F429299

General Info

Members Datasets Scaffolds Average Seq Length
382 233 764 98

Family's Representative Sequence

Representative Sequence 3300028381|Ga0268264_10438939|Ga0268264_104389392
Length 115
Sequence MSMVRVVMPAHLRTLAKVSGEVQLEIKGPVTQRSILNALEDRYPMLQGTIRDHVTQQRRAFVRFFACQEDLSHESPDAPLPDAVAAAGLPAGTSTPRGGTGSNVCFRRVTVRSPG

Samples

Sample ID Description Type Environment
1 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
61 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
67 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
68 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
69 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
70 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
71 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
72 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
74 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
75 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
76 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
77 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
78 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
79 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
80 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
81 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
83 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
84 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
85 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
87 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
88 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
90 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
91 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
92 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
93 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
94 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
95 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
96 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
97 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
98 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
99 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
100 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
101 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
102 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
103 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
104 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
105 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
106 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
107 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
108 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
109 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
110 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
111 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
112 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
113 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
114 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
115 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
171 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
174 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
175 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
176 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
177 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
178 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
179 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
180 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
181 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
182 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
183 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
184 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
185 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
186 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
187 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
188 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
189 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
190 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
191 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
192 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
193 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
194 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
195 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
196 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
197 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
198 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
199 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
200 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
201 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
202 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
203 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
204 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
205 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
206 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
207 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
208 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
218 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
219 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
220 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
221 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
222 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
224 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
225 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
226 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
227 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
228 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
229 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
230 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
231 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
232 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
233 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.43
Metatranscriptomes 1.57
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.26
Nodule 0
Rhizoplane 4.71
Rhizosphere 94.76
Stem 0
Stem Tuber 0
Unclassified 5.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0268264_10438939 3300028381 Bacteria 1262
2 JGI24035J26624_1004934 3300002126 Bacteria 1271
3 Ga0065715_10369885 3300005293 Bacteria 922
4 Ga0065707_10135231 3300005295 Bacteria 1849
5 Ga0070658_10000949 3300005327 Bacteria 24773
6 Ga0070676_10074509 3300005328 Bacteria 2044
7 Ga0070676_10837667 3300005328 Bacteria 681
8 Ga0070690_100120981 3300005330 Bacteria 1757
9 Ga0070677_10004028 3300005333 Bacteria 4772
10 Ga0068869_100544184 3300005334 Bacteria 974
11 Ga0070666_10338246 3300005335 Bacteria 1075
12 Ga0070682_101863329 3300005337 Bacteria 526
13 Ga0068868_100015011 3300005338 Bacteria 5721
14 Ga0068868_100653802 3300005338 Bacteria 936
15 Ga0070660_100101937 3300005339 Bacteria 2275
16 Ga0070660_100763838 3300005339 Bacteria 812
17 Ga0070689_100316357 3300005340 Bacteria 1302
18 Ga0070687_100014457 3300005343 Bacteria 3545
19 Ga0070661_100000337 3300005344 Bacteria 37436
20 Ga0070661_100022437 3300005344 Bacteria 4520
21 Ga0070692_10121713 3300005345 Bacteria 1456
22 Ga0070692_10124769 3300005345 Bacteria 1440
23 Ga0070668_100006297 3300005347 Bacteria 8787
24 Ga0070669_100019201 3300005353 Bacteria 4883
25 Ga0070669_100219283 3300005353 Bacteria 1503
26 Ga0070674_100557373 3300005356 Bacteria 962
27 Ga0070674_101780777 3300005356 Bacteria 558
28 Ga0070673_100238716 3300005364 Bacteria 1579
29 Ga0070673_102219166 3300005364 Bacteria 522
30 Ga0070688_100015357 3300005365 Bacteria 4356
31 Ga0070659_100094328 3300005366 Bacteria 2403
32 Ga0070659_100323327 3300005366 Bacteria 1290
33 Ga0070667_100102200 3300005367 Bacteria 2477
34 Ga0070703_10063690 3300005406 Bacteria 1213
35 Ga0070703_10169280 3300005406 Unclassified 835
36 Ga0070709_10548900 3300005434 Bacteria 884
37 Ga0070709_10683285 3300005434 Unclassified 797
38 Ga0070709_11501311 3300005434 Bacteria 547
39 Ga0070714_101657704 3300005435 Bacteria 625
40 Ga0070713_100090904 3300005436 Bacteria 2625
41 Ga0070701_10046863 3300005438 Bacteria 2224
42 Ga0070711_100017806 3300005439 Bacteria 4527
43 Ga0070711_100140912 3300005439 Bacteria 1808
44 Ga0070711_100345497 3300005439 Bacteria 1195
45 Ga0070705_100002263 3300005440 Bacteria 9744
46 Ga0070700_100014089 3300005441 Bacteria 4509
47 Ga0070694_100022522 3300005444 Bacteria 4037
48 Ga0070708_101400750 3300005445 Unclassified 652
49 Ga0070708_102155857 3300005445 Bacteria 515
50 Ga0070678_100077570 3300005456 Bacteria 2507
51 Ga0070678_100208389 3300005456 Bacteria 1618
52 Ga0070662_100115727 3300005457 Bacteria 2048
53 Ga0070681_10195525 3300005458 Bacteria 1941
54 Ga0070681_10995856 3300005458 Bacteria 758
55 Ga0068867_100079473 3300005459 Bacteria 2468
56 Ga0070685_10008972 3300005466 Bacteria 5156
57 Ga0070707_100002793 3300005468 Bacteria 16615
58 Ga0070707_101570167 3300005468 Unclassified 625
59 Ga0070698_100010196 3300005471 Bacteria 10039
60 Ga0070699_101863858 3300005518 Bacteria 550
61 Ga0070679_100308765 3300005530 Bacteria 1532
62 Ga0070679_101162278 3300005530 Unclassified 717
63 Ga0070684_100126957 3300005535 Bacteria 2298
64 Ga0070684_101768665 3300005535 Bacteria 583
65 Ga0068853_100148754 3300005539 Bacteria 2107
66 Ga0070672_100009338 3300005543 Bacteria 6757
67 Ga0070686_100004525 3300005544 Bacteria 7665
68 Ga0070695_100143570 3300005545 Bacteria 1658
69 Ga0070695_100375276 3300005545 Bacteria 1072
70 Ga0070693_100024126 3300005547 Bacteria 3258
71 Ga0070693_100358296 3300005547 Unclassified 1000
72 Ga0070665_100210789 3300005548 Bacteria 1944
73 Ga0070665_100392862 3300005548 Bacteria 1395
74 Ga0070704_100000100 3300005549 Bacteria 29970
75 Ga0068855_100568320 3300005563 Bacteria 1226
76 Ga0068855_102056560 3300005563 Bacteria 576
77 Ga0070664_100024450 3300005564 Bacteria 4996
78 Ga0070664_101265322 3300005564 Bacteria 696
79 Ga0068857_100002114 3300005577 Bacteria 16152
80 Ga0068857_100300274 3300005577 Bacteria 1480
81 Ga0068857_100709483 3300005577 Bacteria 956
82 Ga0068856_100535420 3300005614 Bacteria 1192
83 Ga0068852_100070843 3300005616 Bacteria 3059
84 Ga0068859_100007870 3300005617 Bacteria 10815
85 Ga0068859_100041961 3300005617 Bacteria 4595
86 Ga0068864_100076263 3300005618 Bacteria 2929
87 Ga0068864_100454041 3300005618 Bacteria 1226
88 Ga0068861_100097989 3300005719 Bacteria 2327
89 Ga0068861_100160794 3300005719 Bacteria 1852
90 Ga0068851_10471856 3300005834 Bacteria 749
91 Ga0068870_10071387 3300005840 Bacteria 1895
92 Ga0068870_10957121 3300005840 Bacteria 608
93 Ga0068863_100036748 3300005841 Bacteria 4665
94 Ga0068863_100516713 3300005841 Bacteria 1177
95 Ga0068858_100042569 3300005842 Bacteria 4210
96 Ga0068858_101134220 3300005842 Bacteria 768
97 Ga0068858_101140139 3300005842 Bacteria 766
98 Ga0068860_100015099 3300005843 Bacteria 7548
99 Ga0068860_101808992 3300005843 Bacteria 633
100 Ga0068862_100075317 3300005844 Bacteria 2919
101 Ga0068862_100099900 3300005844 Bacteria 2537
102 Ga0068862_100248646 3300005844 Bacteria 1620
103 Ga0081455_10221440 3300005937 Bacteria 1402
104 Ga0081538_10195231 3300005981 Bacteria 841
105 Ga0075432_10025491 3300006058 Bacteria 2029
106 Ga0070715_10001646 3300006163 Bacteria 6617
107 Ga0070716_101014608 3300006173 Unclassified 657
108 Ga0070712_100015943 3300006175 Bacteria 4847
109 Ga0097621_100040098 3300006237 Bacteria 3764
110 Ga0097621_100761817 3300006237 Bacteria 895
111 Ga0068871_100028507 3300006358 Bacteria 4377
112 Ga0068871_100081657 3300006358 Bacteria 2678
113 Ga0068871_100588474 3300006358 Bacteria 1011
114 Ga0068871_100950979 3300006358 Bacteria 798
115 Ga0075428_100013256 3300006844 Bacteria 9171
116 Ga0075428_100018609 3300006844 Bacteria 7677
117 Ga0075428_100356001 3300006844 Bacteria 1571
118 Ga0075428_100875782 3300006844 Bacteria 953
119 Ga0075430_100001972 3300006846 Bacteria 16903
120 Ga0075430_100398401 3300006846 Bacteria 1136
121 Ga0075431_100005811 3300006847 Bacteria 12208
122 Ga0075433_10299870 3300006852 Bacteria 1423
123 Ga0075434_100018341 3300006871 Bacteria 6759
124 Ga0075429_100002325 3300006880 Bacteria 15963
125 Ga0075429_100017513 3300006880 Bacteria 6195
126 Ga0068865_100035256 3300006881 Bacteria 3363
127 Ga0068865_101379974 3300006881 Bacteria 628
128 Ga0097620_100007870 3300006931 Bacteria 10815
129 Ga0097620_100041961 3300006931 Bacteria 4595
130 Ga0075435_100881849 3300007076 Bacteria 780
131 Ga0099794_10022741 3300007265 Bacteria 2860
132 Ga0099794_10077334 3300007265 Bacteria 1637
133 Ga0105240_10461249 3300009093 Bacteria 1420
134 Ga0111539_10087273 3300009094 Bacteria 3665
135 Ga0105245_10001678 3300009098 Bacteria 20145
136 Ga0105245_11258199 3300009098 Bacteria 788
137 Ga0105245_12943045 3300009098 Bacteria 528
138 Ga0105247_11772784 3300009101 Unclassified 513
139 Ga0114129_11885786 3300009147 Unclassified 725
140 Ga0105243_10374269 3300009148 Bacteria 1315
141 Ga0105243_10722403 3300009148 Bacteria 974
142 Ga0105243_10756436 3300009148 Bacteria 953
143 Ga0105243_11220892 3300009148 Bacteria 766
144 Ga0105243_12193737 3300009148 Bacteria 589
145 Ga0105243_13065194 3300009148 Unclassified 506
146 Ga0105241_10063260 3300009174 Bacteria 2854
147 Ga0105241_10076715 3300009174 Bacteria 2607
148 Ga0105241_10252006 3300009174 Bacteria 1497
149 Ga0105241_11999042 3300009174 Bacteria 571
150 Ga0105242_10265919 3300009176 Bacteria 1551
151 Ga0105248_10026504 3300009177 Bacteria 6448
152 Ga0105248_10128008 3300009177 Bacteria 2865
153 Ga0105238_10032392 3300009551 Bacteria 5320
154 Ga0105238_10092451 3300009551 Bacteria 3013
155 Ga0105249_10000242 3300009553 Bacteria 60635
156 Ga0105249_10053011 3300009553 Bacteria 3706
157 Ga0105249_10287277 3300009553 Bacteria 1645
158 Ga0105239_10006913 3300010375 Bacteria 13088
159 Ga0105239_10499567 3300010375 Bacteria 1383
160 Ga0105239_11689628 3300010375 Unclassified 733
161 Ga0105239_12687853 3300010375 Bacteria 581
162 Ga0105246_10166264 3300011119 Bacteria 1685
163 Ga0105246_11372498 3300011119 Bacteria 658
164 Ga0157315_1062589 3300012508 Bacteria 528
165 Ga0157373_10400437 3300013100 Bacteria 984
166 Ga0157369_10168221 3300013105 Bacteria 2311
167 Ga0157369_11832174 3300013105 Unclassified 616
168 Ga0157374_10002950 3300013296 Bacteria 14245
169 Ga0157374_10613909 3300013296 Bacteria 1098
170 Ga0157374_10789668 3300013296 Bacteria 965
171 Ga0157378_10067071 3300013297 Bacteria 3215
172 Ga0157378_10422235 3300013297 Bacteria 1318
173 Ga0163162_10001837 3300013306 Bacteria 19975
174 Ga0163162_10066631 3300013306 Bacteria 3649
175 Ga0163162_10205237 3300013306 Bacteria 2100
176 Ga0163162_10236134 3300013306 Bacteria 1958
177 Ga0163162_10881071 3300013306 Bacteria 1009
178 Ga0157372_10015627 3300013307 Bacteria 8139
179 Ga0157372_10149994 3300013307 Bacteria 2690
180 Ga0157372_10242881 3300013307 Bacteria 2090
181 Ga0157375_10422279 3300013308 Bacteria 1499
182 Ga0157375_10690908 3300013308 Bacteria 1174
183 Ga0163163_10553257 3300014325 Bacteria 1213
184 Ga0163163_10680148 3300014325 Unclassified 1093
185 Ga0157380_10003122 3300014326 Bacteria 11297
186 Ga0157380_10880453 3300014326 Bacteria 920
187 Ga0157377_10034103 3300014745 Bacteria 2783
188 Ga0157379_10290905 3300014968 Bacteria 1488
189 Ga0157379_10353104 3300014968 Bacteria 1346
190 Ga0157379_10723049 3300014968 Bacteria 936
191 Ga0157376_10076714 3300014969 Bacteria 2856
192 Ga0157376_10183456 3300014969 Bacteria 1915
193 Ga0163161_10008476 3300017792 Bacteria 7119
194 Ga0163161_10483942 3300017792 Bacteria 1005
195 Ga0197907_10698199 3300020069 Bacteria 563
196 Ga0206350_10144234 3300020080 Bacteria 2521
197 Ga0206350_11405589 3300020080 Bacteria 1054
198 Ga0154015_1255813 3300020610 Bacteria 1637
199 Ga0224712_10055467 3300022467 Bacteria 1559
200 Ga0207697_10000122 3300025315 Bacteria 36998
201 Ga0207656_10509246 3300025321 Bacteria 611
202 Ga0207653_10061865 3300025885 Bacteria 1264
203 Ga0207682_10001800 3300025893 Bacteria 9806
204 Ga0207688_10002634 3300025901 Bacteria 9709
205 Ga0207680_10158337 3300025903 Bacteria 1516
206 Ga0207685_10043273 3300025905 Bacteria 1696
207 Ga0207685_10330701 3300025905 Bacteria 763
208 Ga0207645_10000742 3300025907 Bacteria 27179
209 Ga0207643_10002083 3300025908 Bacteria 11020
210 Ga0207643_10552594 3300025908 Bacteria 739
211 Ga0207705_10019850 3300025909 Bacteria 4807
212 Ga0207684_10036843 3300025910 Bacteria 4151
213 Ga0207693_10000777 3300025915 Bacteria 28620
214 Ga0207663_10005767 3300025916 Bacteria 6270
215 Ga0207663_10420310 3300025916 Bacteria 1026
216 Ga0207660_10816060 3300025917 Bacteria 761
217 Ga0207662_10001137 3300025918 Bacteria 12553
218 Ga0207657_10135164 3300025919 Bacteria 2018
219 Ga0207657_11099922 3300025919 Unclassified 607
220 Ga0207657_11115930 3300025919 Bacteria 602
221 Ga0207649_10000481 3300025920 Bacteria 28440
222 Ga0207649_10037353 3300025920 Bacteria 2934
223 Ga0207652_10228704 3300025921 Bacteria 1676
224 Ga0207652_10369356 3300025921 Bacteria 1295
225 Ga0207646_10039602 3300025922 Bacteria 4242
226 Ga0207646_10440427 3300025922 Bacteria 1176
227 Ga0207681_10112591 3300025923 Bacteria 1982
228 Ga0207681_10210726 3300025923 Bacteria 1497
229 Ga0207681_10553184 3300025923 Bacteria 947
230 Ga0207694_10101226 3300025924 Bacteria 2283
231 Ga0207694_10223195 3300025924 Bacteria 1537
232 Ga0207659_10023012 3300025926 Bacteria 4154
233 Ga0207687_10092068 3300025927 Bacteria 2213
234 Ga0207700_10046680 3300025928 Bacteria 3205
235 Ga0207644_10132377 3300025931 Bacteria 1911
236 Ga0207644_10841734 3300025931 Bacteria 768
237 Ga0207690_10070686 3300025932 Bacteria 2405
238 Ga0207690_10375954 3300025932 Bacteria 1128
239 Ga0207690_10402702 3300025932 Bacteria 1091
240 Ga0207706_10020751 3300025933 Bacteria 5903
241 Ga0207709_10146997 3300025935 Bacteria 1627
242 Ga0207709_10633653 3300025935 Bacteria 850
243 Ga0207709_10713272 3300025935 Bacteria 803
244 Ga0207709_11448595 3300025935 Bacteria 569
245 Ga0207670_10144197 3300025936 Bacteria 1759
246 Ga0207669_10432078 3300025937 Bacteria 1039
247 Ga0207704_10265696 3300025938 Bacteria 1296
248 Ga0207704_10893275 3300025938 Unclassified 747
249 Ga0207691_10018345 3300025940 Bacteria 6629
250 Ga0207711_10138649 3300025941 Bacteria 2186
251 Ga0207711_10638519 3300025941 Bacteria 993
252 Ga0207689_10042217 3300025942 Bacteria 3773
253 Ga0207689_10658236 3300025942 Unclassified 883
254 Ga0207679_10117553 3300025945 Bacteria 2110
255 Ga0207679_10849878 3300025945 Bacteria 833
256 Ga0207679_10854574 3300025945 Bacteria 831
257 Ga0207667_10375988 3300025949 Bacteria 1448
258 Ga0207651_10188649 3300025960 Bacteria 1642
259 Ga0207651_10211604 3300025960 Bacteria 1561
260 Ga0207651_11694770 3300025960 Bacteria 569
261 Ga0207712_10000690 3300025961 Bacteria 26074
262 Ga0207712_10002230 3300025961 Bacteria 12610
263 Ga0207712_10185805 3300025961 Bacteria 1636
264 Ga0207712_11735143 3300025961 Bacteria 560
265 Ga0207668_10094364 3300025972 Bacteria 2206
266 Ga0207668_11531285 3300025972 Bacteria 602
267 Ga0207640_11417158 3300025981 Bacteria 623
268 Ga0207677_10159130 3300026023 Bacteria 1752
269 Ga0207677_10192529 3300026023 Bacteria 1614
270 Ga0207677_10323379 3300026023 Bacteria 1283
271 Ga0207703_10723473 3300026035 Bacteria 947
272 Ga0207703_12115505 3300026035 Bacteria 539
273 Ga0207639_10198072 3300026041 Bacteria 1720
274 Ga0207708_10051264 3300026075 Bacteria 3141
275 Ga0207708_10149790 3300026075 Bacteria 1835
276 Ga0207702_10288890 3300026078 Bacteria 1553
277 Ga0207641_10067469 3300026088 Bacteria 3064
278 Ga0207641_10965395 3300026088 Bacteria 848
279 Ga0207648_10062063 3300026089 Bacteria 3259
280 Ga0207648_10618099 3300026089 Bacteria 1000
281 Ga0207648_12212112 3300026089 Bacteria 511
282 Ga0207676_10137044 3300026095 Bacteria 2090
283 Ga0207676_10409497 3300026095 Bacteria 1269
284 Ga0207676_10857481 3300026095 Bacteria 889
285 Ga0207674_10005378 3300026116 Bacteria 15233
286 Ga0207674_10580156 3300026116 Bacteria 1083
287 Ga0207674_10700679 3300026116 Bacteria 978
288 Ga0207675_100101215 3300026118 Bacteria 2715
289 Ga0207675_100408579 3300026118 Bacteria 1339
290 Ga0207683_10004576 3300026121 Bacteria 11916
291 Ga0207683_10174872 3300026121 Bacteria 1945
292 Ga0207698_10082605 3300026142 Bacteria 2598
293 Ga0207698_10185595 3300026142 Bacteria 1847
294 Ga0209588_1262298 3300027671 Bacteria 525
295 Ga0209971_1105778 3300027682 Bacteria 690
296 Ga0209974_10087690 3300027876 Bacteria 1077
297 Ga0207428_10014456 3300027907 Bacteria 6857
298 Ga0268266_10121088 3300028379 Bacteria 2329
299 Ga0268266_10173365 3300028379 Bacteria 1959
300 Ga0268265_10033013 3300028380 Bacteria 3758
301 Ga0268265_10074086 3300028380 Bacteria 2661
302 Ga0268265_10362630 3300028380 Bacteria 1327
303 Ga0268264_10034336 3300028381 Bacteria 4171
304 Ga0268264_10056952 3300028381 Bacteria 3268
305 Ga0265760_10000654 3300031090 Bacteria 9835
306 Ga0265325_10003360 3300031241 Bacteria 10501
307 Ga0265316_10731856 3300031344 Bacteria 696
308 Ga0265313_10002605 3300031595 Bacteria 15367
309 Ga0307415_100601414 3300032126 Bacteria 979
310 Ga0373928_0049359 3300035084 Bacteria 989
311 Ga0373951_0019008 3300035091 Bacteria 1563
312 Ga0373932_0021436 3300035112 Bacteria 1706
313 Ga0373941_0247767 3300035115 Unclassified 694
314 Ga0373955_0392624 3300035172 Bacteria 843
315 Ga0373961_0095641 3300035241 Bacteria 955
316 Ga0373962_0010631 3300035242 Bacteria 2298
317 Ga0373947_1023358 3300035725 Bacteria 563
318 Ga0395900_0515676 3300037418 Bacteria 1144
319 Ga0395898_0405255 3300037466 Bacteria 1300
320 Ga0395901_1863042 3300038443 Unclassified 550
321 Ga0436365_0863322 3300039437 Bacteria 1127
322 Ga0436362_0057989 3300039453 Unclassified 521
323 Ga0436362_0831739 3300039453 Bacteria 871
324 Ga0439453_0049821 3300041408 Bacteria 844
325 Ga0439450_172052 3300042008 Bacteria 573
326 Ga0450906_086961 3300042145 Bacteria 566
327 Ga0451577_1734747 3300042876 Bacteria 549
328 Ga0453683_1161262 3300044673 Bacteria 516
329 Ga0451576_0036173 3300045051 Bacteria 5235
330 Ga0451576_1203805 3300045051 Bacteria 791
331 Ga0495659_0069515 3300046664 Bacteria 1317
332 Ga0496100_0835590 3300048903 Bacteria 722
333 Ga0496102_0086708 3300048905 Bacteria 2892
334 Ga0496102_0096198 3300048905 Bacteria 2745
335 Ga0496102_1459435 3300048905 Bacteria 603
336 Ga0496103_0483265 3300048906 Bacteria 793
337 Ga0496104_0163292 3300048907 Unclassified 2136
338 Ga0496106_0673027 3300048909 Bacteria 826
339 Ga0496108_0238927 3300048911 Bacteria 1580
340 Ga0496108_0307047 3300048911 Bacteria 1382
341 Ga0496109_0235279 3300048912 Bacteria 1724
342 Ga0496109_0240415 3300048912 Bacteria 1704
343 Ga0496110_0511610 3300048913 Bacteria 1093
344 Ga0496110_0620123 3300048913 Bacteria 980
345 Ga0496113_0662864 3300048916 Bacteria 834
346 Ga0496113_1048959 3300048916 Bacteria 641
347 Ga0496113_1450061 3300048916 Bacteria 531
348 Ga0496114_0045858 3300048917 Bacteria 3632
349 Ga0496114_0450589 3300048917 Bacteria 1140
350 Ga0501033_0635153 3300049570 Bacteria 730
351 Ga0501036_0423971 3300049572 Bacteria 1109
352 Ga0501037_0127761 3300049573 Bacteria 1824
353 Ga0501038_0589657 3300049574 Bacteria 842
354 Ga0501039_0404029 3300049575 Bacteria 1073
355 Ga0501039_0693117 3300049575 Bacteria 797
356 Ga0501043_0104493 3300049579 Bacteria 2226
357 Ga0501046_0038871 3300049580 Bacteria 3816
358 Ga0501047_0080691 3300049581 Bacteria 3127
359 Ga0501047_0102699 3300049581 Bacteria 2738
360 Ga0501048_0851381 3300049582 Bacteria 655
361 Ga0501070_0329386 3300049586 Bacteria 1241
362 Ga0501072_0074793 3300049588 Bacteria 2679
363 Ga0501073_0071880 3300049589 Bacteria 2410
364 Ga0501076_0472395 3300049592 Bacteria 1033
365 Ga0501076_0776678 3300049592 Bacteria 790
366 Ga0501079_0718066 3300049741 Bacteria 787
367 Ga0501035_0009513 3300049822 Bacteria 9038
368 Ga0501035_0982998 3300049822 Bacteria 664
369 Ga0501044_0066467 3300049823 Bacteria 3676
370 nmdc:mga09592_18860_c1 3300050508 Bacteria 5659
371 nmdc:mga09592_41381_c1 3300050508 Bacteria 3875
372 nmdc:mga0qj67_371968_c1 3300050509 Bacteria 1154
373 nmdc:mga0qj67_70_c1 3300050509 Bacteria 73245
374 nmdc:mga06r32_6184_c1 3300050510 Bacteria 10747
375 nmdc:mga08y16_1333855_c1 3300050511 Bacteria 683
376 nmdc:mga0n895_4056_c1 3300050512 Bacteria 11916
377 nmdc:mga0rr50_39338_c1 3300050513 Bacteria 3429
378 nmdc:mga0a205_13416_c1 3300050515 Bacteria 7629
379 Ga0500559_0003914 3300053136 Bacteria 7190
380 Ga0501084_1043617 3300054114 Bacteria 687
381 Ga0501082_0532901 3300060353 Bacteria 1027
382 Ga0501082_0641510 3300060353 Bacteria 929
383 Ga0268264_10438939
384 JGI24035J26624_1004934
385 Ga0065715_10369885
386 Ga0065707_10135231
387 Ga0070658_10000949
388 Ga0070676_10074509
389 Ga0070676_10837667
390 Ga0070690_100120981
391 Ga0070677_10004028
392 Ga0068869_100544184
393 Ga0070666_10338246
394 Ga0070682_101863329
395 Ga0068868_100015011
396 Ga0068868_100653802
397 Ga0070660_100101937
398 Ga0070660_100763838
399 Ga0070689_100316357
400 Ga0070687_100014457
401 Ga0070661_100000337
402 Ga0070661_100022437
403 Ga0070692_10121713
404 Ga0070692_10124769
405 Ga0070668_100006297
406 Ga0070669_100019201
407 Ga0070669_100219283
408 Ga0070674_100557373
409 Ga0070674_101780777
410 Ga0070673_100238716
411 Ga0070673_102219166
412 Ga0070688_100015357
413 Ga0070659_100094328
414 Ga0070659_100323327
415 Ga0070667_100102200
416 Ga0070703_10063690
417 Ga0070703_10169280
418 Ga0070709_10548900
419 Ga0070709_10683285
420 Ga0070709_11501311
421 Ga0070714_101657704
422 Ga0070713_100090904
423 Ga0070701_10046863
424 Ga0070711_100017806
425 Ga0070711_100140912
426 Ga0070711_100345497
427 Ga0070705_100002263
428 Ga0070700_100014089
429 Ga0070694_100022522
430 Ga0070708_101400750
431 Ga0070708_102155857
432 Ga0070678_100077570
433 Ga0070678_100208389
434 Ga0070662_100115727
435 Ga0070681_10195525
436 Ga0070681_10995856
437 Ga0068867_100079473
438 Ga0070685_10008972
439 Ga0070707_100002793
440 Ga0070707_101570167
441 Ga0070698_100010196
442 Ga0070699_101863858
443 Ga0070679_100308765
444 Ga0070679_101162278
445 Ga0070684_100126957
446 Ga0070684_101768665
447 Ga0068853_100148754
448 Ga0070672_100009338
449 Ga0070686_100004525
450 Ga0070695_100143570
451 Ga0070695_100375276
452 Ga0070693_100024126
453 Ga0070693_100358296
454 Ga0070665_100210789
455 Ga0070665_100392862
456 Ga0070704_100000100
457 Ga0068855_100568320
458 Ga0068855_102056560
459 Ga0070664_100024450
460 Ga0070664_101265322
461 Ga0068857_100002114
462 Ga0068857_100300274
463 Ga0068857_100709483
464 Ga0068856_100535420
465 Ga0068852_100070843
466 Ga0068859_100007870
467 Ga0068859_100041961
468 Ga0068864_100076263
469 Ga0068864_100454041
470 Ga0068861_100097989
471 Ga0068861_100160794
472 Ga0068851_10471856
473 Ga0068870_10071387
474 Ga0068870_10957121
475 Ga0068863_100036748
476 Ga0068863_100516713
477 Ga0068858_100042569
478 Ga0068858_101134220
479 Ga0068858_101140139
480 Ga0068860_100015099
481 Ga0068860_101808992
482 Ga0068862_100075317
483 Ga0068862_100099900
484 Ga0068862_100248646
485 Ga0081455_10221440
486 Ga0081538_10195231
487 Ga0075432_10025491
488 Ga0070715_10001646
489 Ga0070716_101014608
490 Ga0070712_100015943
491 Ga0097621_100040098
492 Ga0097621_100761817
493 Ga0068871_100028507
494 Ga0068871_100081657
495 Ga0068871_100588474
496 Ga0068871_100950979
497 Ga0075428_100013256
498 Ga0075428_100018609
499 Ga0075428_100356001
500 Ga0075428_100875782
501 Ga0075430_100001972
502 Ga0075430_100398401
503 Ga0075431_100005811
504 Ga0075433_10299870
505 Ga0075434_100018341
506 Ga0075429_100002325
507 Ga0075429_100017513
508 Ga0068865_100035256
509 Ga0068865_101379974
510 Ga0097620_100007870
511 Ga0097620_100041961
512 Ga0075435_100881849
513 Ga0099794_10022741
514 Ga0099794_10077334
515 Ga0105240_10461249
516 Ga0111539_10087273
517 Ga0105245_10001678
518 Ga0105245_11258199
519 Ga0105245_12943045
520 Ga0105247_11772784
521 Ga0114129_11885786
522 Ga0105243_10374269
523 Ga0105243_10722403
524 Ga0105243_10756436
525 Ga0105243_11220892
526 Ga0105243_12193737
527 Ga0105243_13065194
528 Ga0105241_10063260
529 Ga0105241_10076715
530 Ga0105241_10252006
531 Ga0105241_11999042
532 Ga0105242_10265919
533 Ga0105248_10026504
534 Ga0105248_10128008
535 Ga0105238_10032392
536 Ga0105238_10092451
537 Ga0105249_10000242
538 Ga0105249_10053011
539 Ga0105249_10287277
540 Ga0105239_10006913
541 Ga0105239_10499567
542 Ga0105239_11689628
543 Ga0105239_12687853
544 Ga0105246_10166264
545 Ga0105246_11372498
546 Ga0157315_1062589
547 Ga0157373_10400437
548 Ga0157369_10168221
549 Ga0157369_11832174
550 Ga0157374_10002950
551 Ga0157374_10613909
552 Ga0157374_10789668
553 Ga0157378_10067071
554 Ga0157378_10422235
555 Ga0163162_10001837
556 Ga0163162_10066631
557 Ga0163162_10205237
558 Ga0163162_10236134
559 Ga0163162_10881071
560 Ga0157372_10015627
561 Ga0157372_10149994
562 Ga0157372_10242881
563 Ga0157375_10422279
564 Ga0157375_10690908
565 Ga0163163_10553257
566 Ga0163163_10680148
567 Ga0157380_10003122
568 Ga0157380_10880453
569 Ga0157377_10034103
570 Ga0157379_10290905
571 Ga0157379_10353104
572 Ga0157379_10723049
573 Ga0157376_10076714
574 Ga0157376_10183456
575 Ga0163161_10008476
576 Ga0163161_10483942
577 Ga0197907_10698199
578 Ga0206350_10144234
579 Ga0206350_11405589
580 Ga0154015_1255813
581 Ga0224712_10055467
582 Ga0207697_10000122
583 Ga0207656_10509246
584 Ga0207653_10061865
585 Ga0207682_10001800
586 Ga0207688_10002634
587 Ga0207680_10158337
588 Ga0207685_10043273
589 Ga0207685_10330701
590 Ga0207645_10000742
591 Ga0207643_10002083
592 Ga0207643_10552594
593 Ga0207705_10019850
594 Ga0207684_10036843
595 Ga0207693_10000777
596 Ga0207663_10005767
597 Ga0207663_10420310
598 Ga0207660_10816060
599 Ga0207662_10001137
600 Ga0207657_10135164
601 Ga0207657_11099922
602 Ga0207657_11115930
603 Ga0207649_10000481
604 Ga0207649_10037353
605 Ga0207652_10228704
606 Ga0207652_10369356
607 Ga0207646_10039602
608 Ga0207646_10440427
609 Ga0207681_10112591
610 Ga0207681_10210726
611 Ga0207681_10553184
612 Ga0207694_10101226
613 Ga0207694_10223195
614 Ga0207659_10023012
615 Ga0207687_10092068
616 Ga0207700_10046680
617 Ga0207644_10132377
618 Ga0207644_10841734
619 Ga0207690_10070686
620 Ga0207690_10375954
621 Ga0207690_10402702
622 Ga0207706_10020751
623 Ga0207709_10146997
624 Ga0207709_10633653
625 Ga0207709_10713272
626 Ga0207709_11448595
627 Ga0207670_10144197
628 Ga0207669_10432078
629 Ga0207704_10265696
630 Ga0207704_10893275
631 Ga0207691_10018345
632 Ga0207711_10138649
633 Ga0207711_10638519
634 Ga0207689_10042217
635 Ga0207689_10658236
636 Ga0207679_10117553
637 Ga0207679_10849878
638 Ga0207679_10854574
639 Ga0207667_10375988
640 Ga0207651_10188649
641 Ga0207651_10211604
642 Ga0207651_11694770
643 Ga0207712_10000690
644 Ga0207712_10002230
645 Ga0207712_10185805
646 Ga0207712_11735143
647 Ga0207668_10094364
648 Ga0207668_11531285
649 Ga0207640_11417158
650 Ga0207677_10159130
651 Ga0207677_10192529
652 Ga0207677_10323379
653 Ga0207703_10723473
654 Ga0207703_12115505
655 Ga0207639_10198072
656 Ga0207708_10051264
657 Ga0207708_10149790
658 Ga0207702_10288890
659 Ga0207641_10067469
660 Ga0207641_10965395
661 Ga0207648_10062063
662 Ga0207648_10618099
663 Ga0207648_12212112
664 Ga0207676_10137044
665 Ga0207676_10409497
666 Ga0207676_10857481
667 Ga0207674_10005378
668 Ga0207674_10580156
669 Ga0207674_10700679
670 Ga0207675_100101215
671 Ga0207675_100408579
672 Ga0207683_10004576
673 Ga0207683_10174872
674 Ga0207698_10082605
675 Ga0207698_10185595
676 Ga0209588_1262298
677 Ga0209971_1105778
678 Ga0209974_10087690
679 Ga0207428_10014456
680 Ga0268266_10121088
681 Ga0268266_10173365
682 Ga0268265_10033013
683 Ga0268265_10074086
684 Ga0268265_10362630
685 Ga0268264_10034336
686 Ga0268264_10056952
687 Ga0265760_10000654
688 Ga0265325_10003360
689 Ga0265316_10731856
690 Ga0265313_10002605
691 Ga0307415_100601414
692 Ga0373928_0049359
693 Ga0373951_0019008
694 Ga0373932_0021436
695 Ga0373941_0247767
696 Ga0373955_0392624
697 Ga0373961_0095641
698 Ga0373962_0010631
699 Ga0373947_1023358
700 Ga0395900_0515676
701 Ga0395898_0405255
702 Ga0395901_1863042
703 Ga0436365_0863322
704 Ga0436362_0057989
705 Ga0436362_0831739
706 Ga0439453_0049821
707 Ga0439450_172052
708 Ga0450906_086961
709 Ga0451577_1734747
710 Ga0453683_1161262
711 Ga0451576_0036173
712 Ga0451576_1203805
713 Ga0495659_0069515
714 Ga0496100_0835590
715 Ga0496102_0086708
716 Ga0496102_0096198
717 Ga0496102_1459435
718 Ga0496103_0483265
719 Ga0496104_0163292
720 Ga0496106_0673027
721 Ga0496108_0238927
722 Ga0496108_0307047
723 Ga0496109_0235279
724 Ga0496109_0240415
725 Ga0496110_0511610
726 Ga0496110_0620123
727 Ga0496113_0662864
728 Ga0496113_1048959
729 Ga0496113_1450061
730 Ga0496114_0045858
731 Ga0496114_0450589
732 Ga0501033_0635153
733 Ga0501036_0423971
734 Ga0501037_0127761
735 Ga0501038_0589657
736 Ga0501039_0404029
737 Ga0501039_0693117
738 Ga0501043_0104493
739 Ga0501046_0038871
740 Ga0501047_0080691
741 Ga0501047_0102699
742 Ga0501048_0851381
743 Ga0501070_0329386
744 Ga0501072_0074793
745 Ga0501073_0071880
746 Ga0501076_0472395
747 Ga0501076_0776678
748 Ga0501079_0718066
749 Ga0501035_0009513
750 Ga0501035_0982998
751 Ga0501044_0066467
752 nmdc:mga09592_18860_c1
753 nmdc:mga09592_41381_c1
754 nmdc:mga0qj67_371968_c1
755 nmdc:mga0qj67_70_c1
756 nmdc:mga06r32_6184_c1
757 nmdc:mga08y16_1333855_c1
758 nmdc:mga0n895_4056_c1
759 nmdc:mga0rr50_39338_c1
760 nmdc:mga0a205_13416_c1
761 Ga0500559_0003914
762 Ga0501084_1043617
763 Ga0501082_0532901
764 Ga0501082_0641510

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
3po0-assembly1.cif.gz_A crystal structure of samp1 from haloferax volcanii 0.8466 3 98
4hro-assembly1.cif.gz_A crystal structure of h. volcanii small archaeal modifier protein 1 0.8429 3 91
1v8c-assembly1.cif.gz_A crystal structure of moad related protein from thermus thermophilus hb8 0.8143 3 98
3po0-assembly1.cif.gz_A crystal structure of samp1 from haloferax volcanii 0.8134 3 98
4n6e-assembly1.cif.gz_B-2 crystal structure of amycolatopsis orientalis bexx/cyso complex 0.8125 1 98
ID Description Score Start End Superfamily
4hroA00 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8428 3 91 3.10.20.30
4n6eB00 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8125 1 98 3.10.20.30
af_Q6MWY3_4_79_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8074 2 95 3.10.20.30
4n6eB00 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8046 1 98 3.10.20.30
1v8cB01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8024 3 91 3.10.20.30
ID Description Score Start End GO Terms
AF-A0A535NE45-F1-model_v4 MoaD/ThiS family protein 0.9978 1 46
AF-A0A534ZY62-F1-model_v4 MoaD/ThiS family protein 0.9816 1 84
AF-A0A1F8SIJ2-F1-model_v4 Molybdopterin synthase sulfur carrier subunit 0.9814 1 94
AF-A0A3N5W3B6-F1-model_v4 MoaD/ThiS family protein 0.9785 1 67
AF-A0A1G0SXB6-F1-model_v4 Molybdopterin synthase sulfur carrier subunit 0.9773 1 85

Map