F429353

General Info

Members Datasets Scaffolds Average Seq Length
382 220 764 173

Family's Representative Sequence

Representative Sequence 3300042015|Ga0439462_0084124|Ga0439462_0084124_159_668
Length 163
Sequence MIQKKVCMVGLFATGKTSLVRRFVDSLFSERYLSTVGVKIDRKALEVDGTSLTLVLWDLAGRDGHEDITASYLRGSHAVLYVADGTRRETCDQLPELRAIVRDAAGALNKSDLTDRWALAGGDEQALAQEWDMVRTSAKTGVGVEDAFQRIGRAMLGTKEARP

Samples

Sample ID Description Type Environment
1 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
58 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
62 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
63 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
64 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
65 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
66 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
78 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
79 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
80 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
86 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
87 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
88 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
89 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
90 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
137 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
141 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
142 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
143 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
144 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
145 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
146 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
147 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
148 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
149 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
150 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
151 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
152 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
153 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
154 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
155 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
156 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
157 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
158 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
159 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
160 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
161 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
162 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
163 3300038698 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot15 Metagenome Rhizosphere
164 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
165 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
166 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
167 3300042123 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 Metagenome Rhizosphere
168 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
169 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
170 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
171 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
172 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
173 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
174 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
175 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
176 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
177 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
178 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
179 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
180 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
181 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
182 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
183 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
191 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
192 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
193 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
194 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
195 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
196 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
197 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
198 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
199 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
200 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
201 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
202 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
203 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
204 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
205 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
206 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
207 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
208 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
209 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
210 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
211 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
212 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
213 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
214 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
215 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
216 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
217 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
218 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
219 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
220 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.88
Rhizosphere 96.86
Stem 0
Stem Tuber 0
Unclassified 30.63

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0439462_0084124 3300042015 Bacteria 870
2 Ga0065712_10212817 3300005290 Bacteria 1067
3 Ga0065712_10249986 3300005290 Bacteria 960
4 Ga0065712_10536121 3300005290 Bacteria 626
5 Ga0070658_10558394 3300005327 Unclassified 991
6 Ga0070658_10775043 3300005327 Bacteria 833
7 Ga0070676_10050782 3300005328 Bacteria 2432
8 Ga0070676_10263410 3300005328 Bacteria 1155
9 Ga0070683_100012725 3300005329 Bacteria 7317
10 Ga0070690_100111779 3300005330 Unclassified 1824
11 Ga0070670_100018689 3300005331 Bacteria 5941
12 Ga0070670_100027753 3300005331 Bacteria 4870
13 Ga0070670_100109179 3300005331 Bacteria 2384
14 Ga0070677_10087332 3300005333 Bacteria 1349
15 Ga0068869_100038204 3300005334 Unclassified 3419
16 Ga0068869_100167845 3300005334 Unclassified 1713
17 Ga0070666_10801469 3300005335 Unclassified 694
18 Ga0068868_100002806 3300005338 Bacteria 12071
19 Ga0070660_100034032 3300005339 Unclassified 3847
20 Ga0070660_100217423 3300005339 Unclassified 1553
21 Ga0070689_100218525 3300005340 Bacteria 1562
22 Ga0070689_100826900 3300005340 Bacteria 816
23 Ga0070661_100019612 3300005344 Bacteria 4819
24 Ga0070661_100102923 3300005344 Bacteria 2126
25 Ga0070661_101442965 3300005344 Viruses 579
26 Ga0070668_100003238 3300005347 Bacteria 11999
27 Ga0070668_101137855 3300005347 Bacteria 705
28 Ga0070668_101216483 3300005347 Bacteria 683
29 Ga0070669_100054870 3300005353 Unclassified 2919
30 Ga0070669_100193407 3300005353 Bacteria 1597
31 Ga0070675_100025133 3300005354 Bacteria 4773
32 Ga0070675_100931794 3300005354 Bacteria 797
33 Ga0070671_100062210 3300005355 Bacteria 3109
34 Ga0070671_100196097 3300005355 Unclassified 1712
35 Ga0070674_100028466 3300005356 Bacteria 3670
36 Ga0070674_100907598 3300005356 Bacteria 768
37 Ga0070674_101054111 3300005356 Unclassified 716
38 Ga0070673_100078462 3300005364 Viruses 2671
39 Ga0070673_100210757 3300005364 Unclassified 1678
40 Ga0070673_101374888 3300005364 Unclassified 664
41 Ga0070688_100162203 3300005365 Unclassified 1537
42 Ga0070688_100227689 3300005365 Bacteria 1317
43 Ga0070659_100007117 3300005366 Bacteria 8115
44 Ga0070659_100035922 3300005366 Unclassified 3861
45 Ga0070659_100119638 3300005366 Unclassified 2132
46 Ga0070659_100121410 3300005366 Unclassified 2117
47 Ga0070667_100951019 3300005367 Unclassified 801
48 Ga0070701_10110225 3300005438 Unclassified 1537
49 Ga0070701_10437394 3300005438 Unclassified 837
50 Ga0070705_100027596 3300005440 Unclassified 3102
51 Ga0070700_100081985 3300005441 Bacteria 2085
52 Ga0070700_100378551 3300005441 Unclassified 1058
53 Ga0070694_100063053 3300005444 Unclassified 2533
54 Ga0070694_100076182 3300005444 Bacteria 2322
55 Ga0070708_100145468 3300005445 Bacteria 2201
56 Ga0070678_101327460 3300005456 Bacteria 670
57 Ga0070662_100002938 3300005457 Bacteria 10602
58 Ga0070681_10053533 3300005458 Bacteria 4022
59 Ga0070681_10114002 3300005458 Bacteria 2642
60 Ga0070681_10155555 3300005458 Unclassified 2211
61 Ga0068867_100180416 3300005459 Unclassified 1678
62 Ga0070685_10153666 3300005466 Unclassified 1460
63 Ga0070706_100136108 3300005467 Bacteria 2293
64 Ga0070707_100010496 3300005468 Bacteria 8629
65 Ga0070707_100334743 3300005468 Bacteria 1471
66 Ga0070698_100000173 3300005471 Bacteria 60217
67 Ga0070698_100014759 3300005471 Bacteria 8253
68 Ga0070699_100000024 3300005518 Bacteria 161189
69 Ga0070699_101177946 3300005518 Unclassified 703
70 Ga0070679_100017905 3300005530 Bacteria 6862
71 Ga0070684_100003493 3300005535 Bacteria 11803
72 Ga0068853_101206737 3300005539 Bacteria 730
73 Ga0070672_100004669 3300005543 Bacteria 8983
74 Ga0070672_100017666 3300005543 Bacteria 5138
75 Ga0070672_100714652 3300005543 Unclassified 878
76 Ga0070686_100159180 3300005544 Bacteria 1589
77 Ga0070696_100222343 3300005546 Bacteria 1417
78 Ga0070693_100061115 3300005547 Bacteria 2189
79 Ga0070665_100198592 3300005548 Bacteria 2006
80 Ga0070704_100001719 3300005549 Bacteria 11939
81 Ga0070704_101039943 3300005549 Viruses 742
82 Ga0068855_100243036 3300005563 Bacteria 2011
83 Ga0068855_100663003 3300005563 Bacteria 1119
84 Ga0070664_100009511 3300005564 Bacteria 7881
85 Ga0070664_100393027 3300005564 Bacteria 1267
86 Ga0070664_100885819 3300005564 Bacteria 836
87 Ga0068857_100001520 3300005577 Bacteria 18526
88 Ga0068857_100158146 3300005577 Bacteria 2055
89 Ga0068857_101052536 3300005577 Bacteria 784
90 Ga0068854_100377719 3300005578 Bacteria 1167
91 Ga0068854_100435767 3300005578 Bacteria 1091
92 Ga0070702_100060320 3300005615 Bacteria 2205
93 Ga0070702_100745820 3300005615 Bacteria 751
94 Ga0068852_100016269 3300005616 Bacteria 5794
95 Ga0068852_100424370 3300005616 Unclassified 1312
96 Ga0068859_100175183 3300005617 Bacteria 2227
97 Ga0068859_100205263 3300005617 Unclassified 2056
98 Ga0068859_102404940 3300005617 Viruses 580
99 Ga0068864_100036309 3300005618 Unclassified 4200
100 Ga0068864_100173388 3300005618 Bacteria 1968
101 Ga0068866_10007979 3300005718 Unclassified 4446
102 Ga0068861_100022519 3300005719 Bacteria 4541
103 Ga0068861_100334578 3300005719 Bacteria 1323
104 Ga0068851_10015944 3300005834 Unclassified 3587
105 Ga0068851_10043131 3300005834 Unclassified 2273
106 Ga0068870_10487719 3300005840 Bacteria 819
107 Ga0068863_100394978 3300005841 Unclassified 1352
108 Ga0068862_100099733 3300005844 Unclassified 2539
109 Ga0081539_10156618 3300005985 Bacteria 1090
110 Ga0070712_100131960 3300006175 Bacteria 1894
111 Ga0075428_100059197 3300006844 Unclassified 4195
112 Ga0075428_100992262 3300006844 Bacteria 889
113 Ga0075428_101383461 3300006844 Unclassified 739
114 Ga0075430_100088668 3300006846 Bacteria 2589
115 Ga0075430_100097789 3300006846 Unclassified 2452
116 Ga0075430_100564291 3300006846 Bacteria 939
117 Ga0075431_100014375 3300006847 Bacteria 8005
118 Ga0075431_100433011 3300006847 Bacteria 1313
119 Ga0075431_100858730 3300006847 Bacteria 879
120 Ga0075431_100951927 3300006847 Unclassified 827
121 Ga0075433_10195810 3300006852 Unclassified 1798
122 Ga0075434_100007263 3300006871 Bacteria 10250
123 Ga0075434_100038856 3300006871 Unclassified 4715
124 Ga0075434_100827280 3300006871 Bacteria 942
125 Ga0075429_100008052 3300006880 Bacteria 9163
126 Ga0075429_100084014 3300006880 Bacteria 2775
127 Ga0075429_100302300 3300006880 Bacteria 1401
128 Ga0068865_100004524 3300006881 Bacteria 8390
129 Ga0097620_100175182 3300006931 Bacteria 2227
130 Ga0097620_100205264 3300006931 Unclassified 2056
131 Ga0097620_102404887 3300006931 Viruses 580
132 Ga0111539_10278972 3300009094 Bacteria 1945
133 Ga0111539_10425715 3300009094 Bacteria 1546
134 Ga0111539_10612331 3300009094 Bacteria 1268
135 Ga0111539_10680104 3300009094 Unclassified 1198
136 Ga0105245_11487889 3300009098 Unclassified 728
137 Ga0114129_10022193 3300009147 Bacteria 9011
138 Ga0114129_10070761 3300009147 Bacteria 4864
139 Ga0114129_10146179 3300009147 Unclassified 3239
140 Ga0114129_10323417 3300009147 Bacteria 2050
141 Ga0114129_11093091 3300009147 Bacteria 999
142 Ga0114129_11869463 3300009147 Bacteria 729
143 Ga0105248_10043474 3300009177 Bacteria 5037
144 Ga0105248_10715978 3300009177 Bacteria 1129
145 Ga0105237_10640795 3300009545 Unclassified 1069
146 Ga0105249_10036254 3300009553 Unclassified 4474
147 Ga0105239_10096718 3300010375 Unclassified 3262
148 Ga0157371_10294010 3300013102 Bacteria 1175
149 Ga0157369_10128458 3300013105 Bacteria 2686
150 Ga0157374_10120928 3300013296 Unclassified 2527
151 Ga0157374_10123495 3300013296 Bacteria 2501
152 Ga0157378_10082219 3300013297 Bacteria 2912
153 Ga0157378_10492778 3300013297 Bacteria 1223
154 Ga0163162_10004488 3300013306 Bacteria 13448
155 Ga0163162_11181667 3300013306 Unclassified 868
156 Ga0157372_10174231 3300013307 Unclassified 2490
157 Ga0157375_10191901 3300013308 Unclassified 2198
158 Ga0157375_10461572 3300013308 Bacteria 1435
159 Ga0157375_11212609 3300013308 Unclassified 885
160 Ga0157380_10060418 3300014326 Unclassified 3029
161 Ga0157380_10289022 3300014326 Unclassified 1504
162 Ga0157379_10691292 3300014968 Bacteria 957
163 Ga0157376_10771360 3300014969 Unclassified 972
164 Ga0182005_1022947 3300015265 Unclassified 1707
165 Ga0163161_10057824 3300017792 Bacteria 2818
166 Ga0207697_10008769 3300025315 Unclassified 4403
167 Ga0207656_10006043 3300025321 Bacteria 4330
168 Ga0207642_10212211 3300025899 Bacteria 1076
169 Ga0207680_10118484 3300025903 Bacteria 1728
170 Ga0207647_10027037 3300025904 Bacteria 3745
171 Ga0207645_10003648 3300025907 Bacteria 11614
172 Ga0207643_10223441 3300025908 Bacteria 1153
173 Ga0207705_10562323 3300025909 Bacteria 887
174 Ga0207705_10755578 3300025909 Unclassified 755
175 Ga0207707_10048354 3300025912 Bacteria 3705
176 Ga0207707_10156866 3300025912 Bacteria 1990
177 Ga0207693_10211949 3300025915 Bacteria 1523
178 Ga0207662_10122891 3300025918 Bacteria 1629
179 Ga0207657_10037268 3300025919 Bacteria 4343
180 Ga0207657_10132667 3300025919 Unclassified 2040
181 Ga0207649_10002664 3300025920 Bacteria 9904
182 Ga0207649_10023200 3300025920 Bacteria 3591
183 Ga0207649_10166125 3300025920 Bacteria 1533
184 Ga0207652_10038031 3300025921 Unclassified 4076
185 Ga0207646_10224096 3300025922 Unclassified 1698
186 Ga0207646_10695806 3300025922 Unclassified 909
187 Ga0207681_10178974 3300025923 Bacteria 1614
188 Ga0207681_10766979 3300025923 Unclassified 805
189 Ga0207650_10051520 3300025925 Unclassified 3046
190 Ga0207659_10070986 3300025926 Unclassified 2541
191 Ga0207659_10280283 3300025926 Unclassified 1362
192 Ga0207644_10098110 3300025931 Archaea 2196
193 Ga0207644_10646751 3300025931 Unclassified 880
194 Ga0207690_10162463 3300025932 Bacteria 1666
195 Ga0207706_10060202 3300025933 Bacteria 3344
196 Ga0207686_10084929 3300025934 Bacteria 2075
197 Ga0207686_10110642 3300025934 Unclassified 1852
198 Ga0207669_10030309 3300025937 Unclassified 3005
199 Ga0207669_10079989 3300025937 Bacteria 2089
200 Ga0207691_10001668 3300025940 Bacteria 21968
201 Ga0207691_10008122 3300025940 Bacteria 10076
202 Ga0207691_10063172 3300025940 Bacteria 3359
203 Ga0207711_10350671 3300025941 Bacteria 1366
204 Ga0207689_10010905 3300025942 Bacteria 7815
205 Ga0207661_10016085 3300025944 Bacteria 5514
206 Ga0207661_10045605 3300025944 Bacteria 3471
207 Ga0207661_10189133 3300025944 Bacteria 1804
208 Ga0207679_10012175 3300025945 Bacteria 5601
209 Ga0207679_10225905 3300025945 Bacteria 1578
210 Ga0207667_10666909 3300025949 Bacteria 1044
211 Ga0207712_10008414 3300025961 Bacteria 6520
212 Ga0207712_10083740 3300025961 Unclassified 2328
213 Ga0207668_10009094 3300025972 Bacteria 5938
214 Ga0207668_10045742 3300025972 Bacteria 2987
215 Ga0207640_10280911 3300025981 Bacteria 1308
216 Ga0207658_10250480 3300025986 Bacteria 1505
217 Ga0207677_10188223 3300026023 Bacteria 1630
218 Ga0207639_10078320 3300026041 Unclassified 2608
219 Ga0207708_10085115 3300026075 Bacteria 2432
220 Ga0207708_10409862 3300026075 Unclassified 1122
221 Ga0207641_10165630 3300026088 Bacteria 2013
222 Ga0207648_10025486 3300026089 Bacteria 5266
223 Ga0207648_10127095 3300026089 Bacteria 2243
224 Ga0207648_10180413 3300026089 Bacteria 1869
225 Ga0207676_10173502 3300026095 Bacteria 1881
226 Ga0207676_10176544 3300026095 Bacteria 1866
227 Ga0207676_10332536 3300026095 Bacteria 1399
228 Ga0207676_10710330 3300026095 Bacteria 975
229 Ga0207674_10000247 3300026116 Bacteria 67328
230 Ga0207674_10000740 3300026116 Bacteria 42740
231 Ga0207674_10061741 3300026116 Bacteria 3786
232 Ga0207675_100000677 3300026118 Bacteria 33529
233 Ga0207683_10168675 3300026121 Unclassified 1982
234 Ga0207698_10199773 3300026142 Unclassified 1789
235 Ga0207698_10333306 3300026142 Bacteria 1426
236 Ga0209983_1024136 3300027665 Unclassified 1279
237 Ga0209971_1036513 3300027682 Unclassified 1183
238 Ga0209974_10049188 3300027876 Unclassified 1414
239 Ga0207428_10783012 3300027907 Unclassified 678
240 Ga0268266_10096142 3300028379 Unclassified 2603
241 Ga0268266_11123688 3300028379 Unclassified 760
242 Ga0268265_10018203 3300028380 Bacteria 4865
243 Ga0268264_10121171 3300028381 Bacteria 2305
244 Ga0307408_100064675 3300031548 Bacteria 2680
245 Ga0307408_100189009 3300031548 Bacteria 1658
246 Ga0307405_10008092 3300031731 Bacteria 5308
247 Ga0307405_10226800 3300031731 Bacteria 1374
248 Ga0307413_10007041 3300031824 Bacteria 5186
249 Ga0307413_10137523 3300031824 Unclassified 1682
250 Ga0307413_10178557 3300031824 Bacteria 1511
251 Ga0307413_10279932 3300031824 Unclassified 1254
252 Ga0307410_10024852 3300031852 Bacteria 3748
253 Ga0307410_10025526 3300031852 Bacteria 3709
254 Ga0307410_10063827 3300031852 Bacteria 2528
255 Ga0307410_10084103 3300031852 Bacteria 2242
256 Ga0307410_10133743 3300031852 Unclassified 1825
257 Ga0307406_10050409 3300031901 Bacteria 2639
258 Ga0307406_10150521 3300031901 Bacteria 1659
259 Ga0307406_10265416 3300031901 Bacteria 1301
260 Ga0307406_10348339 3300031901 Unclassified 1156
261 Ga0307407_10201681 3300031903 Bacteria 1333
262 Ga0307407_10272318 3300031903 Bacteria 1169
263 Ga0307412_10609444 3300031911 Unclassified 926
264 Ga0307409_100009716 3300031995 Bacteria 5931
265 Ga0307409_100132470 3300031995 Bacteria 2133
266 Ga0307409_100461246 3300031995 Bacteria 1228
267 Ga0307409_100678648 3300031995 Bacteria 1027
268 Ga0307416_100016854 3300032002 Bacteria 5092
269 Ga0307416_100081475 3300032002 Bacteria 2737
270 Ga0307416_100197451 3300032002 Bacteria 1905
271 Ga0307416_100267957 3300032002 Bacteria 1674
272 Ga0307416_100383508 3300032002 Bacteria 1436
273 Ga0307414_10011495 3300032004 Bacteria 5194
274 Ga0307414_10218178 3300032004 Unclassified 1564
275 Ga0307414_10589776 3300032004 Unclassified 995
276 Ga0307414_10613140 3300032004 Unclassified 977
277 Ga0307414_10719222 3300032004 Unclassified 905
278 Ga0307411_10010424 3300032005 Bacteria 4954
279 Ga0307411_10019208 3300032005 Bacteria 3943
280 Ga0307411_10061179 3300032005 Bacteria 2505
281 Ga0307411_10278155 3300032005 Bacteria 1331
282 Ga0307411_10469268 3300032005 Unclassified 1057
283 Ga0307411_10485895 3300032005 Bacteria 1041
284 Ga0307415_100065204 3300032126 Bacteria 2537
285 Ga0307415_100372029 3300032126 Bacteria 1210
286 Ga0307415_101478843 3300032126 Archaea 649
287 Ga0373930_0023895 3300034816 Bacteria 1218
288 Ga0373948_0039868 3300034817 Unclassified 979
289 Ga0373929_0029750 3300035085 Bacteria 1161
290 Ga0373949_0066628 3300035090 Unclassified 936
291 Ga0373923_0235027 3300035111 Unclassified 855
292 Ga0373939_0031464 3300035114 Unclassified 1534
293 Ga0373941_0008681 3300035115 Bacteria 2533
294 Ga0373960_0124725 3300035121 Bacteria 858
295 Ga0373943_0185077 3300035170 Unclassified 1146
296 Ga0373924_0208237 3300035410 Unclassified 863
297 Ga0395905_0295459 3300037471 Unclassified 1507
298 Ga0395905_0726011 3300037471 Bacteria 896
299 Ga0242419_014853 3300038698 Bacteria 623
300 Ga0242420_058631 3300038996 Bacteria 764
301 Ga0451853_2571509 3300041512 Bacteria 738
302 Ga0439457_099956 3300042014 Unclassified 676
303 Ga0439462_0072458 3300042015 Bacteria 936
304 Ga0450921_004780 3300042123 Bacteria 1003
305 Ga0450891_024365 3300042129 Archaea 607
306 Ga0450898_031456 3300042134 Bacteria 975
307 Ga0439446_0296971 3300042156 Bacteria 566
308 Ga0451577_0220169 3300042876 Bacteria 1716
309 Ga0451576_0961396 3300045051 Bacteria 895
310 Ga0451576_1068251 3300045051 Unclassified 845
311 Ga0495585_0351847 3300046492 Bacteria 716
312 Ga0495647_0139993 3300046681 Unclassified 1031
313 Ga0495581_0105237 3300047315 Unclassified 1640
314 Ga0496104_0071978 3300048907 Bacteria 3287
315 Ga0496108_0011614 3300048911 Bacteria 7164
316 Ga0496108_0161167 3300048911 Bacteria 1939
317 Ga0496109_0189722 3300048912 Bacteria 1931
318 Ga0496109_0191683 3300048912 Bacteria 1921
319 Ga0496110_0078516 3300048913 Bacteria 2939
320 Ga0496111_0061510 3300048914 Bacteria 2722
321 Ga0496112_0008903 3300048915 Bacteria 9009
322 Ga0496112_0312189 3300048915 Unclassified 1517
323 Ga0496113_0004355 3300048916 Bacteria 8680
324 Ga0496113_0233159 3300048916 Bacteria 1468
325 Ga0501031_0198579 3300049568 Bacteria 1309
326 Ga0501038_0659029 3300049574 Bacteria 787
327 Ga0501041_0031809 3300049577 Bacteria 3190
328 Ga0501041_0078159 3300049577 Bacteria 2036
329 Ga0501042_0053395 3300049578 Bacteria 2883
330 Ga0501043_0114053 3300049579 Bacteria 2122
331 Ga0501046_0113680 3300049580 Bacteria 2066
332 Ga0501046_0523935 3300049580 Bacteria 847
333 Ga0501048_0899148 3300049582 Unclassified 637
334 Ga0501067_0041682 3300049583 Unclassified 2549
335 Ga0501068_0161161 3300049584 Bacteria 1414
336 Ga0501070_0354055 3300049586 Bacteria 1191
337 Ga0501071_0015959 3300049587 Bacteria 5160
338 Ga0501071_0653154 3300049587 Bacteria 809
339 Ga0501074_0035744 3300049590 Bacteria 3600
340 Ga0501075_0013181 3300049591 Bacteria 5895
341 Ga0501076_0164870 3300049592 Bacteria 1806
342 Ga0501076_0757147 3300049592 Bacteria 801
343 Ga0501077_0001629 3300049593 Bacteria 13488
344 Ga0501077_0127581 3300049593 Unclassified 1612
345 Ga0501217_029830 3300049661 Bacteria 1336
346 Ga0501233_070293 3300049668 Bacteria 886
347 Ga0501235_146221 3300049669 Bacteria 609
348 Ga0501253_098356 3300049683 Unclassified 683
349 Ga0501259_006281 3300049688 Bacteria 1889
350 Ga0501225_0085330 3300049705 Bacteria 910
351 Ga0501079_0050519 3300049741 Bacteria 3210
352 Ga0501080_0035233 3300049742 Bacteria 4672
353 Ga0501081_0012986 3300049743 Bacteria 5479
354 Ga0501081_0972500 3300049743 Unclassified 641
355 Ga0501083_0152350 3300049744 Bacteria 1514
356 Ga0501083_0747308 3300049744 Unclassified 636
357 Ga0501045_0067168 3300049824 Bacteria 2633
358 nmdc:mga05p37_31364_c1 3300050507 Bacteria 5633
359 nmdc:mga05p37_64252_c1 3300050507 Bacteria 4516
360 nmdc:mga09592_114989_c1 3300050508 Unclassified 2309
361 nmdc:mga09592_319951_c1 3300050508 Archaea 1344
362 nmdc:mga09592_705571_c1 3300050508 Unclassified 858
363 nmdc:mga0qj67_157476_c1 3300050509 Bacteria 1844
364 nmdc:mga06r32_29597_c1 3300050510 Bacteria 5134
365 nmdc:mga06r32_423072_c1 3300050510 Bacteria 1313
366 nmdc:mga06r32_741095_c1 3300050510 Unclassified 946
367 nmdc:mga08y16_118194_c1 3300050511 Bacteria 2759
368 nmdc:mga08y16_1760206_c1 3300050511 Unclassified 574
369 nmdc:mga08y16_85893_c1 3300050511 Bacteria 3279
370 nmdc:mga0n895_32951_c1 3300050512 Unclassified 4976
371 nmdc:mga0n895_7425_c1 3300050512 Bacteria 9405
372 nmdc:mga0a205_1832_c1 3300050515 Bacteria 8561
373 nmdc:mga0a205_19482_c1 3300050515 Unclassified 1870
374 Ga0501084_0016335 3300054114 Bacteria 6165
375 Ga0501084_0039748 3300054114 Bacteria 3934
376 Ga0501084_0952689 3300054114 Bacteria 722
377 Ga0590071_000598 3300059421 Bacteria 10346
378 Ga0590071_040389 3300059421 Unclassified 1122
379 Ga0590075_021430 3300059424 Unclassified 1613
380 Ga0501082_0079004 3300060353 Bacteria 2838
381 Ga0501082_0319337 3300060353 Bacteria 1353
382 Ga0530510_0566030 3300061734 Bacteria 863
383 Ga0439462_0084124
384 Ga0065712_10212817
385 Ga0065712_10249986
386 Ga0065712_10536121
387 Ga0070658_10558394
388 Ga0070658_10775043
389 Ga0070676_10050782
390 Ga0070676_10263410
391 Ga0070683_100012725
392 Ga0070690_100111779
393 Ga0070670_100018689
394 Ga0070670_100027753
395 Ga0070670_100109179
396 Ga0070677_10087332
397 Ga0068869_100038204
398 Ga0068869_100167845
399 Ga0070666_10801469
400 Ga0068868_100002806
401 Ga0070660_100034032
402 Ga0070660_100217423
403 Ga0070689_100218525
404 Ga0070689_100826900
405 Ga0070661_100019612
406 Ga0070661_100102923
407 Ga0070661_101442965
408 Ga0070668_100003238
409 Ga0070668_101137855
410 Ga0070668_101216483
411 Ga0070669_100054870
412 Ga0070669_100193407
413 Ga0070675_100025133
414 Ga0070675_100931794
415 Ga0070671_100062210
416 Ga0070671_100196097
417 Ga0070674_100028466
418 Ga0070674_100907598
419 Ga0070674_101054111
420 Ga0070673_100078462
421 Ga0070673_100210757
422 Ga0070673_101374888
423 Ga0070688_100162203
424 Ga0070688_100227689
425 Ga0070659_100007117
426 Ga0070659_100035922
427 Ga0070659_100119638
428 Ga0070659_100121410
429 Ga0070667_100951019
430 Ga0070701_10110225
431 Ga0070701_10437394
432 Ga0070705_100027596
433 Ga0070700_100081985
434 Ga0070700_100378551
435 Ga0070694_100063053
436 Ga0070694_100076182
437 Ga0070708_100145468
438 Ga0070678_101327460
439 Ga0070662_100002938
440 Ga0070681_10053533
441 Ga0070681_10114002
442 Ga0070681_10155555
443 Ga0068867_100180416
444 Ga0070685_10153666
445 Ga0070706_100136108
446 Ga0070707_100010496
447 Ga0070707_100334743
448 Ga0070698_100000173
449 Ga0070698_100014759
450 Ga0070699_100000024
451 Ga0070699_101177946
452 Ga0070679_100017905
453 Ga0070684_100003493
454 Ga0068853_101206737
455 Ga0070672_100004669
456 Ga0070672_100017666
457 Ga0070672_100714652
458 Ga0070686_100159180
459 Ga0070696_100222343
460 Ga0070693_100061115
461 Ga0070665_100198592
462 Ga0070704_100001719
463 Ga0070704_101039943
464 Ga0068855_100243036
465 Ga0068855_100663003
466 Ga0070664_100009511
467 Ga0070664_100393027
468 Ga0070664_100885819
469 Ga0068857_100001520
470 Ga0068857_100158146
471 Ga0068857_101052536
472 Ga0068854_100377719
473 Ga0068854_100435767
474 Ga0070702_100060320
475 Ga0070702_100745820
476 Ga0068852_100016269
477 Ga0068852_100424370
478 Ga0068859_100175183
479 Ga0068859_100205263
480 Ga0068859_102404940
481 Ga0068864_100036309
482 Ga0068864_100173388
483 Ga0068866_10007979
484 Ga0068861_100022519
485 Ga0068861_100334578
486 Ga0068851_10015944
487 Ga0068851_10043131
488 Ga0068870_10487719
489 Ga0068863_100394978
490 Ga0068862_100099733
491 Ga0081539_10156618
492 Ga0070712_100131960
493 Ga0075428_100059197
494 Ga0075428_100992262
495 Ga0075428_101383461
496 Ga0075430_100088668
497 Ga0075430_100097789
498 Ga0075430_100564291
499 Ga0075431_100014375
500 Ga0075431_100433011
501 Ga0075431_100858730
502 Ga0075431_100951927
503 Ga0075433_10195810
504 Ga0075434_100007263
505 Ga0075434_100038856
506 Ga0075434_100827280
507 Ga0075429_100008052
508 Ga0075429_100084014
509 Ga0075429_100302300
510 Ga0068865_100004524
511 Ga0097620_100175182
512 Ga0097620_100205264
513 Ga0097620_102404887
514 Ga0111539_10278972
515 Ga0111539_10425715
516 Ga0111539_10612331
517 Ga0111539_10680104
518 Ga0105245_11487889
519 Ga0114129_10022193
520 Ga0114129_10070761
521 Ga0114129_10146179
522 Ga0114129_10323417
523 Ga0114129_11093091
524 Ga0114129_11869463
525 Ga0105248_10043474
526 Ga0105248_10715978
527 Ga0105237_10640795
528 Ga0105249_10036254
529 Ga0105239_10096718
530 Ga0157371_10294010
531 Ga0157369_10128458
532 Ga0157374_10120928
533 Ga0157374_10123495
534 Ga0157378_10082219
535 Ga0157378_10492778
536 Ga0163162_10004488
537 Ga0163162_11181667
538 Ga0157372_10174231
539 Ga0157375_10191901
540 Ga0157375_10461572
541 Ga0157375_11212609
542 Ga0157380_10060418
543 Ga0157380_10289022
544 Ga0157379_10691292
545 Ga0157376_10771360
546 Ga0182005_1022947
547 Ga0163161_10057824
548 Ga0207697_10008769
549 Ga0207656_10006043
550 Ga0207642_10212211
551 Ga0207680_10118484
552 Ga0207647_10027037
553 Ga0207645_10003648
554 Ga0207643_10223441
555 Ga0207705_10562323
556 Ga0207705_10755578
557 Ga0207707_10048354
558 Ga0207707_10156866
559 Ga0207693_10211949
560 Ga0207662_10122891
561 Ga0207657_10037268
562 Ga0207657_10132667
563 Ga0207649_10002664
564 Ga0207649_10023200
565 Ga0207649_10166125
566 Ga0207652_10038031
567 Ga0207646_10224096
568 Ga0207646_10695806
569 Ga0207681_10178974
570 Ga0207681_10766979
571 Ga0207650_10051520
572 Ga0207659_10070986
573 Ga0207659_10280283
574 Ga0207644_10098110
575 Ga0207644_10646751
576 Ga0207690_10162463
577 Ga0207706_10060202
578 Ga0207686_10084929
579 Ga0207686_10110642
580 Ga0207669_10030309
581 Ga0207669_10079989
582 Ga0207691_10001668
583 Ga0207691_10008122
584 Ga0207691_10063172
585 Ga0207711_10350671
586 Ga0207689_10010905
587 Ga0207661_10016085
588 Ga0207661_10045605
589 Ga0207661_10189133
590 Ga0207679_10012175
591 Ga0207679_10225905
592 Ga0207667_10666909
593 Ga0207712_10008414
594 Ga0207712_10083740
595 Ga0207668_10009094
596 Ga0207668_10045742
597 Ga0207640_10280911
598 Ga0207658_10250480
599 Ga0207677_10188223
600 Ga0207639_10078320
601 Ga0207708_10085115
602 Ga0207708_10409862
603 Ga0207641_10165630
604 Ga0207648_10025486
605 Ga0207648_10127095
606 Ga0207648_10180413
607 Ga0207676_10173502
608 Ga0207676_10176544
609 Ga0207676_10332536
610 Ga0207676_10710330
611 Ga0207674_10000247
612 Ga0207674_10000740
613 Ga0207674_10061741
614 Ga0207675_100000677
615 Ga0207683_10168675
616 Ga0207698_10199773
617 Ga0207698_10333306
618 Ga0209983_1024136
619 Ga0209971_1036513
620 Ga0209974_10049188
621 Ga0207428_10783012
622 Ga0268266_10096142
623 Ga0268266_11123688
624 Ga0268265_10018203
625 Ga0268264_10121171
626 Ga0307408_100064675
627 Ga0307408_100189009
628 Ga0307405_10008092
629 Ga0307405_10226800
630 Ga0307413_10007041
631 Ga0307413_10137523
632 Ga0307413_10178557
633 Ga0307413_10279932
634 Ga0307410_10024852
635 Ga0307410_10025526
636 Ga0307410_10063827
637 Ga0307410_10084103
638 Ga0307410_10133743
639 Ga0307406_10050409
640 Ga0307406_10150521
641 Ga0307406_10265416
642 Ga0307406_10348339
643 Ga0307407_10201681
644 Ga0307407_10272318
645 Ga0307412_10609444
646 Ga0307409_100009716
647 Ga0307409_100132470
648 Ga0307409_100461246
649 Ga0307409_100678648
650 Ga0307416_100016854
651 Ga0307416_100081475
652 Ga0307416_100197451
653 Ga0307416_100267957
654 Ga0307416_100383508
655 Ga0307414_10011495
656 Ga0307414_10218178
657 Ga0307414_10589776
658 Ga0307414_10613140
659 Ga0307414_10719222
660 Ga0307411_10010424
661 Ga0307411_10019208
662 Ga0307411_10061179
663 Ga0307411_10278155
664 Ga0307411_10469268
665 Ga0307411_10485895
666 Ga0307415_100065204
667 Ga0307415_100372029
668 Ga0307415_101478843
669 Ga0373930_0023895
670 Ga0373948_0039868
671 Ga0373929_0029750
672 Ga0373949_0066628
673 Ga0373923_0235027
674 Ga0373939_0031464
675 Ga0373941_0008681
676 Ga0373960_0124725
677 Ga0373943_0185077
678 Ga0373924_0208237
679 Ga0395905_0295459
680 Ga0395905_0726011
681 Ga0242419_014853
682 Ga0242420_058631
683 Ga0451853_2571509
684 Ga0439457_099956
685 Ga0439462_0072458
686 Ga0450921_004780
687 Ga0450891_024365
688 Ga0450898_031456
689 Ga0439446_0296971
690 Ga0451577_0220169
691 Ga0451576_0961396
692 Ga0451576_1068251
693 Ga0495585_0351847
694 Ga0495647_0139993
695 Ga0495581_0105237
696 Ga0496104_0071978
697 Ga0496108_0011614
698 Ga0496108_0161167
699 Ga0496109_0189722
700 Ga0496109_0191683
701 Ga0496110_0078516
702 Ga0496111_0061510
703 Ga0496112_0008903
704 Ga0496112_0312189
705 Ga0496113_0004355
706 Ga0496113_0233159
707 Ga0501031_0198579
708 Ga0501038_0659029
709 Ga0501041_0031809
710 Ga0501041_0078159
711 Ga0501042_0053395
712 Ga0501043_0114053
713 Ga0501046_0113680
714 Ga0501046_0523935
715 Ga0501048_0899148
716 Ga0501067_0041682
717 Ga0501068_0161161
718 Ga0501070_0354055
719 Ga0501071_0015959
720 Ga0501071_0653154
721 Ga0501074_0035744
722 Ga0501075_0013181
723 Ga0501076_0164870
724 Ga0501076_0757147
725 Ga0501077_0001629
726 Ga0501077_0127581
727 Ga0501217_029830
728 Ga0501233_070293
729 Ga0501235_146221
730 Ga0501253_098356
731 Ga0501259_006281
732 Ga0501225_0085330
733 Ga0501079_0050519
734 Ga0501080_0035233
735 Ga0501081_0012986
736 Ga0501081_0972500
737 Ga0501083_0152350
738 Ga0501083_0747308
739 Ga0501045_0067168
740 nmdc:mga05p37_31364_c1
741 nmdc:mga05p37_64252_c1
742 nmdc:mga09592_114989_c1
743 nmdc:mga09592_319951_c1
744 nmdc:mga09592_705571_c1
745 nmdc:mga0qj67_157476_c1
746 nmdc:mga06r32_29597_c1
747 nmdc:mga06r32_423072_c1
748 nmdc:mga06r32_741095_c1
749 nmdc:mga08y16_118194_c1
750 nmdc:mga08y16_1760206_c1
751 nmdc:mga08y16_85893_c1
752 nmdc:mga0n895_32951_c1
753 nmdc:mga0n895_7425_c1
754 nmdc:mga0a205_1832_c1
755 nmdc:mga0a205_19482_c1
756 Ga0501084_0016335
757 Ga0501084_0039748
758 Ga0501084_0952689
759 Ga0590071_000598
760 Ga0590071_040389
761 Ga0590075_021430
762 Ga0501082_0079004
763 Ga0501082_0319337
764 Ga0530510_0566030

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00071

Ras

Ras family

5

157

0.95

PF08477

Roc

Ras of Complex, Roc, domain of DAPkinase

5

111

0.86

PF00025

Arf

ADP-ribosylation factor family

2

155

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
4aii-assembly1.cif.gz_A crystal structure of the rat rem2 gtpase - g domain bound to gdp 0.9022 1 163
2efh-assembly2.cif.gz_D ara7-gdp/atvps9a(d185n) 0.9007 1 160
2o52-assembly1.cif.gz_A crystal structure of human rab4b in complex with gdp 0.9005 2 163
2o52-assembly2.cif.gz_B crystal structure of human rab4b in complex with gdp 0.8997 2 163
3q72-assembly1.cif.gz_A crystal structure of rad g-domain-gtp analog complex 0.8935 1 163
ID Description Score Start End Superfamily
af_Q9SJZ5_48_162_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9184 70 163 3.40.50.300
af_Q75J93_19_174_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9108 70 160 3.40.50.300
af_Q4CZ47_1_97_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9098 86 163 3.40.50.300
af_A0A1D6EL55_1_151_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8983 40 163 3.40.50.300
af_Q3E8G1_3_112_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8932 70 163 3.40.50.300
ID Description Score Start End GO Terms
AF-W4L503-F1-model_v4 GTP-binding protein 0.9361 42 162 GO:0003924
GO:0005525
AF-W4L503-F1-model_v4 GTP-binding protein 0.9076 42 162 GO:0003924
GO:0005525
AF-A0A1A8ET10-F1-model_v4 EF-hand calcium binding domain 4B 0.8913 3 163 GO:0003924
GO:0005525
AF-A0A2M4AUT7-F1-model_v4 Putative gtp-binding protein 0.8905 40 163 GO:0003924
GO:0005525
GO:0035556
AF-T0QE72-F1-model_v4 Rab family, other 0.8831 1 163 GO:0003924
GO:0005525

Map