F429409

General Info

Members Datasets Scaffolds Average Seq Length
382 280 325 334

Family's Representative Sequence

Representative Sequence 3300048921|Ga0496118_0006093|Ga0496118_0006093_9882_11030
Length 382
Sequence MVIILPGVGAHRLALKAERRSTYTDHCSDYPGRRSETDSVSAAQEKAMSTETMKAVRFHEFGGPQVLRYEDVPKPHLKPGEVLVRVHAVGVNPPDWYLRDGYTTVPNFKPPVTLPVIPGSDVSGVVEAVAPDVQGFSVGDEVFGMVRFPSFGDSAAYAEYVAAPASDLALKPAGIDHVQAAAAPMAGLTAWQFLIDLGHDEPNPFQGQPHQPAPLAGRTVLINGAAGGVGHFAVQLAKWKGARVIAVASGAHEAFLRGLGADAFIDYTLTPPEDVVSDIDLVLDTAGGSTTGRFLRTIRRGGALFPVFLGFSDAEEAAERGVTVSMTQVRSSGAQLADLARPLDAGTVRVAIDSTFPLAEAGRAHERAARGHIQGKIVLTVG

Samples

Sample ID Description Type Environment
1 2579778521 Frankia torreyi CpI1-S Isolate Unclassified
2 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
3 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
4 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
5 2619618881 Frankia sp. ACN1ag Isolate Unclassified
6 2619619003 Frankia sp. CpI1-P Isolate Nodule
7 2643221609 Acidovorax sp. Root217 Isolate Unclassified
8 2643221611 Acidovorax sp. Root219 Isolate Unclassified
9 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
10 2643221647 Streptomyces sp. Root369 Isolate Unclassified
11 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
12 2643221732 Bacillus sp. Root239 Isolate Unclassified
13 2738541278 Niastella sp. CF465 Isolate Unclassified
14 2738543005 Rhodococcus sp. OK519 Isolate Unclassified
15 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
16 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
17 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
18 2854911287 Brucella lupini LUP21 Isolate Unclassified
19 2856741275 Microbispora triticiradicis NEAU-HRDPA2-9 Isolate Unclassified
20 2857576091 Pigmentiphaga sp. R-72090 Isolate Unclassified
21 2857591370 Brevibacillus sp. R-71934 Isolate Unclassified
22 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
23 2862574272 Streptomyces sp. AcE210 Isolate Nodule
24 2865002811 Paenibacillus sp. R-74131 Isolate Unclassified
25 2867428634 Streptomyces sp. RP5T Isolate Unclassified
26 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
27 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
28 2891562705 Microbispora tritici MT50 Isolate Unclassified
29 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
30 2904524088 Priestia megaterium 1428 Isolate Rhizosphere
31 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
32 2919143609 Priestia megaterium 1751 Isolate Rhizosphere
33 2919517244 Priestia aryabhattai 3820 Isolate Unclassified
34 2928093941 Priestia aryabhattai 1389 Isolate Rhizosphere
35 2929004312 Priestia megaterium 1104 Isolate Unclassified
36 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
37 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
38 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
39 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
40 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
41 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
42 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
43 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
44 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
45 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
46 3001892409 Neobacillus rhizophilus FJAT-49825 Isolate Rhizosphere
47 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
48 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
49 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
50 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
51 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
52 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
53 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
54 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
55 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
56 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
57 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
58 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
59 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
60 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
61 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
62 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
63 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
64 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
65 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
66 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
67 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
68 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
69 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
70 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
71 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
72 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
73 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
74 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
75 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
76 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
77 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
78 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
80 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
81 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
87 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
88 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
89 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
91 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
93 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
94 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
95 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
96 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
97 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
99 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
100 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
115 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
118 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
119 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
120 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
121 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
122 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
123 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
124 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
125 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
126 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
127 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
128 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
129 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
130 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
131 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
132 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
133 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
134 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
135 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
136 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
137 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
138 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
139 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
140 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
141 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
142 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
143 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
144 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
145 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
146 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
147 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
148 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
149 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
150 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
151 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
152 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
153 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
154 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
155 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
156 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
157 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
158 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
159 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
160 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
161 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
162 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
163 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
164 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
165 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
166 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
167 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
168 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
169 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
170 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
171 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
172 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
173 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
174 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
175 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
176 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
177 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
178 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
179 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
180 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
181 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
182 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
183 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
184 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
185 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
186 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
187 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
188 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
189 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
190 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
191 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
192 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
193 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
194 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
195 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
196 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
197 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
198 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
199 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
200 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
201 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
202 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
203 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
204 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
205 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
206 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
207 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
208 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
209 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
210 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
211 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
212 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
213 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
214 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
215 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
216 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
217 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
218 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
219 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
220 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
221 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
222 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
223 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
224 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
225 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
226 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
229 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
233 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
236 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
237 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
238 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
240 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
241 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
242 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
243 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
244 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
245 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
246 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
247 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
248 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
249 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
250 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
251 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
252 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
253 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
254 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
255 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
256 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
257 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
258 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
259 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
260 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
261 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
262 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
263 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
264 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
265 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
266 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
267 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
268 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
269 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
270 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
271 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
272 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified
273 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
274 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
275 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
276 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
277 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
278 8054913762 Frankia gtarii Agncl-10 Isolate Nodule
279 8054920844 Frankia tisae Agncl-8 Isolate Nodule
280 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 85.08
Metatranscriptomes 0
Isolates 14.92

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.97
Nodule 1.57
Rhizoplane 3.93
Rhizosphere 58.9
Stem 0
Stem Tuber 0
Unclassified 19.63

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10032508 3300001990 Bacteria 1624
2 JGI25152J39213_1000831 3300002773 Bacteria 15321
3 JGI25153J46596_10001274 3300003215 Bacteria 15140
4 rootH1_10154899 3300003316 Bacteria 1800
5 rootH2_10263809 3300003320 Bacteria 2192
6 rootL2_10029221 3300003322 Bacteria 12469
7 rootL2_10055409 3300003322 Bacteria 4563
8 rootH1_10005689 3300003323 Bacteria 9971
9 rootH1_10022076 3300003323 Bacteria 2065
10 rootH1_10034663 3300003323 Bacteria 4736
11 Ga0055526_1000659 3300003771 Bacteria 26512
12 Ga0055526_1003216 3300003771 Bacteria 10535
13 Ga0055524_1000618 3300003775 Bacteria 25511
14 Ga0055528_1000602 3300003790 Bacteria 26995
15 Ga0065165_1000006 3300005262 Bacteria 352298
16 Ga0065165_1001673 3300005262 Bacteria 22420
17 Ga0065165_1004517 3300005262 Bacteria 8536
18 Ga0070683_100170708 3300005329 Bacteria 2064
19 Ga0070668_100221985 3300005347 Bacteria 1559
20 Ga0070667_100000142 3300005367 Bacteria 90696
21 Ga0070699_100238779 3300005518 Bacteria 1621
22 Ga0068855_100167723 3300005563 Bacteria 2488
23 Ga0068855_100214220 3300005563 Bacteria 2163
24 Ga0068859_100002793 3300005617 Bacteria 17685
25 Ga0068861_100000109 3300005719 Bacteria 41453
26 Ga0068863_100000105 3300005841 Bacteria 90388
27 Ga0068858_100173754 3300005842 Bacteria 2033
28 Ga0068860_100000209 3300005843 Bacteria 92811
29 Ga0068862_100000211 3300005844 Bacteria 65382
30 Ga0068862_100195882 3300005844 Bacteria 1820
31 Ga0075365_10041274 3300006038 Bacteria 3013
32 Ga0075368_10000298 3300006042 Bacteria 14314
33 Ga0075364_10039168 3300006051 Bacteria 3072
34 Ga0075367_10000140 3300006178 Bacteria 21897
35 Ga0075367_10000255 3300006178 Bacteria 18154
36 Ga0075366_10038469 3300006195 Bacteria 2825
37 Ga0075370_10005538 3300006353 Bacteria 6292
38 Ga0075370_10025139 3300006353 Bacteria 3292
39 Ga0075428_100010750 3300006844 Bacteria 10174
40 Ga0075428_100069814 3300006844 Bacteria 3841
41 Ga0075430_100014876 3300006846 Bacteria 6626
42 Ga0075429_100015425 3300006880 Bacteria 6620
43 Ga0097620_100002793 3300006931 Bacteria 17685
44 Ga0105244_10028800 3300009036 Bacteria 2976
45 Ga0105247_10000141 3300009101 Bacteria 70210
46 Ga0114129_10029180 3300009147 Bacteria 7814
47 Ga0114129_10050047 3300009147 Bacteria 5870
48 Ga0105248_10000242 3300009177 Bacteria 63110
49 Ga0105248_10017160 3300009177 Bacteria 7974
50 Ga0105249_10000031 3300009553 Bacteria 220006
51 Ga0157374_10575725 3300013296 Bacteria 1135
52 Ga0163163_10109970 3300014325 Bacteria 2784
53 Ga0157379_10105052 3300014968 Bacteria 2535
54 Ga0163161_10260202 3300017792 Bacteria 1355
55 Ga0213875_10014757 3300021388 Bacteria 3809
56 Ga0209258_100311 3300025242 Bacteria 76151
57 Ga0207425_1000444 3300025245 Bacteria 27112
58 Ga0209148_1000163 3300025254 Bacteria 137449
59 Ga0209129_1000012 3300025258 Bacteria 541516
60 Ga0209673_1000475 3300025273 Bacteria 67091
61 Ga0209025_1021261 3300025294 Bacteria 3503
62 Ga0209564_1000022 3300025295 Bacteria 555109
63 Ga0209564_1000496 3300025295 Bacteria 64984
64 Ga0209758_1000198 3300025297 Bacteria 133584
65 Ga0209050_1000283 3300025298 Bacteria 107761
66 Ga0209256_1000439 3300025299 Bacteria 64161
67 Ga0209256_1013636 3300025299 Bacteria 3002
68 Ga0207426_1002028 3300025302 Bacteria 14201
69 Ga0209051_1033881 3300025303 Bacteria 1923
70 Ga0209257_1000013 3300025304 Bacteria 1047305
71 Ga0207655_1029708 3300025728 Bacteria 2553
72 Ga0207713_1027200 3300025735 Bacteria 2603
73 Ga0207710_10000164 3300025900 Bacteria 70180
74 Ga0207647_10007912 3300025904 Bacteria 7647
75 Ga0207687_10215230 3300025927 Bacteria 1509
76 Ga0207711_10000196 3300025941 Bacteria 64910
77 Ga0207711_10007713 3300025941 Bacteria 8992
78 Ga0207667_10356777 3300025949 Bacteria 1491
79 Ga0207712_10000029 3300025961 Bacteria 220014
80 Ga0207668_10230906 3300025972 Bacteria 1492
81 Ga0207658_10000113 3300025986 Bacteria 88960
82 Ga0207658_10338499 3300025986 Bacteria 1307
83 Ga0207641_10001920 3300026088 Bacteria 19944
84 Ga0207675_100000255 3300026118 Bacteria 50880
85 Ga0209813_10000145 3300027866 Bacteria 24679
86 Ga0209813_10003282 3300027866 Bacteria 3777
87 Ga0268265_10000040 3300028380 Bacteria 194156
88 Ga0268264_10000017 3300028381 Bacteria 498037
89 Ga0265318_10004374 3300028577 Bacteria 6855
90 Ga0307517_10063754 3300028786 Bacteria 3439
91 Ga0307515_10006532 3300028794 Bacteria 23318
92 Ga0307515_10189233 3300028794 Bacteria 1975
93 Ga0307515_10316683 3300028794 Bacteria 1230
94 Ga0307512_10006223 3300030522 Bacteria 12158
95 Ga0307512_10023291 3300030522 Bacteria 5537
96 Ga0265330_10002686 3300031235 Bacteria 9609
97 Ga0265332_10017136 3300031238 Bacteria 3195
98 Ga0265328_10060707 3300031239 Bacteria 1388
99 Ga0265320_10001020 3300031240 Bacteria 20858
100 Ga0265329_10006019 3300031242 Bacteria 4851
101 Ga0265340_10005110 3300031247 Bacteria 7293
102 Ga0265331_10039765 3300031250 Bacteria 2291
103 Ga0307513_10002122 3300031456 Bacteria 27831
104 Ga0307513_10168595 3300031456 Bacteria 2070
105 Ga0307509_10000047 3300031507 Bacteria 169362
106 Ga0307508_10011219 3300031616 Bacteria 8197
107 Ga0307508_10066042 3300031616 Bacteria 3185
108 Ga0307514_10080196 3300031649 Bacteria 2416
109 Ga0265314_10039874 3300031711 Bacteria 3377
110 Ga0265342_10019479 3300031712 Bacteria 4372
111 Ga0307516_10015740 3300031730 Bacteria 7948
112 Ga0307516_10093180 3300031730 Bacteria 2838
113 Ga0307516_10180039 3300031730 Bacteria 1848
114 Ga0373942_0000468 3300035207 Bacteria 11445
115 Ga0373931_0003427 3300035691 Bacteria 7119
116 Ga0395899_0135063 3300037312 Bacteria 1759
117 Ga0395900_0151249 3300037418 Bacteria 2371
118 Ga0395900_0202467 3300037418 Bacteria 2008
119 Ga0395898_0251128 3300037466 Bacteria 1687
120 Ga0395905_0277313 3300037471 Bacteria 1562
121 Ga0436364_0697584 3300037853 Bacteria 3811
122 Ga0451837_0072614 3300041494 Bacteria 1457
123 Ga0451853_1564484 3300041512 Bacteria 1532
124 Ga0439455_0007303 3300042012 Bacteria 2333
125 Ga0450903_000688 3300042138 Bacteria 6769
126 Ga0439458_0001378 3300042157 Bacteria 6135
127 Ga0466963_0000381 3300044694 Bacteria 20256
128 Ga0453684_0000959 3300044712 Bacteria 94983
129 Ga0453684_0001492 3300044712 Bacteria 66005
130 Ga0466970_0082810 3300044765 Bacteria 1735
131 Ga0466957_0238165 3300044842 Bacteria 1207
132 Ga0495617_018798 3300046452 Bacteria 2337
133 Ga0495603_0000169 3300046455 Bacteria 33188
134 Ga0495603_0191603 3300046455 Bacteria 1182
135 Ga0495629_0010801 3300046459 Bacteria 6643
136 Ga0495629_0054042 3300046459 Bacteria 2809
137 Ga0495629_0087760 3300046459 Bacteria 2170
138 Ga0495638_0130907 3300046460 Bacteria 1473
139 Ga0495651_0030039 3300046462 Bacteria 4237
140 Ga0495653_0000002 3300046463 Bacteria 507262
141 Ga0495650_0000048 3300046471 Bacteria 334427
142 Ga0495580_0041995 3300046472 Bacteria 3259
143 Ga0495605_0009363 3300046474 Bacteria 5504
144 Ga0495662_0003835 3300046476 Bacteria 7578
145 Ga0495664_0057887 3300046477 Bacteria 2306
146 Ga0495584_0049384 3300046491 Bacteria 2120
147 Ga0495594_0001545 3300046499 Bacteria 11952
148 Ga0495594_0007681 3300046499 Bacteria 5548
149 Ga0495607_0000101 3300046501 Bacteria 91495
150 Ga0495607_0073191 3300046501 Bacteria 1905
151 Ga0495583_0002813 3300046506 Bacteria 14240
152 Ga0495583_0102199 3300046506 Bacteria 1222
153 Ga0495606_0000566 3300046507 Bacteria 58661
154 Ga0495606_0001273 3300046507 Bacteria 34937
155 Ga0495608_0083878 3300046511 Bacteria 2068
156 Ga0495616_0027569 3300046513 Bacteria 3013
157 Ga0495618_0132375 3300046514 Bacteria 1595
158 Ga0495620_0005362 3300046515 Bacteria 7166
159 Ga0495620_0041755 3300046515 Bacteria 2009
160 Ga0495628_0000305 3300046516 Bacteria 44171
161 Ga0495628_0037310 3300046516 Bacteria 3896
162 Ga0495628_0080361 3300046516 Bacteria 2534
163 Ga0495631_0009029 3300046518 Bacteria 4994
164 Ga0495643_0000779 3300046522 Bacteria 35558
165 Ga0495643_0008026 3300046522 Bacteria 6730
166 Ga0495643_0034825 3300046522 Bacteria 2775
167 Ga0495643_0134197 3300046522 Bacteria 1240
168 Ga0495648_0083172 3300046524 Bacteria 1814
169 Ga0495648_0105221 3300046524 Bacteria 1548
170 Ga0495652_0009557 3300046529 Bacteria 8805
171 Ga0495652_0033722 3300046529 Bacteria 4467
172 Ga0495652_0062633 3300046529 Bacteria 3136
173 Ga0495652_0064571 3300046529 Bacteria 3078
174 Ga0495640_0001326 3300046533 Bacteria 19473
175 Ga0495609_0036257 3300046538 Bacteria 2227
176 Ga0495597_0008976 3300046542 Bacteria 4982
177 Ga0495633_0123209 3300046558 Bacteria 1201
178 Ga0495656_0014908 3300046615 Bacteria 2924
179 Ga0495656_0089374 3300046615 Bacteria 1406
180 Ga0495668_0014161 3300046616 Bacteria 4686
181 Ga0495668_0098787 3300046616 Bacteria 1597
182 Ga0495634_0035893 3300046642 Bacteria 3392
183 Ga0495634_0060391 3300046642 Bacteria 2522
184 Ga0495611_0020635 3300046648 Bacteria 2837
185 Ga0495625_0062933 3300046660 Bacteria 2621
186 Ga0495625_0142250 3300046660 Bacteria 1617
187 Ga0495635_0097949 3300046663 Bacteria 2005
188 Ga0495635_0164362 3300046663 Bacteria 1510
189 Ga0495661_0052360 3300046665 Bacteria 2460
190 Ga0495588_0008096 3300046674 Bacteria 4806
191 Ga0495657_0010702 3300046675 Bacteria 6895
192 Ga0495657_0015392 3300046675 Bacteria 5599
193 Ga0495657_0036802 3300046675 Bacteria 3379
194 Ga0495623_0004702 3300046679 Bacteria 8972
195 Ga0495613_0002314 3300046689 Bacteria 14432
196 Ga0495613_0023226 3300046689 Bacteria 4619
197 Ga0495613_0055011 3300046689 Bacteria 2925
198 Ga0495624_0038473 3300046690 Bacteria 3073
199 Ga0495670_0063320 3300046691 Bacteria 1862
200 Ga0495670_0080785 3300046691 Bacteria 1656
201 Ga0495649_0004377 3300046694 Bacteria 9241
202 Ga0495649_0033777 3300046694 Bacteria 2815
203 Ga0495649_0092183 3300046694 Bacteria 1614
204 Ga0495600_0010654 3300046809 Bacteria 5712
205 Ga0495600_0045267 3300046809 Bacteria 2871
206 Ga0495600_0092332 3300046809 Bacteria 1974
207 Ga0495660_0057620 3300046810 Bacteria 2095
208 Ga0495604_0003056 3300047317 Bacteria 13374
209 Ga0495604_0008141 3300047317 Bacteria 8296
210 Ga0495604_0009589 3300047317 Bacteria 7657
211 Ga0495604_0162072 3300047317 Bacteria 1579
212 Ga0495636_0054459 3300047318 Bacteria 1681
213 Ga0495676_0009514 3300047321 Bacteria 8849
214 Ga0495676_0020440 3300047321 Bacteria 5808
215 Ga0495676_0035443 3300047321 Bacteria 4172
216 Ga0495676_0076489 3300047321 Bacteria 2555
217 Ga0495676_0097149 3300047321 Bacteria 2188
218 Ga0495680_0002951 3300047322 Bacteria 17021
219 Ga0495683_0115809 3300047323 Bacteria 1276
220 Ga0495687_003312 3300047443 Bacteria 11815
221 Ga0495687_007993 3300047443 Bacteria 6127
222 Ga0495687_008306 3300047443 Bacteria 5964
223 Ga0495675_0090769 3300047444 Bacteria 1917
224 Ga0495685_007546 3300047447 Bacteria 3593
225 Ga0495685_011054 3300047447 Bacteria 3038
226 Ga0495685_052840 3300047447 Bacteria 1376
227 Ga0495681_0085934 3300047470 Bacteria 1396
228 Ga0495684_0135001 3300047471 Bacteria 1852
229 Ga0495684_0199823 3300047471 Bacteria 1474
230 Ga0495593_0009118 3300047673 Bacteria 5755
231 Ga0495602_0114327 3300048088 Bacteria 2186
232 Ga0495614_0015967 3300048089 Bacteria 3270
233 Ga0495614_0018640 3300048089 Bacteria 3006
234 Ga0495626_0043373 3300048091 Bacteria 2110
235 Ga0496100_0003562 3300048903 Bacteria 8137
236 Ga0496100_0129047 3300048903 Bacteria 1778
237 Ga0496101_0000209 3300048904 Bacteria 44473
238 Ga0496101_0018410 3300048904 Bacteria 4750
239 Ga0496101_0021376 3300048904 Bacteria 4447
240 Ga0496102_0000014 3300048905 Bacteria 310241
241 Ga0496102_0000941 3300048905 Bacteria 27484
242 Ga0496103_0000004 3300048906 Bacteria 510080
243 Ga0496103_0004108 3300048906 Bacteria 8840
244 Ga0496103_0004615 3300048906 Bacteria 8339
245 Ga0496105_0138936 3300048908 Bacteria 2001
246 Ga0496106_0107568 3300048909 Bacteria 2169
247 Ga0496112_0141469 3300048915 Bacteria 2375
248 Ga0496114_0523276 3300048917 Bacteria 1049
249 Ga0496116_0000069 3300048919 Bacteria 252643
250 Ga0496116_0033265 3300048919 Bacteria 3661
251 Ga0496117_0000003 3300048920 Bacteria 1881097
252 Ga0496117_0000160 3300048920 Bacteria 141709
253 Ga0496118_0000001 3300048921 Bacteria 1881100
254 Ga0496118_0006093 3300048921 Bacteria 13404
255 Ga0496118_0013637 3300048921 Bacteria 7671
256 Ga0496119_0000262 3300048922 Bacteria 74530
257 Ga0496119_0003411 3300048922 Bacteria 16508
258 Ga0496120_0000085 3300048923 Bacteria 155343
259 Ga0496121_0000032 3300048924 Bacteria 378997
260 Ga0496121_0001187 3300048924 Bacteria 45612
261 Ga0496121_0011050 3300048924 Bacteria 10077
262 Ga0496121_0038495 3300048924 Bacteria 4233
263 Ga0496121_0063135 3300048924 Bacteria 3029
264 Ga0496121_0107825 3300048924 Bacteria 2132
265 Ga0496125_0067371 3300048928 Bacteria 2821
266 Ga0496125_0135446 3300048928 Bacteria 1724
267 Ga0496126_0001225 3300048929 Bacteria 41693
268 Ga0496126_0018246 3300048929 Bacteria 6960
269 Ga0496126_0120269 3300048929 Bacteria 2278
270 Ga0501031_0045388 3300049568 Bacteria 2867
271 Ga0501032_0034774 3300049569 Bacteria 3447
272 Ga0501033_0058570 3300049570 Bacteria 2845
273 Ga0501033_0070424 3300049570 Bacteria 2569
274 Ga0501034_0171235 3300049571 Bacteria 2138
275 Ga0501034_0209622 3300049571 Bacteria 1904
276 Ga0501036_0022012 3300049572 Bacteria 5361
277 Ga0501036_0026501 3300049572 Bacteria 4893
278 Ga0501037_0006008 3300049573 Bacteria 8862
279 Ga0501037_0080902 3300049573 Bacteria 2356
280 Ga0501038_0043508 3300049574 Bacteria 3904
281 Ga0501038_0047987 3300049574 Bacteria 3697
282 Ga0501043_0003130 3300049579 Bacteria 13723
283 Ga0501043_0010871 3300049579 Bacteria 7128
284 Ga0501046_0028148 3300049580 Bacteria 4579
285 Ga0501070_0066425 3300049586 Bacteria 2987
286 Ga0501070_0400321 3300049586 Bacteria 1110
287 Ga0501077_0007313 3300049593 Bacteria 6813
288 Ga0501241_000278 3300049758 Bacteria 11304
289 Ga0501035_0150390 3300049822 Bacteria 2021
290 Ga0501044_0008318 3300049823 Bacteria 11369
291 Ga0501044_0039673 3300049823 Bacteria 4911
292 Ga0501044_0243158 3300049823 Bacteria 1743
293 Ga0501045_0086082 3300049824 Bacteria 2320
294 nmdc:mga03n38_33242_c1 3300050490 Bacteria 2192
295 nmdc:mga0yw44_105838_c1 3300050492 Bacteria 1797
296 nmdc:mga0k408_100422_c1 3300050493 Bacteria 1706
297 nmdc:mga06z11_263_c1 3300050494 Bacteria 20517
298 nmdc:mga04h51_150_c1 3300050495 Bacteria 20503
299 nmdc:mga04h51_4781_c1 3300050495 Bacteria 3400
300 nmdc:mga07m45_26197_c1 3300050496 Bacteria 3204
301 nmdc:mga05p37_96407_c1 3300050507 Bacteria 3644
302 nmdc:mga09592_151470_c1 3300050508 Bacteria 2001
303 nmdc:mga0qj67_134616_c1 3300050509 Bacteria 2002
304 nmdc:mga06r32_126006_c1 3300050510 Bacteria 2530
305 Ga0495619_0036037 3300053085 Bacteria 3220
306 Ga0500578_0000086 3300053086 Bacteria 103107
307 Ga0500643_015477 3300053087 Bacteria 2614
308 Ga0500644_0013968 3300053088 Bacteria 2255
309 Ga0500646_0038188 3300053090 Bacteria 1344
310 Ga0500641_0037984 3300053096 Bacteria 1933
311 Ga0500650_0137366 3300053098 Bacteria 1134
312 Ga0500555_031630 3300053103 Bacteria 1499
313 Ga0500556_0000991 3300053104 Bacteria 15004
314 Ga0500569_000537 3300053109 Bacteria 6336
315 Ga0500594_0018230 3300053118 Bacteria 1726
316 Ga0500652_043523 3300053131 Bacteria 1815
317 Ga0500658_0000826 3300053134 Bacteria 12746
318 Ga0500573_0024734 3300053140 Bacteria 3453
319 Ga0500577_0041869 3300053142 Bacteria 1673
320 Ga0500600_0049015 3300053149 Bacteria 2403
321 Ga0500616_0000106 3300053153 Bacteria 153706
322 Ga0500616_0000181 3300053153 Bacteria 104316
323 Ga0500616_0003944 3300053153 Bacteria 10885
324 Ga0500622_0000051 3300053156 Bacteria 145514
325 Ga0500636_0037856 3300053177 Bacteria 2853

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050510 nmdc:mga06r32_126006_c1 nmdc:mga06r32_126006_c1_1693_2508 267
2 3300046660 Ga0495625_0062933 Ga0495625_0062933_856_1695 277
3 3300005518 Ga0070699_100238779 Ga0070699_1002387792 281
4 3300050490 nmdc:mga03n38_33242_c1 nmdc:mga03n38_33242_c1_22_867 281
5 3300041512 Ga0451853_1564484 Ga0451853_1564484_646_1497 282
6 3300046506 Ga0495583_0102199 Ga0495583_0102199_15_872 285
7 3300046516 Ga0495628_0080361 Ga0495628_0080361_1399_2328 297
8 3300046529 Ga0495652_0064571 Ga0495652_0064571_1538_2467 297
9 3300047471 Ga0495684_0199823 Ga0495684_0199823_26_955 297
10 3300048088 Ga0495602_0114327 Ga0495602_0114327_201_1130 297
11 3300053085 Ga0495619_0036037 Ga0495619_0036037_1445_2374 297
12 3300037312 Ga0395899_0135063 Ga0395899_0135063_38_949 302
13 3300046529 Ga0495652_0009557 Ga0495652_0009557_7883_8791 302
14 iso_pu_bacteria 2643221623 2644130915 302
15 3300005329 Ga0070683_100170708 Ga0070683_1001707082 303
16 3300025927 Ga0207687_10215230 Ga0207687_102152302 304
17 3300006844 Ga0075428_100010750 Ga0075428_1000107506 305
18 3300006846 Ga0075430_100014876 Ga0075430_1000148763 305
19 3300006880 Ga0075429_100015425 Ga0075429_1000154252 305
20 3300009147 Ga0114129_10029180 Ga0114129_100291805 305
21 3300048915 Ga0496112_0141469 Ga0496112_0141469_100_1032 305
22 3300049593 Ga0501077_0007313 Ga0501077_0007313_637_1569 305
23 3300050508 nmdc:mga09592_151470_c1 nmdc:mga09592_151470_c1_47_976 305
24 3300050509 nmdc:mga0qj67_134616_c1 nmdc:mga0qj67_134616_c1_298_1227 305
25 3300053087 Ga0500643_015477 Ga0500643_015477_55_981 306
26 3300044712 Ga0453684_0000959 Ga0453684_0000959_66177_67115 309
27 3300044712 Ga0453684_0001492 Ga0453684_0001492_58823_59761 309
28 3300047321 Ga0495676_0035443 Ga0495676_0035443_2486_3481 309
29 3300048917 Ga0496114_0523276 Ga0496114_0523276_91_1029 310
30 3300031730 Ga0307516_10015740 Ga0307516_100157404 311
31 3300031730 Ga0307516_10093180 Ga0307516_100931802 311
32 3300030522 Ga0307512_10023291 Ga0307512_100232912 314
33 iso_pu_bacteria 2856741275 2856743708 316
34 iso_pu_bacteria 2891395885 2891397072 316
35 iso_pu_bacteria 2891554331 2891558090 316
36 iso_pu_bacteria 2891562705 2891566203 316
37 iso_pu_bacteria 8055066027 8055072576 318
38 3300046452 Ga0495617_018798 Ga0495617_018798_13_1011 320
39 3300046459 Ga0495629_0010801 Ga0495629_0010801_1575_2573 320
40 3300046459 Ga0495629_0054042 Ga0495629_0054042_1798_2796 320
41 3300046460 Ga0495638_0130907 Ga0495638_0130907_451_1449 320
42 3300046474 Ga0495605_0009363 Ga0495605_0009363_3598_4596 320
43 3300046491 Ga0495584_0049384 Ga0495584_0049384_54_1052 320
44 3300046499 Ga0495594_0001545 Ga0495594_0001545_9992_10990 320
45 3300046501 Ga0495607_0073191 Ga0495607_0073191_882_1880 320
46 3300046507 Ga0495606_0001273 Ga0495606_0001273_3818_4816 320
47 3300046513 Ga0495616_0027569 Ga0495616_0027569_837_1835 320
48 3300046518 Ga0495631_0009029 Ga0495631_0009029_3061_4059 320
49 3300046542 Ga0495597_0008976 Ga0495597_0008976_955_1953 320
50 3300046616 Ga0495668_0014161 Ga0495668_0014161_2750_3748 320
51 3300046660 Ga0495625_0142250 Ga0495625_0142250_19_1017 320
52 3300046663 Ga0495635_0164362 Ga0495635_0164362_351_1349 320
53 3300046665 Ga0495661_0052360 Ga0495661_0052360_1450_2448 320
54 3300046675 Ga0495657_0010702 Ga0495657_0010702_3982_4980 320
55 3300046689 Ga0495613_0023226 Ga0495613_0023226_1905_2903 320
56 3300046694 Ga0495649_0004377 Ga0495649_0004377_6858_7856 320
57 3300046809 Ga0495600_0045267 Ga0495600_0045267_455_1453 320
58 3300046810 Ga0495660_0057620 Ga0495660_0057620_856_1854 320
59 3300047317 Ga0495604_0162072 Ga0495604_0162072_139_1137 320
60 3300047318 Ga0495636_0054459 Ga0495636_0054459_57_1055 320
61 3300047321 Ga0495676_0076489 Ga0495676_0076489_957_1955 320
62 3300047321 Ga0495676_0097149 Ga0495676_0097149_1143_2141 320
63 3300047470 Ga0495681_0085934 Ga0495681_0085934_206_1204 320
64 3300048089 Ga0495614_0015967 Ga0495614_0015967_869_1867 320
65 3300048089 Ga0495614_0018640 Ga0495614_0018640_763_1761 320
66 3300048091 Ga0495626_0043373 Ga0495626_0043373_578_1576 320
67 3300044765 Ga0466970_0082810 Ga0466970_0082810_462_1469 321
68 3300046538 Ga0495609_0036257 Ga0495609_0036257_185_1183 321
69 3300047447 Ga0495685_007546 Ga0495685_007546_1685_2683 321
70 3300047673 Ga0495593_0009118 Ga0495593_0009118_2682_3680 321
71 3300037466 Ga0395898_0251128 Ga0395898_0251128_19_996 322
72 3300041494 Ga0451837_0072614 Ga0451837_0072614_53_1066 323
73 3300047443 Ga0495687_007993 Ga0495687_007993_834_1829 323
74 3300006353 Ga0075370_10025139 Ga0075370_100251391 324
75 3300046462 Ga0495651_0030039 Ga0495651_0030039_414_1430 325
76 3300046516 Ga0495628_0000305 Ga0495628_0000305_23657_24673 325
77 3300046529 Ga0495652_0033722 Ga0495652_0033722_408_1424 325
78 3300046809 Ga0495600_0092332 Ga0495600_0092332_382_1398 325
79 3300047317 Ga0495604_0009589 Ga0495604_0009589_3923_4939 325
80 3300003322 rootL2_10055409 rootL2_100554096 326
81 3300005719 Ga0068861_100000109 Ga0068861_10000010918 326
82 3300026118 Ga0207675_100000255 Ga0207675_10000025525 326
83 iso_pu_bacteria 2582581314 2585321883 327
84 iso_pu_bacteria 2643221647 2644265670 327
85 iso_pu_bacteria 2643221678 2644440122 327
86 iso_pu_bacteria 2786546132 2786667587 327
87 iso_pu_bacteria 2895427314 2895434752 327
88 iso_pu_bacteria 2954380949 2954381328 327
89 iso_pu_bacteria 2954673503 2954673727 327
90 iso_pu_bacteria 2954682443 2954690263 327
91 iso_pu_bacteria 2954711539 2954719719 327
92 iso_pu_bacteria 2954721474 2954729754 327
93 iso_pu_bacteria 2954731030 2954732025 327
94 iso_pu_bacteria 2954740390 2954748660 327
95 iso_pu_bacteria 2954749733 2954750994 327
96 iso_pu_bacteria 2954759201 2954767777 327
97 iso_pu_bacteria 8008558824 8008565345 327
98 3300046472 Ga0495580_0041995 Ga0495580_0041995_1917_2981 328
99 3300046511 Ga0495608_0083878 Ga0495608_0083878_376_1440 328
100 3300046514 Ga0495618_0132375 Ga0495618_0132375_196_1260 328
101 3300046515 Ga0495620_0041755 Ga0495620_0041755_560_1642 328
102 3300046516 Ga0495628_0037310 Ga0495628_0037310_1809_2873 328
103 3300046522 Ga0495643_0034825 Ga0495643_0034825_1346_2428 328
104 3300046642 Ga0495634_0035893 Ga0495634_0035893_2258_3322 328
105 3300046675 Ga0495657_0015392 Ga0495657_0015392_141_1205 328
106 3300046679 Ga0495623_0004702 Ga0495623_0004702_209_1273 328
107 3300046809 Ga0495600_0010654 Ga0495600_0010654_2895_3959 328
108 3300047317 Ga0495604_0003056 Ga0495604_0003056_10193_11257 328
109 3300047322 Ga0495680_0002951 Ga0495680_0002951_1402_2466 328
110 3300047444 Ga0495675_0090769 Ga0495675_0090769_40_1104 328
111 3300047471 Ga0495684_0135001 Ga0495684_0135001_434_1498 328
112 3300053153 Ga0500616_0000106 Ga0500616_0000106_50182_51195 328
113 iso_pu_bacteria 2854911287 2854913131 328
114 3300044842 Ga0466957_0238165 Ga0466957_0238165_109_1122 329
115 3300046642 Ga0495634_0060391 Ga0495634_0060391_1285_2277 329
116 3300053153 Ga0500616_0000181 Ga0500616_0000181_2890_3906 329
117 3300031616 Ga0307508_10066042 Ga0307508_100660423 330
118 3300046615 Ga0495656_0014908 Ga0495656_0014908_791_1795 330
119 3300049568 Ga0501031_0045388 Ga0501031_0045388_1312_2352 330
120 3300049570 Ga0501033_0058570 Ga0501033_0058570_1302_2342 330
121 3300049571 Ga0501034_0171235 Ga0501034_0171235_609_1649 330
122 3300049572 Ga0501036_0022012 Ga0501036_0022012_2537_3577 330
123 3300049573 Ga0501037_0006008 Ga0501037_0006008_6359_7399 330
124 3300049574 Ga0501038_0047987 Ga0501038_0047987_1945_2985 330
125 3300049579 Ga0501043_0003130 Ga0501043_0003130_1397_2437 330
126 3300049580 Ga0501046_0028148 Ga0501046_0028148_2039_3079 330
127 3300049758 Ga0501241_000278 Ga0501241_000278_6976_8019 330
128 3300005262 Ga0065165_1000006 Ga0065165_100000649 331
129 3300006038 Ga0075365_10041274 Ga0075365_100412742 331
130 3300006042 Ga0075368_10000298 Ga0075368_100002986 331
131 3300006051 Ga0075364_10039168 Ga0075364_100391683 331
132 3300006178 Ga0075367_10000140 Ga0075367_1000014019 331
133 3300006178 Ga0075367_10000255 Ga0075367_100002556 331
134 3300009147 Ga0114129_10050047 Ga0114129_100500474 331
135 3300013296 Ga0157374_10575725 Ga0157374_105757251 331
136 3300027866 Ga0209813_10000145 Ga0209813_1000014516 331
137 3300027866 Ga0209813_10003282 Ga0209813_100032823 331
138 3300035207 Ga0373942_0000468 Ga0373942_0000468_544_1542 331
139 3300037418 Ga0395900_0151249 Ga0395900_0151249_338_1336 331
140 3300037471 Ga0395905_0277313 Ga0395905_0277313_236_1234 331
141 3300042012 Ga0439455_0007303 Ga0439455_0007303_898_1896 331
142 3300042138 Ga0450903_000688 Ga0450903_000688_4467_5465 331
143 3300042157 Ga0439458_0001378 Ga0439458_0001378_270_1268 331
144 3300046455 Ga0495603_0191603 Ga0495603_0191603_111_1106 331
145 3300046459 Ga0495629_0087760 Ga0495629_0087760_1035_2033 331
146 3300046476 Ga0495662_0003835 Ga0495662_0003835_5857_6855 331
147 3300046477 Ga0495664_0057887 Ga0495664_0057887_1236_2234 331
148 3300046499 Ga0495594_0007681 Ga0495594_0007681_1968_2966 331
149 3300046506 Ga0495583_0002813 Ga0495583_0002813_5143_6156 331
150 3300046515 Ga0495620_0005362 Ga0495620_0005362_3907_4920 331
151 3300046522 Ga0495643_0000779 Ga0495643_0000779_23931_24926 331
152 3300046522 Ga0495643_0008026 Ga0495643_0008026_4933_5946 331
153 3300046524 Ga0495648_0083172 Ga0495648_0083172_389_1402 331
154 3300046524 Ga0495648_0105221 Ga0495648_0105221_191_1186 331
155 3300046529 Ga0495652_0062633 Ga0495652_0062633_73_1071 331
156 3300046533 Ga0495640_0001326 Ga0495640_0001326_2837_3835 331
157 3300046558 Ga0495633_0123209 Ga0495633_0123209_16_1014 331
158 3300046616 Ga0495668_0098787 Ga0495668_0098787_16_1029 331
159 3300046663 Ga0495635_0097949 Ga0495635_0097949_63_1061 331
160 3300046674 Ga0495588_0008096 Ga0495588_0008096_3261_4259 331
161 3300046675 Ga0495657_0036802 Ga0495657_0036802_1927_2925 331
162 3300046689 Ga0495613_0002314 Ga0495613_0002314_11033_12031 331
163 3300046689 Ga0495613_0055011 Ga0495613_0055011_1415_2413 331
164 3300046690 Ga0495624_0038473 Ga0495624_0038473_1193_2191 331
165 3300046691 Ga0495670_0063320 Ga0495670_0063320_44_1042 331
166 3300046694 Ga0495649_0033777 Ga0495649_0033777_530_1543 331
167 3300046694 Ga0495649_0092183 Ga0495649_0092183_95_1090 331
168 3300047317 Ga0495604_0008141 Ga0495604_0008141_1381_2379 331
169 3300047321 Ga0495676_0009514 Ga0495676_0009514_3264_4262 331
170 3300047321 Ga0495676_0020440 Ga0495676_0020440_36_1031 331
171 3300047443 Ga0495687_003312 Ga0495687_003312_2083_3096 331
172 3300047443 Ga0495687_008306 Ga0495687_008306_1004_2002 331
173 3300047447 Ga0495685_011054 Ga0495685_011054_1103_2116 331
174 3300047447 Ga0495685_052840 Ga0495685_052840_364_1362 331
175 3300048903 Ga0496100_0129047 Ga0496100_0129047_570_1565 331
176 3300049569 Ga0501032_0034774 Ga0501032_0034774_929_1927 331
177 3300049570 Ga0501033_0070424 Ga0501033_0070424_1508_2506 331
178 3300049571 Ga0501034_0209622 Ga0501034_0209622_774_1772 331
179 3300049572 Ga0501036_0026501 Ga0501036_0026501_1645_2643 331
180 3300049573 Ga0501037_0080902 Ga0501037_0080902_1084_2082 331
181 3300049574 Ga0501038_0043508 Ga0501038_0043508_1798_2796 331
182 3300049579 Ga0501043_0010871 Ga0501043_0010871_149_1147 331
183 3300049586 Ga0501070_0066425 Ga0501070_0066425_883_1881 331
184 3300049586 Ga0501070_0400321 Ga0501070_0400321_63_1061 331
185 3300049822 Ga0501035_0150390 Ga0501035_0150390_1009_2007 331
186 3300049823 Ga0501044_0008318 Ga0501044_0008318_8793_9791 331
187 3300049823 Ga0501044_0039673 Ga0501044_0039673_211_1209 331
188 3300049824 Ga0501045_0086082 Ga0501045_0086082_978_1976 331
189 3300050492 nmdc:mga0yw44_105838_c1 nmdc:mga0yw44_105838_c1_301_1299 331
190 3300050494 nmdc:mga06z11_263_c1 nmdc:mga06z11_263_c1_13647_14717 331
191 3300050495 nmdc:mga04h51_150_c1 nmdc:mga04h51_150_c1_5808_6878 331
192 3300050495 nmdc:mga04h51_4781_c1 nmdc:mga04h51_4781_c1_1993_2991 331
193 3300053140 Ga0500573_0024734 Ga0500573_0024734_1416_2414 331
194 3300053149 Ga0500600_0049015 Ga0500600_0049015_104_1102 331
195 3300044694 Ga0466963_0000381 Ga0466963_0000381_3672_4682 332
196 iso_pu_bacteria 2579778521 2579855767 332
197 iso_pu_bacteria 2582581313 2585303019 332
198 iso_pu_bacteria 2616644814 2616698461 332
199 iso_pu_bacteria 2619618881 2619856451 332
200 iso_pu_bacteria 2619619003 2620351967 332
201 iso_pu_bacteria 2643221732 2644724549 332
202 iso_pu_bacteria 2738541278 2738731281 332
203 iso_pu_bacteria 2738543005 2739206374 332
204 iso_pu_bacteria 2808606359 2808848937 332
205 iso_pu_bacteria 2808606375 2808917177 332
206 iso_pu_bacteria 2857591370 2857595148 332
207 iso_pu_bacteria 2862574272 2862581211 332
208 iso_pu_bacteria 2865002811 2865006154 332
209 iso_pu_bacteria 2867428634 2867431595 332
210 iso_pu_bacteria 2904524088 2904529810 332
211 iso_pu_bacteria 2919143609 2919149738 332
212 iso_pu_bacteria 2919517244 2919522849 332
213 iso_pu_bacteria 2928093941 2928099537 332
214 iso_pu_bacteria 2929004312 2929009650 332
215 iso_pu_bacteria 3001892409 3001896097 332
216 iso_pu_bacteria 8008574985 8008581861 332
217 iso_pu_bacteria 8054913762 8054918834 332
218 iso_pu_bacteria 8054920844 8054927610 332
219 3300046471 Ga0495650_0000048 Ga0495650_0000048_64454_65455 333
220 iso_pu_bacteria 8047710418 8047712329 333
221 iso_pu_bacteria 8047893842 8047896400 333
222 iso_pu_bacteria 8048127548 8048133166 333
223 iso_pu_bacteria 8048356638 8048362536 333
224 iso_pu_bacteria 8048369669 8048373409 333
225 iso_pu_bacteria 8048379754 8048384833 333
226 3300005367 Ga0070667_100000142 Ga0070667_10000014231 335
227 3300005617 Ga0068859_100002793 Ga0068859_10000279320 335
228 3300005841 Ga0068863_100000105 Ga0068863_10000010567 335
229 3300005842 Ga0068858_100173754 Ga0068858_1001737542 335
230 3300005843 Ga0068860_100000209 Ga0068860_10000020962 335
231 3300005844 Ga0068862_100000211 Ga0068862_10000021116 335
232 3300006931 Ga0097620_100002793 Ga0097620_1000027936 335
233 3300009101 Ga0105247_10000141 Ga0105247_1000014163 335
234 3300009177 Ga0105248_10000242 Ga0105248_1000024227 335
235 3300009177 Ga0105248_10017160 Ga0105248_100171603 335
236 3300009553 Ga0105249_10000031 Ga0105249_10000031163 335
237 3300014325 Ga0163163_10109970 Ga0163163_101099703 335
238 3300014968 Ga0157379_10105052 Ga0157379_101050522 335
239 3300017792 Ga0163161_10260202 Ga0163161_102602022 335
240 3300025900 Ga0207710_10000164 Ga0207710_1000016463 335
241 3300025941 Ga0207711_10000196 Ga0207711_100001967 335
242 3300025941 Ga0207711_10007713 Ga0207711_100077133 335
243 3300025961 Ga0207712_10000029 Ga0207712_10000029164 335
244 3300025986 Ga0207658_10000113 Ga0207658_1000011329 335
245 3300026088 Ga0207641_10001920 Ga0207641_1000192017 335
246 3300028380 Ga0268265_10000040 Ga0268265_1000004016 335
247 3300028381 Ga0268264_10000017 Ga0268264_10000017207 335
248 3300035691 Ga0373931_0003427 Ga0373931_0003427_2361_3440 335
249 3300046522 Ga0495643_0134197 Ga0495643_0134197_41_1102 335
250 3300048903 Ga0496100_0003562 Ga0496100_0003562_1150_2196 335
251 3300048904 Ga0496101_0000209 Ga0496101_0000209_13052_14098 335
252 3300048904 Ga0496101_0018410 Ga0496101_0018410_3226_4239 335
253 3300048905 Ga0496102_0000014 Ga0496102_0000014_27831_28877 335
254 3300048905 Ga0496102_0000941 Ga0496102_0000941_974_1987 335
255 3300048906 Ga0496103_0000004 Ga0496103_0000004_28337_29383 335
256 3300048906 Ga0496103_0004615 Ga0496103_0004615_1533_2546 335
257 3300048919 Ga0496116_0000069 Ga0496116_0000069_29288_30334 335
258 3300048919 Ga0496116_0033265 Ga0496116_0033265_2350_3363 335
259 3300048920 Ga0496117_0000003 Ga0496117_0000003_1226740_1227786 335
260 3300048920 Ga0496117_0000160 Ga0496117_0000160_120221_121234 335
261 3300048921 Ga0496118_0000001 Ga0496118_0000001_1226743_1227789 335
262 3300048921 Ga0496118_0006093 Ga0496118_0006093_9882_11030 335
263 3300048921 Ga0496118_0013637 Ga0496118_0013637_4098_5111 335
264 3300048922 Ga0496119_0000262 Ga0496119_0000262_28878_29924 335
265 3300048922 Ga0496119_0003411 Ga0496119_0003411_7018_8166 335
266 3300048923 Ga0496120_0000085 Ga0496120_0000085_126403_127449 335
267 3300048924 Ga0496121_0000032 Ga0496121_0000032_117073_118119 335
268 3300048924 Ga0496121_0001187 Ga0496121_0001187_42578_43726 335
269 3300048924 Ga0496121_0011050 Ga0496121_0011050_4606_5619 335
270 3300048928 Ga0496125_0067371 Ga0496125_0067371_579_1592 335
271 3300048929 Ga0496126_0001225 Ga0496126_0001225_34662_35708 335
272 3300048929 Ga0496126_0120269 Ga0496126_0120269_497_1510 335
273 3300049823 Ga0501044_0243158 Ga0501044_0243158_82_1089 335
274 3300002773 JGI25152J39213_1000831 JGI25152J39213_10008316 336
275 3300003215 JGI25153J46596_10001274 JGI25153J46596_100012746 336
276 3300003316 rootH1_10154899 rootH1_101548992 336
277 3300003320 rootH2_10263809 rootH2_102638092 336
278 3300003322 rootL2_10029221 rootL2_100292216 336
279 3300003323 rootH1_10005689 rootH1_100056896 336
280 3300003323 rootH1_10022076 rootH1_100220762 336
281 3300003323 rootH1_10034663 rootH1_100346631 336
282 3300003771 Ga0055526_1000659 Ga0055526_100065929 336
283 3300003771 Ga0055526_1003216 Ga0055526_10032164 336
284 3300003775 Ga0055524_1000618 Ga0055524_10006189 336
285 3300003790 Ga0055528_1000602 Ga0055528_100060218 336
286 3300005262 Ga0065165_1001673 Ga0065165_100167314 336
287 3300005262 Ga0065165_1004517 Ga0065165_10045175 336
288 3300005563 Ga0068855_100167723 Ga0068855_1001677232 336
289 3300005563 Ga0068855_100214220 Ga0068855_1002142202 336
290 3300006195 Ga0075366_10038469 Ga0075366_100384693 336
291 3300006353 Ga0075370_10005538 Ga0075370_100055386 336
292 3300006844 Ga0075428_100069814 Ga0075428_1000698144 336
293 3300009036 Ga0105244_10028800 Ga0105244_100288002 336
294 3300021388 Ga0213875_10014757 Ga0213875_100147571 336
295 3300025242 Ga0209258_100311 Ga0209258_1003119 336
296 3300025245 Ga0207425_1000444 Ga0207425_100044424 336
297 3300025254 Ga0209148_1000163 Ga0209148_100016374 336
298 3300025258 Ga0209129_1000012 Ga0209129_100001287 336
299 3300025273 Ga0209673_1000475 Ga0209673_100047520 336
300 3300025294 Ga0209025_1021261 Ga0209025_10212612 336
301 3300025295 Ga0209564_1000022 Ga0209564_1000022427 336
302 3300025295 Ga0209564_1000496 Ga0209564_100049645 336
303 3300025297 Ga0209758_1000198 Ga0209758_1000198100 336
304 3300025298 Ga0209050_1000283 Ga0209050_100028336 336
305 3300025299 Ga0209256_1000439 Ga0209256_100043945 336
306 3300025299 Ga0209256_1013636 Ga0209256_10136362 336
307 3300025302 Ga0207426_1002028 Ga0207426_10020287 336
308 3300025303 Ga0209051_1033881 Ga0209051_10338812 336
309 3300025304 Ga0209257_1000013 Ga0209257_1000013286 336
310 3300025728 Ga0207655_1029708 Ga0207655_10297082 336
311 3300025735 Ga0207713_1027200 Ga0207713_10272001 336
312 3300025949 Ga0207667_10356777 Ga0207667_103567772 336
313 3300028577 Ga0265318_10004374 Ga0265318_100043749 336
314 3300028786 Ga0307517_10063754 Ga0307517_100637541 336
315 3300028794 Ga0307515_10006532 Ga0307515_1000653216 336
316 3300028794 Ga0307515_10189233 Ga0307515_101892332 336
317 3300030522 Ga0307512_10006223 Ga0307512_100062232 336
318 3300031235 Ga0265330_10002686 Ga0265330_100026869 336
319 3300031238 Ga0265332_10017136 Ga0265332_100171363 336
320 3300031239 Ga0265328_10060707 Ga0265328_100607072 336
321 3300031240 Ga0265320_10001020 Ga0265320_100010203 336
322 3300031242 Ga0265329_10006019 Ga0265329_100060193 336
323 3300031247 Ga0265340_10005110 Ga0265340_100051106 336
324 3300031250 Ga0265331_10039765 Ga0265331_100397653 336
325 3300031456 Ga0307513_10002122 Ga0307513_100021226 336
326 3300031456 Ga0307513_10168595 Ga0307513_101685952 336
327 3300031616 Ga0307508_10011219 Ga0307508_100112192 336
328 3300031649 Ga0307514_10080196 Ga0307514_100801962 336
329 3300031711 Ga0265314_10039874 Ga0265314_100398744 336
330 3300031712 Ga0265342_10019479 Ga0265342_100194792 336
331 3300031730 Ga0307516_10180039 Ga0307516_101800391 336
332 3300037418 Ga0395900_0202467 Ga0395900_0202467_666_1730 336
333 3300037853 Ga0436364_0697584 Ga0436364_0697584_31_1041 336
334 3300046455 Ga0495603_0000169 Ga0495603_0000169_1215_2279 336
335 3300046463 Ga0495653_0000002 Ga0495653_0000002_225788_226858 336
336 3300046501 Ga0495607_0000101 Ga0495607_0000101_87482_88495 336
337 3300046507 Ga0495606_0000566 Ga0495606_0000566_28830_29900 336
338 3300046615 Ga0495656_0089374 Ga0495656_0089374_162_1226 336
339 3300046648 Ga0495611_0020635 Ga0495611_0020635_1455_2519 336
340 3300046691 Ga0495670_0080785 Ga0495670_0080785_274_1338 336
341 3300047323 Ga0495683_0115809 Ga0495683_0115809_71_1135 336
342 3300048904 Ga0496101_0021376 Ga0496101_0021376_1436_2467 336
343 3300048906 Ga0496103_0004108 Ga0496103_0004108_718_1728 336
344 3300048908 Ga0496105_0138936 Ga0496105_0138936_798_1808 336
345 3300048909 Ga0496106_0107568 Ga0496106_0107568_70_1080 336
346 3300048924 Ga0496121_0038495 Ga0496121_0038495_2817_3878 336
347 3300048924 Ga0496121_0063135 Ga0496121_0063135_1372_2391 336
348 3300048924 Ga0496121_0107825 Ga0496121_0107825_191_1213 336
349 3300048928 Ga0496125_0135446 Ga0496125_0135446_239_1258 336
350 3300048929 Ga0496126_0018246 Ga0496126_0018246_4297_5328 336
351 3300050493 nmdc:mga0k408_100422_c1 nmdc:mga0k408_100422_c1_228_1340 336
352 3300050496 nmdc:mga07m45_26197_c1 nmdc:mga07m45_26197_c1_235_1347 336
353 3300050507 nmdc:mga05p37_96407_c1 nmdc:mga05p37_96407_c1_2316_3326 336
354 3300053086 Ga0500578_0000086 Ga0500578_0000086_35545_36564 336
355 3300053088 Ga0500644_0013968 Ga0500644_0013968_614_1624 336
356 3300053090 Ga0500646_0038188 Ga0500646_0038188_273_1283 336
357 3300053096 Ga0500641_0037984 Ga0500641_0037984_627_1637 336
358 3300053098 Ga0500650_0137366 Ga0500650_0137366_60_1070 336
359 3300053103 Ga0500555_031630 Ga0500555_031630_364_1377 336
360 3300053109 Ga0500569_000537 Ga0500569_000537_678_1721 336
361 3300053118 Ga0500594_0018230 Ga0500594_0018230_451_1461 336
362 3300053131 Ga0500652_043523 Ga0500652_043523_133_1143 336
363 3300053134 Ga0500658_0000826 Ga0500658_0000826_2127_3170 336
364 3300053142 Ga0500577_0041869 Ga0500577_0041869_31_1074 336
365 3300053156 Ga0500622_0000051 Ga0500622_0000051_82468_83511 336
366 3300053177 Ga0500636_0037856 Ga0500636_0037856_1621_2643 336
367 iso_pu_bacteria 2643221609 2644061744 336
368 iso_pu_bacteria 2643221611 2644070950 336
369 iso_pu_bacteria 2857576091 2857576948 336
370 iso_pu_bacteria 2862382967 2862384976 336
371 iso_pu_bacteria 2912723979 2912727930 336
372 iso_pu_bacteria 2929921140 2929924086 336
373 3300001990 JGI24737J22298_10032508 JGI24737J22298_100325082 337
374 3300005347 Ga0070668_100221985 Ga0070668_1002219852 337
375 3300005844 Ga0068862_100195882 Ga0068862_1001958822 337
376 3300025904 Ga0207647_10007912 Ga0207647_100079128 337
377 3300025972 Ga0207668_10230906 Ga0207668_102309061 337
378 3300025986 Ga0207658_10338499 Ga0207658_103384992 337
379 3300028794 Ga0307515_10316683 Ga0307515_103166831 337
380 3300031507 Ga0307509_10000047 Ga0307509_1000004791 337
381 3300053104 Ga0500556_0000991 Ga0500556_0000991_1210_2235 337
382 3300053153 Ga0500616_0003944 Ga0500616_0003944_8752_9777 337

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13602

ADH_zinc_N_2

Zinc-binding dehydrogenase

259

379

0.87

PF08240

ADH_N

Alcohol dehydrogenase GroES-like domain

78

173

0.84

PF00107

ADH_zinc_N

Zinc-binding dehydrogenase

228

341

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ide-assembly1.cif.gz_A structure of the fragaria x ananassa enone oxidoreductase in complex with nadp+ and edhmf 0.9172 1 335
3tqh-assembly1.cif.gz_A structure of the quinone oxidoreductase from coxiella burnetii 0.8942 4 337
3tqh-assembly1.cif.gz_A structure of the quinone oxidoreductase from coxiella burnetii 0.8914 4 337
4ide-assembly1.cif.gz_A structure of the fragaria x ananassa enone oxidoreductase in complex with nadp+ and edhmf 0.8869 1 335
5a3j-assembly8.cif.gz_H crystal structure of the chloroplastic gamma-ketol reductase from arabidopsis thaliana bound to 13-oxo-9(z),11(e),15(z)- octadecatrienoic acid. 0.8816 4 335
ID Description Score Start End Superfamily
4a27B01 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9391 4 135 3.90.180.10
af_O45496_9_126_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9389 6 131 3.90.180.10
af_M0R3N4_1_117_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9384 6 131 3.90.180.10
af_A0A0R0I1N1_1_153_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9361 6 151 3.90.180.10
af_A0A0P0W924_2_174_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.935 20 148 3.90.180.10
ID Description Score Start End GO Terms
AF-B6A117-F1-model_v4 deleted 0.9864 6 337
AF-A0A8B4TPP6-F1-model_v4 Bifunctional zinc-containing alcohol dehydrogenase/quinone oxidoreductase (EC 1.6.5.5) 0.9792 1 323 GO:0008270
GO:0016491
AF-B6A117-F1-model_v4 deleted 0.9777 6 337
AF-A0A7Y2W8E6-F1-model_v4 NADP-dependent oxidoreductase 0.9755 67 337 GO:0016491
AF-A0A4Q5QYW0-F1-model_v4 NADP-dependent oxidoreductase 0.9713 43 336 GO:0008270
GO:0016491

Feature Viewer

pLDDT pTM Quality
94.4 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map