F429332

General Info

Members Datasets Scaffolds Average Seq Length
382 215 764 190

Family's Representative Sequence

Representative Sequence 3300035724|Ga0373933_0042226|Ga0373933_0042226_993_1634
Length 213
Sequence MPIAKAPKGTKVKSVRAASEKGSVSRADTKKELSPGQREELLRALEARFEKNMRRHQGLEWAKVQAKLEASAEKLRSLHQMERTGGEPDVVGQDRKTGEYIFYDCSEESPNGRRSFCYDREALDSRKENKPKDNAVGMAAAMGIELLTEEQYRELQKLGTFDTKTSSWVKTPSAIRKLGGALFCDRRFDTVFLYHNGAESYYAARGFRGSLRV

Samples

Sample ID Description Type Environment
1 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
54 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
55 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
56 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
57 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
58 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
73 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
76 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
77 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
78 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
79 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
80 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
87 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
88 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
89 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
90 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
91 3300022730 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 Metagenome Rhizosphere
92 3300022732 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 Metagenome Rhizosphere
93 3300022734 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU3 Metagenome Rhizosphere
94 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
95 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
96 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
145 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
149 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
150 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
151 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
152 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
153 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
154 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
155 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
156 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
157 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
158 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
159 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
160 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
161 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
162 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
163 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
164 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
165 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
166 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
167 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
168 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
169 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
170 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
171 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
172 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
173 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
174 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
175 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
176 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
177 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
178 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
179 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
180 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
181 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
182 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
183 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
184 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
185 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
186 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
187 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
188 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
189 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
190 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
191 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
192 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
193 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
194 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
195 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
196 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
197 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
198 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
199 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
200 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
201 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
202 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
203 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
204 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
207 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
208 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
209 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
210 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
211 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
212 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
213 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
214 2881636855 Paenibacillus sp. 7197 Isolate Rhizosphere
215 2990275345 Bacillus sp. SLBN-46 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.17
Metatranscriptomes 1.31
Isolates 0.52

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.52
Nodule 0
Rhizoplane 2.09
Rhizosphere 91.1
Stem 0
Stem Tuber 0
Unclassified 2.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373933_0042226 3300035724 Bacteria 2695
2 JGI24737J22298_10020667 3300001990 Unclassified 2100
3 JGI25406J46586_10000320 3300003203 Bacteria 21684
4 rootH1_10003358 3300003316 Bacteria 8071
5 rootH1_10008657 3300003316 Bacteria 22351
6 rootH2_10001524 3300003320 Bacteria 35747
7 rootH2_10063207 3300003320 Bacteria 4416
8 rootL2_10191327 3300003322 Bacteria 4382
9 rootL2_10312937 3300003322 Bacteria 1854
10 rootH1_10020383 3300003323 Bacteria 8000
11 rootH1_10063070 3300003323 Bacteria 3268
12 Ga0070658_10004280 3300005327 Bacteria 11663
13 Ga0070683_100008898 3300005329 Bacteria 8554
14 Ga0070683_100205506 3300005329 Bacteria 1871
15 Ga0070683_100739798 3300005329 Bacteria 942
16 Ga0070670_100001356 3300005331 Bacteria 19626
17 Ga0070670_100241779 3300005331 Bacteria 1572
18 Ga0070677_10497313 3300005333 Bacteria 660
19 Ga0068869_100037532 3300005334 Bacteria 3445
20 Ga0070680_100320813 3300005336 Bacteria 1315
21 Ga0070682_100130113 3300005337 Bacteria 1702
22 Ga0070682_100355035 3300005337 Bacteria 1094
23 Ga0068868_100003750 3300005338 Bacteria 10615
24 Ga0068868_100018789 3300005338 Bacteria 5170
25 Ga0068868_100108482 3300005338 Bacteria 2253
26 Ga0070660_100255096 3300005339 Bacteria 1431
27 Ga0070660_100810525 3300005339 Bacteria 788
28 Ga0070660_100905033 3300005339 Bacteria 744
29 Ga0070689_100039048 3300005340 Bacteria 3634
30 Ga0070689_100133669 3300005340 Bacteria 1991
31 Ga0070691_10088190 3300005341 Bacteria 1527
32 Ga0070687_100088788 3300005343 Bacteria 1705
33 Ga0070661_100089833 3300005344 Bacteria 2275
34 Ga0070671_100452460 3300005355 Bacteria 1102
35 Ga0070673_100144086 3300005364 Bacteria 2013
36 Ga0070688_100014887 3300005365 Bacteria 4415
37 Ga0070688_100228509 3300005365 Bacteria 1315
38 Ga0070714_100055308 3300005435 Bacteria 3391
39 Ga0070714_100318489 3300005435 Unclassified 1454
40 Ga0070713_100138799 3300005436 Bacteria 2151
41 Ga0070713_100241626 3300005436 Unclassified 1644
42 Ga0070713_100276604 3300005436 Bacteria 1539
43 Ga0070713_100437169 3300005436 Bacteria 1227
44 Ga0070713_101009444 3300005436 Bacteria 803
45 Ga0070713_101177407 3300005436 Bacteria 742
46 Ga0070711_100003018 3300005439 Bacteria 9730
47 Ga0070705_100031684 3300005440 Bacteria 2930
48 Ga0070681_10007290 3300005458 Bacteria 10792
49 Ga0070681_10141371 3300005458 Bacteria 2337
50 Ga0070681_10256239 3300005458 Bacteria 1662
51 Ga0068867_100063713 3300005459 Bacteria 2740
52 Ga0068867_100414393 3300005459 Bacteria 1140
53 Ga0070685_10148747 3300005466 Bacteria 1482
54 Ga0070685_10153037 3300005466 Bacteria 1463
55 Ga0070707_101020230 3300005468 Bacteria 793
56 Ga0070679_100007239 3300005530 Bacteria 10356
57 Ga0070679_100018011 3300005530 Bacteria 6846
58 Ga0070679_100245581 3300005530 Bacteria 1747
59 Ga0070679_100306413 3300005530 Bacteria 1539
60 Ga0070684_100023876 3300005535 Bacteria 5122
61 Ga0070684_100065395 3300005535 Bacteria 3191
62 Ga0070684_100157543 3300005535 Bacteria 2059
63 Ga0070684_100660865 3300005535 Bacteria 973
64 Ga0068853_100044920 3300005539 Bacteria 3783
65 Ga0068853_100236653 3300005539 Bacteria 1672
66 Ga0070686_100532358 3300005544 Bacteria 916
67 Ga0070696_100215362 3300005546 Bacteria 1439
68 Ga0070693_100125340 3300005547 Bacteria 1598
69 Ga0070704_100272590 3300005549 Bacteria 1399
70 Ga0068855_100023012 3300005563 Bacteria 7467
71 Ga0070664_100000655 3300005564 Bacteria 26466
72 Ga0070664_100033248 3300005564 Bacteria 4318
73 Ga0070664_100049600 3300005564 Unclassified 3551
74 Ga0070664_100139661 3300005564 Bacteria 2133
75 Ga0068857_100005006 3300005577 Bacteria 11261
76 Ga0068857_100162540 3300005577 Bacteria 2026
77 Ga0068857_100787988 3300005577 Bacteria 907
78 Ga0068854_100003799 3300005578 Bacteria 9440
79 Ga0068856_100000950 3300005614 Bacteria 31035
80 Ga0068856_100422522 3300005614 Bacteria 1353
81 Ga0068856_100901222 3300005614 Bacteria 903
82 Ga0068852_100368487 3300005616 Bacteria 1407
83 Ga0068859_100002509 3300005617 Bacteria 18655
84 Ga0068859_100593414 3300005617 Bacteria 1201
85 Ga0068859_101464227 3300005617 Bacteria 753
86 Ga0068864_100000347 3300005618 Bacteria 40801
87 Ga0068864_100029482 3300005618 Bacteria 4649
88 Ga0068864_100172083 3300005618 Bacteria 1975
89 Ga0068864_100410936 3300005618 Bacteria 1288
90 Ga0068866_10053904 3300005718 Bacteria 2058
91 Ga0068861_100138004 3300005719 Bacteria 1986
92 Ga0068861_100380513 3300005719 Bacteria 1247
93 Ga0068863_100040002 3300005841 Bacteria 4459
94 Ga0068863_100058241 3300005841 Bacteria 3656
95 Ga0068863_100220279 3300005841 Bacteria 1828
96 Ga0068858_100000843 3300005842 Bacteria 31775
97 Ga0068858_100006749 3300005842 Bacteria 11171
98 Ga0068860_100011185 3300005843 Bacteria 8845
99 Ga0068860_101884318 3300005843 Bacteria 620
100 Ga0068862_100506402 3300005844 Bacteria 1147
101 Ga0081540_1075188 3300005983 Bacteria 1544
102 Ga0081539_10000147 3300005985 Bacteria 164274
103 Ga0070717_10080444 3300006028 Bacteria 2734
104 Ga0070717_10782299 3300006028 Bacteria 868
105 Ga0070715_10000035 3300006163 Bacteria 78855
106 Ga0070716_100027471 3300006173 Bacteria 3058
107 Ga0070716_100028659 3300006173 Bacteria 3002
108 Ga0070716_100045697 3300006173 Bacteria 2460
109 Ga0070716_100078130 3300006173 Bacteria 1967
110 Ga0070716_100525341 3300006173 Bacteria 878
111 Ga0070712_100015023 3300006175 Bacteria 4978
112 Ga0070712_100015742 3300006175 Bacteria 4876
113 Ga0070712_100063456 3300006175 Bacteria 2616
114 Ga0070712_100113340 3300006175 Bacteria 2028
115 Ga0070712_100503616 3300006175 Bacteria 1015
116 Ga0070712_100517500 3300006175 Unclassified 1002
117 Ga0097621_100016633 3300006237 Bacteria 5565
118 Ga0097621_100086305 3300006237 Bacteria 2619
119 Ga0097621_100857997 3300006237 Bacteria 844
120 Ga0068871_100060863 3300006358 Bacteria 3081
121 Ga0068871_100121062 3300006358 Bacteria 2210
122 Ga0068871_100372669 3300006358 Bacteria 1267
123 Ga0068871_100910380 3300006358 Bacteria 815
124 Ga0075428_100027003 3300006844 Bacteria 6357
125 Ga0068865_100713865 3300006881 Bacteria 858
126 Ga0097620_100002509 3300006931 Bacteria 18655
127 Ga0097620_100593414 3300006931 Bacteria 1201
128 Ga0097620_101464246 3300006931 Bacteria 753
129 Ga0075435_100962039 3300007076 Bacteria 745
130 Ga0105240_10142477 3300009093 Bacteria 2864
131 Ga0105240_10754216 3300009093 Bacteria 1058
132 Ga0111539_10454851 3300009094 Bacteria 1491
133 Ga0105245_10051278 3300009098 Bacteria 3699
134 Ga0114129_10035534 3300009147 Bacteria 7039
135 Ga0105241_10008473 3300009174 Bacteria 7562
136 Ga0105241_10039594 3300009174 Bacteria 3556
137 Ga0105241_10059720 3300009174 Bacteria 2933
138 Ga0105242_10271833 3300009176 Bacteria 1535
139 Ga0105248_10604757 3300009177 Bacteria 1237
140 Ga0105248_11073095 3300009177 Bacteria 910
141 Ga0105237_10091196 3300009545 Bacteria 3037
142 Ga0105237_10221662 3300009545 Bacteria 1891
143 Ga0105237_10449599 3300009545 Bacteria 1294
144 Ga0105238_11839301 3300009551 Bacteria 638
145 Ga0105239_10104313 3300010375 Bacteria 3139
146 Ga0105239_10256666 3300010375 Bacteria 1964
147 Ga0105239_10406800 3300010375 Bacteria 1540
148 Ga0105239_10463676 3300010375 Bacteria 1438
149 Ga0105239_11310160 3300010375 Bacteria 835
150 Ga0105239_11742734 3300010375 Bacteria 721
151 Ga0105246_10042219 3300011119 Bacteria 3088
152 Ga0157373_10058823 3300013100 Bacteria 2724
153 Ga0157373_10095824 3300013100 Bacteria 2089
154 Ga0157371_10083630 3300013102 Bacteria 2260
155 Ga0157371_10642047 3300013102 Bacteria 792
156 Ga0157370_10186979 3300013104 Bacteria 1923
157 Ga0157370_10554028 3300013104 Bacteria 1054
158 Ga0157369_10087263 3300013105 Bacteria 3332
159 Ga0157369_10171191 3300013105 Unclassified 2288
160 Ga0157369_10181294 3300013105 Bacteria 2215
161 Ga0157369_10741503 3300013105 Bacteria 1011
162 Ga0157374_10000426 3300013296 Bacteria 38168
163 Ga0157374_10006760 3300013296 Bacteria 9751
164 Ga0157374_10038676 3300013296 Bacteria 4386
165 Ga0157374_10206897 3300013296 Bacteria 1923
166 Ga0157374_10237626 3300013296 Bacteria 1791
167 Ga0157374_10489019 3300013296 Bacteria 1234
168 Ga0157378_10000208 3300013297 Bacteria 56312
169 Ga0157378_10007520 3300013297 Bacteria 9513
170 Ga0163162_10004606 3300013306 Bacteria 13287
171 Ga0163162_10138451 3300013306 Bacteria 2545
172 Ga0163162_10542523 3300013306 Bacteria 1291
173 Ga0157372_10000554 3300013307 Bacteria 41086
174 Ga0157372_10372824 3300013307 Bacteria 1663
175 Ga0157372_10650059 3300013307 Bacteria 1228
176 Ga0157372_10824219 3300013307 Bacteria 1077
177 Ga0157375_10025362 3300013308 Bacteria 5507
178 Ga0157375_10319113 3300013308 Bacteria 1718
179 Ga0163163_10000276 3300014325 Bacteria 51378
180 Ga0163163_10057555 3300014325 Bacteria 3844
181 Ga0163163_10098534 3300014325 Bacteria 2944
182 Ga0163163_11283952 3300014325 Bacteria 794
183 Ga0157380_10151761 3300014326 Bacteria 2004
184 Ga0157377_10052039 3300014745 Bacteria 2311
185 Ga0157377_10062524 3300014745 Bacteria 2130
186 Ga0157379_10016557 3300014968 Bacteria 6484
187 Ga0157379_10052327 3300014968 Bacteria 3648
188 Ga0157376_10017092 3300014969 Bacteria 5525
189 Ga0206350_11538559 3300020080 Bacteria 1354
190 Ga0224570_100685 3300022730 Bacteria 2682
191 Ga0224569_101740 3300022732 Bacteria 1805
192 Ga0224571_101335 3300022734 Bacteria 1535
193 Ga0224572_1005711 3300024225 Bacteria 2229
194 Ga0228598_1006546 3300024227 Bacteria 2409
195 Ga0207692_10132150 3300025898 Bacteria 1411
196 Ga0207642_10016396 3300025899 Bacteria 2790
197 Ga0207647_10009387 3300025904 Bacteria 6953
198 Ga0207647_10051917 3300025904 Bacteria 2532
199 Ga0207647_10169633 3300025904 Bacteria 1271
200 Ga0207685_10000019 3300025905 Bacteria 145568
201 Ga0207699_10054993 3300025906 Bacteria 2367
202 Ga0207705_10000623 3300025909 Bacteria 29594
203 Ga0207705_10016021 3300025909 Bacteria 5380
204 Ga0207705_10264767 3300025909 Bacteria 1313
205 Ga0207705_10797007 3300025909 Bacteria 733
206 Ga0207684_10023959 3300025910 Bacteria 5208
207 Ga0207654_10092650 3300025911 Bacteria 1845
208 Ga0207654_10261054 3300025911 Bacteria 1165
209 Ga0207707_10070350 3300025912 Bacteria 3049
210 Ga0207707_10239218 3300025912 Bacteria 1579
211 Ga0207695_10066882 3300025913 Bacteria 3688
212 Ga0207695_10272785 3300025913 Bacteria 1587
213 Ga0207695_10665290 3300025913 Bacteria 922
214 Ga0207671_10246693 3300025914 Bacteria 1403
215 Ga0207693_10006092 3300025915 Bacteria 9989
216 Ga0207693_10008408 3300025915 Bacteria 8444
217 Ga0207693_10087982 3300025915 Bacteria 2434
218 Ga0207693_10093729 3300025915 Bacteria 2354
219 Ga0207663_10156172 3300025916 Bacteria 1605
220 Ga0207660_10088099 3300025917 Bacteria 2295
221 Ga0207662_10110792 3300025918 Bacteria 1711
222 Ga0207657_10284825 3300025919 Bacteria 1311
223 Ga0207657_10742220 3300025919 Bacteria 761
224 Ga0207649_10020865 3300025920 Bacteria 3763
225 Ga0207649_10049041 3300025920 Bacteria 2606
226 Ga0207652_10012480 3300025921 Bacteria 6866
227 Ga0207652_10028657 3300025921 Bacteria 4649
228 Ga0207652_11364511 3300025921 Bacteria 612
229 Ga0207646_10679452 3300025922 Bacteria 921
230 Ga0207681_10084354 3300025923 Bacteria 2252
231 Ga0207681_10149210 3300025923 Bacteria 1750
232 Ga0207694_10611744 3300025924 Unclassified 917
233 Ga0207650_10004968 3300025925 Bacteria 9090
234 Ga0207659_10514862 3300025926 Bacteria 1014
235 Ga0207700_10143586 3300025928 Bacteria 1964
236 Ga0207700_10171546 3300025928 Bacteria 1810
237 Ga0207700_10343704 3300025928 Bacteria 1298
238 Ga0207664_10079130 3300025929 Bacteria 2667
239 Ga0207706_10067937 3300025933 Bacteria 3137
240 Ga0207706_10081670 3300025933 Bacteria 2840
241 Ga0207686_10058080 3300025934 Bacteria 2438
242 Ga0207686_10771549 3300025934 Bacteria 769
243 Ga0207670_10148851 3300025936 Bacteria 1734
244 Ga0207665_10008803 3300025939 Bacteria 6635
245 Ga0207665_10065449 3300025939 Bacteria 2472
246 Ga0207665_10068933 3300025939 Bacteria 2411
247 Ga0207665_10418700 3300025939 Bacteria 1023
248 Ga0207691_10081751 3300025940 Bacteria 2903
249 Ga0207711_10126630 3300025941 Bacteria 2285
250 Ga0207689_10006188 3300025942 Bacteria 10598
251 Ga0207689_10225103 3300025942 Bacteria 1550
252 Ga0207661_10023769 3300025944 Bacteria 4636
253 Ga0207661_10072782 3300025944 Bacteria 2813
254 Ga0207661_10218545 3300025944 Bacteria 1683
255 Ga0207679_10001181 3300025945 Bacteria 16627
256 Ga0207679_10089394 3300025945 Bacteria 2378
257 Ga0207679_10127882 3300025945 Bacteria 2033
258 Ga0207679_10154077 3300025945 Bacteria 1874
259 Ga0207679_10162797 3300025945 Bacteria 1828
260 Ga0207679_10902558 3300025945 Bacteria 808
261 Ga0207667_10012965 3300025949 Bacteria 9570
262 Ga0207667_10706155 3300025949 Bacteria 1010
263 Ga0207651_10871660 3300025960 Bacteria 801
264 Ga0207640_10015605 3300025981 Bacteria 4402
265 Ga0207677_10010194 3300026023 Bacteria 5311
266 Ga0207677_10065721 3300026023 Bacteria 2532
267 Ga0207703_10009729 3300026035 Bacteria 7545
268 Ga0207639_10157076 3300026041 Bacteria 1912
269 Ga0207639_10456067 3300026041 Bacteria 1161
270 Ga0207639_10600121 3300026041 Bacteria 1015
271 Ga0207678_10076997 3300026067 Bacteria 2857
272 Ga0207702_10936949 3300026078 Bacteria 859
273 Ga0207641_10020602 3300026088 Bacteria 5418
274 Ga0207641_10236673 3300026088 Bacteria 1699
275 Ga0207648_10075945 3300026089 Bacteria 2929
276 Ga0207648_10091176 3300026089 Bacteria 2664
277 Ga0207648_10350250 3300026089 Bacteria 1331
278 Ga0207676_10008723 3300026095 Bacteria 7209
279 Ga0207676_10155944 3300026095 Bacteria 1972
280 Ga0207676_10799415 3300026095 Bacteria 920
281 Ga0207674_10002556 3300026116 Bacteria 22910
282 Ga0207674_10015716 3300026116 Bacteria 8304
283 Ga0207674_10094570 3300026116 Bacteria 2975
284 Ga0207674_10858804 3300026116 Bacteria 875
285 Ga0207675_100401681 3300026118 Bacteria 1350
286 Ga0207675_100406860 3300026118 Bacteria 1342
287 Ga0207698_10158745 3300026142 Bacteria 1974
288 Ga0207698_10252174 3300026142 Bacteria 1616
289 Ga0207698_10714770 3300026142 Bacteria 998
290 Ga0265356_1000594 3300028017 Bacteria 6386
291 Ga0268266_10320688 3300028379 Bacteria 1450
292 Ga0268266_11068039 3300028379 Bacteria 781
293 Ga0268265_10760251 3300028380 Bacteria 941
294 Ga0268264_10031227 3300028381 Bacteria 4368
295 Ga0268264_10105672 3300028381 Bacteria 2456
296 Ga0265334_10061322 3300028573 Bacteria 1418
297 Ga0265762_1001149 3300030760 Bacteria 4777
298 Ga0265762_1004083 3300030760 Bacteria 2614
299 Ga0265760_10001746 3300031090 Bacteria 6392
300 Ga0265760_10070039 3300031090 Bacteria 1075
301 Ga0265332_10022180 3300031238 Bacteria 2803
302 Ga0265320_10009347 3300031240 Bacteria 5920
303 Ga0265325_10025593 3300031241 Bacteria 3203
304 Ga0265331_10042293 3300031250 Bacteria 2210
305 Ga0265316_10008794 3300031344 Bacteria 9331
306 Ga0307509_10176767 3300031507 Bacteria 2006
307 Ga0307414_10065450 3300032004 Bacteria 2593
308 Ga0307414_10197991 3300032004 Bacteria 1631
309 Ga0316214_1004040 3300033545 Bacteria 1876
310 Ga0373923_0285930 3300035111 Bacteria 778
311 Ga0373936_0019326 3300035113 Bacteria 2640
312 Ga0373943_0121481 3300035170 Bacteria 1388
313 Ga0316574_0034255 3300035398 Bacteria 3095
314 Ga0373924_0107843 3300035410 Bacteria 1202
315 Ga0373931_0500663 3300035691 Bacteria 783
316 Ga0373935_0096800 3300035692 Bacteria 1940
317 Ga0373933_0360732 3300035724 Bacteria 945
318 Ga0373937_0289640 3300036401 Bacteria 1547
319 Ga0373925_0102342 3300037068 Bacteria 2203
320 Ga0373925_0124816 3300037068 Bacteria 2002
321 Ga0395900_0239534 3300037418 Bacteria 1821
322 Ga0395898_0544392 3300037466 Unclassified 1103
323 Ga0395905_0276325 3300037471 Bacteria 1565
324 Ga0436364_0607028 3300037853 Bacteria 978
325 Ga0395901_0413123 3300038443 Bacteria 1385
326 Ga0436360_0273599 3300039438 Bacteria 1231
327 Ga0436360_1340491 3300039438 Bacteria 1179
328 Ga0436363_0889922 3300039450 Bacteria 735
329 Ga0466969_0247710 3300044656 Bacteria 808
330 Ga0466963_0008639 3300044694 Bacteria 6114
331 Ga0453684_0302168 3300044712 Bacteria 1819
332 Ga0453684_1133629 3300044712 Unclassified 825
333 Ga0466957_0000197 3300044842 Bacteria 27875
334 Ga0466957_0000575 3300044842 Bacteria 18530
335 Ga0466957_0084100 3300044842 Bacteria 1986
336 Ga0451576_0048203 3300045051 Bacteria 4477
337 Ga0451576_0123365 3300045051 Bacteria 2698
338 Ga0466958_0103190 3300045836 Bacteria 1775
339 Ga0466967_0006787 3300045976 Bacteria 8157
340 Ga0466967_0394627 3300045976 Bacteria 1345
341 Ga0495580_0001482 3300046472 Bacteria 20596
342 Ga0495580_0046879 3300046472 Bacteria 3065
343 Ga0495580_0488560 3300046472 Bacteria 823
344 Ga0495664_0025680 3300046477 Bacteria 3430
345 Ga0495594_0115219 3300046499 Bacteria 1517
346 Ga0495630_0064920 3300046517 Bacteria 2743
347 Ga0495587_0396612 3300046536 Bacteria 767
348 Ga0495657_0363590 3300046675 Bacteria 855
349 Ga0495675_0014970 3300047444 Bacteria 4904
350 Ga0496104_0255052 3300048907 Bacteria 1667
351 Ga0496106_0152456 3300048909 Bacteria 1824
352 Ga0496109_0437059 3300048912 Bacteria 1236
353 Ga0496110_0048917 3300048913 Bacteria 3708
354 Ga0496112_0010193 3300048915 Bacteria 8515
355 Ga0496112_0020533 3300048915 Bacteria 6263
356 Ga0496113_0454123 3300048916 Bacteria 1030
357 Ga0496115_0100261 3300048918 Bacteria 2374
358 Ga0496116_0000213 3300048919 Bacteria 109134
359 Ga0496119_0001124 3300048922 Bacteria 33715
360 Ga0496119_0012435 3300048922 Bacteria 6912
361 Ga0496119_0033337 3300048922 Bacteria 3416
362 Ga0496120_0000003 3300048923 Bacteria 538703
363 Ga0496120_0003302 3300048923 Bacteria 14828
364 Ga0496122_0044767 3300048925 Bacteria 3449
365 Ga0496123_0037039 3300048926 Bacteria 3449
366 Ga0496125_0000027 3300048928 Bacteria 397211
367 Ga0496126_0002284 3300048929 Bacteria 26409
368 Ga0496126_0101699 3300048929 Bacteria 2513
369 Ga0501300_002028 3300049523 Bacteria 3023
370 Ga0501033_0165482 3300049570 Bacteria 1590
371 Ga0501033_0251661 3300049570 Bacteria 1252
372 Ga0501048_0322311 3300049582 Bacteria 1101
373 Ga0501075_0755016 3300049591 Bacteria 740
374 Ga0501079_0492774 3300049741 Bacteria 963
375 nmdc:mga08x19_19725_c1 3300050514 Bacteria 4142
376 Ga0495601_0014427 3300053077 Bacteria 4762
377 Ga0500583_0000751 3300053092 Bacteria 9399
378 Ga0500589_036826 3300053147 Bacteria 2284
379 Ga0501082_0072359 3300060353 Bacteria 2970
380 Ga0530510_0211192 3300061734 Bacteria 1442
381 2881641715 2881636855 Bacteria 5205297
382 2990276338 2990275345 Bacteria 4887158
383 Ga0373933_0042226
384 JGI24737J22298_10020667
385 JGI25406J46586_10000320
386 rootH1_10003358
387 rootH1_10008657
388 rootH2_10001524
389 rootH2_10063207
390 rootL2_10191327
391 rootL2_10312937
392 rootH1_10020383
393 rootH1_10063070
394 Ga0070658_10004280
395 Ga0070683_100008898
396 Ga0070683_100205506
397 Ga0070683_100739798
398 Ga0070670_100001356
399 Ga0070670_100241779
400 Ga0070677_10497313
401 Ga0068869_100037532
402 Ga0070680_100320813
403 Ga0070682_100130113
404 Ga0070682_100355035
405 Ga0068868_100003750
406 Ga0068868_100018789
407 Ga0068868_100108482
408 Ga0070660_100255096
409 Ga0070660_100810525
410 Ga0070660_100905033
411 Ga0070689_100039048
412 Ga0070689_100133669
413 Ga0070691_10088190
414 Ga0070687_100088788
415 Ga0070661_100089833
416 Ga0070671_100452460
417 Ga0070673_100144086
418 Ga0070688_100014887
419 Ga0070688_100228509
420 Ga0070714_100055308
421 Ga0070714_100318489
422 Ga0070713_100138799
423 Ga0070713_100241626
424 Ga0070713_100276604
425 Ga0070713_100437169
426 Ga0070713_101009444
427 Ga0070713_101177407
428 Ga0070711_100003018
429 Ga0070705_100031684
430 Ga0070681_10007290
431 Ga0070681_10141371
432 Ga0070681_10256239
433 Ga0068867_100063713
434 Ga0068867_100414393
435 Ga0070685_10148747
436 Ga0070685_10153037
437 Ga0070707_101020230
438 Ga0070679_100007239
439 Ga0070679_100018011
440 Ga0070679_100245581
441 Ga0070679_100306413
442 Ga0070684_100023876
443 Ga0070684_100065395
444 Ga0070684_100157543
445 Ga0070684_100660865
446 Ga0068853_100044920
447 Ga0068853_100236653
448 Ga0070686_100532358
449 Ga0070696_100215362
450 Ga0070693_100125340
451 Ga0070704_100272590
452 Ga0068855_100023012
453 Ga0070664_100000655
454 Ga0070664_100033248
455 Ga0070664_100049600
456 Ga0070664_100139661
457 Ga0068857_100005006
458 Ga0068857_100162540
459 Ga0068857_100787988
460 Ga0068854_100003799
461 Ga0068856_100000950
462 Ga0068856_100422522
463 Ga0068856_100901222
464 Ga0068852_100368487
465 Ga0068859_100002509
466 Ga0068859_100593414
467 Ga0068859_101464227
468 Ga0068864_100000347
469 Ga0068864_100029482
470 Ga0068864_100172083
471 Ga0068864_100410936
472 Ga0068866_10053904
473 Ga0068861_100138004
474 Ga0068861_100380513
475 Ga0068863_100040002
476 Ga0068863_100058241
477 Ga0068863_100220279
478 Ga0068858_100000843
479 Ga0068858_100006749
480 Ga0068860_100011185
481 Ga0068860_101884318
482 Ga0068862_100506402
483 Ga0081540_1075188
484 Ga0081539_10000147
485 Ga0070717_10080444
486 Ga0070717_10782299
487 Ga0070715_10000035
488 Ga0070716_100027471
489 Ga0070716_100028659
490 Ga0070716_100045697
491 Ga0070716_100078130
492 Ga0070716_100525341
493 Ga0070712_100015023
494 Ga0070712_100015742
495 Ga0070712_100063456
496 Ga0070712_100113340
497 Ga0070712_100503616
498 Ga0070712_100517500
499 Ga0097621_100016633
500 Ga0097621_100086305
501 Ga0097621_100857997
502 Ga0068871_100060863
503 Ga0068871_100121062
504 Ga0068871_100372669
505 Ga0068871_100910380
506 Ga0075428_100027003
507 Ga0068865_100713865
508 Ga0097620_100002509
509 Ga0097620_100593414
510 Ga0097620_101464246
511 Ga0075435_100962039
512 Ga0105240_10142477
513 Ga0105240_10754216
514 Ga0111539_10454851
515 Ga0105245_10051278
516 Ga0114129_10035534
517 Ga0105241_10008473
518 Ga0105241_10039594
519 Ga0105241_10059720
520 Ga0105242_10271833
521 Ga0105248_10604757
522 Ga0105248_11073095
523 Ga0105237_10091196
524 Ga0105237_10221662
525 Ga0105237_10449599
526 Ga0105238_11839301
527 Ga0105239_10104313
528 Ga0105239_10256666
529 Ga0105239_10406800
530 Ga0105239_10463676
531 Ga0105239_11310160
532 Ga0105239_11742734
533 Ga0105246_10042219
534 Ga0157373_10058823
535 Ga0157373_10095824
536 Ga0157371_10083630
537 Ga0157371_10642047
538 Ga0157370_10186979
539 Ga0157370_10554028
540 Ga0157369_10087263
541 Ga0157369_10171191
542 Ga0157369_10181294
543 Ga0157369_10741503
544 Ga0157374_10000426
545 Ga0157374_10006760
546 Ga0157374_10038676
547 Ga0157374_10206897
548 Ga0157374_10237626
549 Ga0157374_10489019
550 Ga0157378_10000208
551 Ga0157378_10007520
552 Ga0163162_10004606
553 Ga0163162_10138451
554 Ga0163162_10542523
555 Ga0157372_10000554
556 Ga0157372_10372824
557 Ga0157372_10650059
558 Ga0157372_10824219
559 Ga0157375_10025362
560 Ga0157375_10319113
561 Ga0163163_10000276
562 Ga0163163_10057555
563 Ga0163163_10098534
564 Ga0163163_11283952
565 Ga0157380_10151761
566 Ga0157377_10052039
567 Ga0157377_10062524
568 Ga0157379_10016557
569 Ga0157379_10052327
570 Ga0157376_10017092
571 Ga0206350_11538559
572 Ga0224570_100685
573 Ga0224569_101740
574 Ga0224571_101335
575 Ga0224572_1005711
576 Ga0228598_1006546
577 Ga0207692_10132150
578 Ga0207642_10016396
579 Ga0207647_10009387
580 Ga0207647_10051917
581 Ga0207647_10169633
582 Ga0207685_10000019
583 Ga0207699_10054993
584 Ga0207705_10000623
585 Ga0207705_10016021
586 Ga0207705_10264767
587 Ga0207705_10797007
588 Ga0207684_10023959
589 Ga0207654_10092650
590 Ga0207654_10261054
591 Ga0207707_10070350
592 Ga0207707_10239218
593 Ga0207695_10066882
594 Ga0207695_10272785
595 Ga0207695_10665290
596 Ga0207671_10246693
597 Ga0207693_10006092
598 Ga0207693_10008408
599 Ga0207693_10087982
600 Ga0207693_10093729
601 Ga0207663_10156172
602 Ga0207660_10088099
603 Ga0207662_10110792
604 Ga0207657_10284825
605 Ga0207657_10742220
606 Ga0207649_10020865
607 Ga0207649_10049041
608 Ga0207652_10012480
609 Ga0207652_10028657
610 Ga0207652_11364511
611 Ga0207646_10679452
612 Ga0207681_10084354
613 Ga0207681_10149210
614 Ga0207694_10611744
615 Ga0207650_10004968
616 Ga0207659_10514862
617 Ga0207700_10143586
618 Ga0207700_10171546
619 Ga0207700_10343704
620 Ga0207664_10079130
621 Ga0207706_10067937
622 Ga0207706_10081670
623 Ga0207686_10058080
624 Ga0207686_10771549
625 Ga0207670_10148851
626 Ga0207665_10008803
627 Ga0207665_10065449
628 Ga0207665_10068933
629 Ga0207665_10418700
630 Ga0207691_10081751
631 Ga0207711_10126630
632 Ga0207689_10006188
633 Ga0207689_10225103
634 Ga0207661_10023769
635 Ga0207661_10072782
636 Ga0207661_10218545
637 Ga0207679_10001181
638 Ga0207679_10089394
639 Ga0207679_10127882
640 Ga0207679_10154077
641 Ga0207679_10162797
642 Ga0207679_10902558
643 Ga0207667_10012965
644 Ga0207667_10706155
645 Ga0207651_10871660
646 Ga0207640_10015605
647 Ga0207677_10010194
648 Ga0207677_10065721
649 Ga0207703_10009729
650 Ga0207639_10157076
651 Ga0207639_10456067
652 Ga0207639_10600121
653 Ga0207678_10076997
654 Ga0207702_10936949
655 Ga0207641_10020602
656 Ga0207641_10236673
657 Ga0207648_10075945
658 Ga0207648_10091176
659 Ga0207648_10350250
660 Ga0207676_10008723
661 Ga0207676_10155944
662 Ga0207676_10799415
663 Ga0207674_10002556
664 Ga0207674_10015716
665 Ga0207674_10094570
666 Ga0207674_10858804
667 Ga0207675_100401681
668 Ga0207675_100406860
669 Ga0207698_10158745
670 Ga0207698_10252174
671 Ga0207698_10714770
672 Ga0265356_1000594
673 Ga0268266_10320688
674 Ga0268266_11068039
675 Ga0268265_10760251
676 Ga0268264_10031227
677 Ga0268264_10105672
678 Ga0265334_10061322
679 Ga0265762_1001149
680 Ga0265762_1004083
681 Ga0265760_10001746
682 Ga0265760_10070039
683 Ga0265332_10022180
684 Ga0265320_10009347
685 Ga0265325_10025593
686 Ga0265331_10042293
687 Ga0265316_10008794
688 Ga0307509_10176767
689 Ga0307414_10065450
690 Ga0307414_10197991
691 Ga0316214_1004040
692 Ga0373923_0285930
693 Ga0373936_0019326
694 Ga0373943_0121481
695 Ga0316574_0034255
696 Ga0373924_0107843
697 Ga0373931_0500663
698 Ga0373935_0096800
699 Ga0373933_0360732
700 Ga0373937_0289640
701 Ga0373925_0102342
702 Ga0373925_0124816
703 Ga0395900_0239534
704 Ga0395898_0544392
705 Ga0395905_0276325
706 Ga0436364_0607028
707 Ga0395901_0413123
708 Ga0436360_0273599
709 Ga0436360_1340491
710 Ga0436363_0889922
711 Ga0466969_0247710
712 Ga0466963_0008639
713 Ga0453684_0302168
714 Ga0453684_1133629
715 Ga0466957_0000197
716 Ga0466957_0000575
717 Ga0466957_0084100
718 Ga0451576_0048203
719 Ga0451576_0123365
720 Ga0466958_0103190
721 Ga0466967_0006787
722 Ga0466967_0394627
723 Ga0495580_0001482
724 Ga0495580_0046879
725 Ga0495580_0488560
726 Ga0495664_0025680
727 Ga0495594_0115219
728 Ga0495630_0064920
729 Ga0495587_0396612
730 Ga0495657_0363590
731 Ga0495675_0014970
732 Ga0496104_0255052
733 Ga0496106_0152456
734 Ga0496109_0437059
735 Ga0496110_0048917
736 Ga0496112_0010193
737 Ga0496112_0020533
738 Ga0496113_0454123
739 Ga0496115_0100261
740 Ga0496116_0000213
741 Ga0496119_0001124
742 Ga0496119_0012435
743 Ga0496119_0033337
744 Ga0496120_0000003
745 Ga0496120_0003302
746 Ga0496122_0044767
747 Ga0496123_0037039
748 Ga0496125_0000027
749 Ga0496126_0002284
750 Ga0496126_0101699
751 Ga0501300_002028
752 Ga0501033_0165482
753 Ga0501033_0251661
754 Ga0501048_0322311
755 Ga0501075_0755016
756 Ga0501079_0492774
757 nmdc:mga08x19_19725_c1
758 Ga0495601_0014427
759 Ga0500583_0000751
760 Ga0500589_036826
761 Ga0501082_0072359
762 Ga0530510_0211192
763 2881641715
764 2990276338

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14066

DUF4256

Protein of unknown function (DUF4256)

41

213

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
3l7t-assembly2.cif.gz_C crystal structure of smu.1112c 0.6298 50 77
4igx-assembly4.cif.gz_D crystal structure of kirola (act d 11) - triclinic form 0.5714 59 77
4igw-assembly2.cif.gz_B crystal structure of kirola (act d 11) in p6122 space group 0.5588 59 77
4rej-assembly1.cif.gz_A crystal structure of ginseng major latex-like protein 151 (glp) from panax ginseng. (crystal-3) 0.5338 59 77
4reh-assembly1.cif.gz_A crystal structure of ginseng major latex-like protein 151 (glp) from panax ginseng. (crystal-1) 0.5244 59 77
ID Description Score Start End Superfamily
af_Q9LHD8_51_311_2.120.10.80 Mainly Beta;6 Propeller;Neuraminidase;Kelch-type beta propeller 0.6127 50 77 2.120.10.80
af_P52096_9_128_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.5976 44 77 3.10.180.10
4igxC00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.5581 59 77 3.30.530.20
af_Q5NA90_43_292_2.120.10.80 Mainly Beta;6 Propeller;Neuraminidase;Kelch-type beta propeller 0.4993 57 83 2.120.10.80
af_B4FQ89_10_332_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.4959 57 89 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A2V9W7L6-F1-model_v4 DUF4256 domain-containing protein 0.9747 2 128
AF-A0A1M6PGL9-F1-model_v4 LytTr DNA-binding domain-containing protein 0.9645 2 136 GO:0000156
GO:0003677
AF-M6JPN8-F1-model_v4 DUF4256 domain-containing protein 0.9632 6 73
AF-A0A7X7IGS1-F1-model_v4 deleted 0.9612 11 151
AF-A0A4Q6ATW6-F1-model_v4 DUF4256 family protein 0.9563 11 130

Map