ga0495594_0000717
667 Ga0495594_0008776
668 Ga0495583_0024950
669 Ga0495583_0031837
670 Ga0495583_0086645
671 Ga0495583_0198911
672 Ga0495628_0576530
673 Ga0495644_0000021
674 Ga0495648_0059831
675 Ga0495648_0461837
676 Ga0495652_0565846
677 Ga0495645_0138264
678 Ga0495622_0008749
679 Ga0495633_0231620
680 Ga0495668_0040115
681 Ga0495611_0024131
682 Ga0495625_0003043
683 Ga0495625_0007483
684 Ga0495625_0042062
685 Ga0495635_0224919
686 Ga0495661_0039497
687 Ga0495623_0240673
688 Ga0495669_0007986
689 Ga0495613_0002777
690 Ga0495670_0013416
691 Ga0495649_0267081
692 Ga0495581_0077269
693 Ga0495672_0002291
694 Ga0495672_0120711
695 Ga0495676_0477593
696 Ga0495685_094341
697 Ga0495673_0221679
698 Ga0495681_0143839
699 Ga0495684_0540255
700 Ga0495686_0010830
701 Ga0495686_0034806
702 Ga0495602_0574934
703 Ga0495614_0008204
704 Ga0496100_0907757
705 Ga0496103_0188024
706 Ga0496104_0072656
707 Ga0496104_0330817
708 Ga0496105_0345298
709 Ga0496108_0245286
710 Ga0496108_0827859
711 Ga0496110_0321340
712 Ga0496112_0188436
713 Ga0496120_0206326
714 Ga0496126_0000215
715 Ga0496126_0003413
716 Ga0496126_0009197
717 Ga0496126_0171528
718 Ga0496126_0558846
719 Ga0495682_0034928
720 Ga0495682_0055684
721 Ga0501031_0023672
722 Ga0501032_0020688
723 Ga0501032_0188580
724 Ga0501032_0389354
725 Ga0501033_0000858
726 Ga0501034_0003472
727 Ga0501036_0001180
728 Ga0501036_0584158
729 Ga0501036_1194119
730 Ga0501037_0048706
731 Ga0501038_0000539
732 Ga0501038_0114365
733 Ga0501039_0063383
734 Ga0501043_0002505
735 Ga0501043_0202775
736 Ga0501046_0000298
737 Ga0501047_0000629
738 Ga0501047_0115901
739 Ga0501067_0261573
740 Ga0501068_0867223
741 Ga0501069_0071751
742 Ga0501069_0366615
743 Ga0501070_0117072
744 Ga0501070_0175023
745 Ga0501072_1162068
746 Ga0501073_0048432
747 Ga0501074_0151922
748 Ga0501080_0023938
749 Ga0501083_0956611
750 Ga0501035_0004556
751 Ga0501035_0083225
752 Ga0501035_0847758
753 Ga0501035_1417326
754 Ga0501044_0009866
755 Ga0501044_0062542
756 Ga0501044_0204180
757 Ga0501045_0379998
758 nmdc:mga08x19_4480_c1
759 Ga0495601_0376499
760 Ga0500651_0000356
761 Ga0500595_000101
762 Ga0500595_023613
763 Ga0500661_001481
764 2884215856

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14464

Prok-JAB

Prokaryotic homologs of the JAB domain

7

126

0.86

PF01398

JAB

JAB1/Mov34/MPN/PAD-1 ubiquitin protease

6

102

0.71

Structural Annotation

Top 5 Hits

ID Description Score Start End
2kks-assembly1.cif.gz_A solution structure of protein dsy2949 from desulfitobacterium hafniense. northeast structural genomics consortium target dhr27 0.8541 16 157
5ld9-assembly1.cif.gz_B structure of deubiquitinating enzyme homolog, pyrococcus furiosus jamm1. 0.8534 15 157
5ld9-assembly1.cif.gz_B structure of deubiquitinating enzyme homolog, pyrococcus furiosus jamm1. 0.8406 15 157
5ld9-assembly1.cif.gz_A structure of deubiquitinating enzyme homolog, pyrococcus furiosus jamm1. 0.826 15 157
5cw4-assembly1.cif.gz_A structure of cfbrcc36-cfkiaa0157 complex (selenium edge) 0.8144 14 157
ID Description Score Start End Superfamily
af_Q55FM0_2_113_3.40.140.10 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.8789 14 99 3.40.140.10
2kksA00 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.8541 16 157 3.40.140.10
af_P9WHS1_10_146_3.40.140.10 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.816 17 155 3.40.140.10
2kksA00 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.7893 16 157 3.40.140.10
af_P9WHS1_10_146_3.40.140.10 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.7835 17 155 3.40.140.10
ID Description Score Start End GO Terms
AF-A0A2V9YEC8-F1-model_v4 JAB domain-containing protein 0.9772 96 157 GO:0006508
GO:0008237
GO:0046872
AF-A0A1Q7CBK1-F1-model_v4 MPN domain-containing protein 0.9491 16 157 GO:0006508
GO:0008235
GO:0008270
AF-A0A5M8SHL5-F1-model_v4 M67 family metallopeptidase 0.9489 15 157 GO:0006508
GO:0008235
GO:0008270
AF-A0A5M8SDD4-F1-model_v4 M67 family metallopeptidase 0.9488 18 157 GO:0006508
GO:0008235
GO:0008270
AF-A0A5M8SDD4-F1-model_v4 M67 family metallopeptidase 0.9422 18 157 GO:0006508
GO:0008235
GO:0008270

Map