F429295

General Info

Members Datasets Scaffolds Average Seq Length
382 230 764 233

Family's Representative Sequence

Representative Sequence 3300026095|Ga0207676_10817776|Ga0207676_108177762
Length 265
Sequence MRPAVEPVSMGKSFPPLAFSVYLRGISSNEADRWKSQYRSALIVGTGPGLSASLARLFSRNGLSVAIAARDTAKLAALAKETGAAVHKCNAAEPEDVAALFGAVEANAGPPEVVVYNASARARGPLVDLAPEDVRRAIEVSAFGAFLVSQQAARRMLPKRHGAIFLTGATAGVKGFALSSTFAMGKFALRGLAQSMARELSPQGIHVAHFVIDGGIRSATRPDPGNNPDSFLDPDAIAETYWAVLQQHRSAWSWEVEVRPWVEKF

Samples

Sample ID Description Type Environment
1 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
44 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
45 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
46 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
47 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
48 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
49 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
50 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
51 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
52 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
53 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
54 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
55 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
56 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
57 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
58 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
59 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
60 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
61 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
62 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
63 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
64 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
74 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
78 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
79 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
80 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
81 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
82 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
83 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
84 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
113 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
115 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
116 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
117 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
118 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
119 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
120 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
121 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
122 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
123 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
124 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
125 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
126 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
127 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
128 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
129 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
130 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
131 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
132 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
133 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
134 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
135 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
136 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
137 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
138 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
139 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
140 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
141 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
142 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
143 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
144 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
145 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
146 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
147 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
148 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
149 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
150 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
151 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
152 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
153 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
154 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
155 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
156 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
157 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
158 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
159 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
160 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
161 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
162 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
163 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
164 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
165 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
166 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
167 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
168 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
169 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
170 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
171 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
185 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
186 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
187 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
188 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
189 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
190 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
191 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
192 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
193 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
194 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
195 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
196 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
197 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
198 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
199 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
202 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
203 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
204 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
205 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
206 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
207 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
208 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
209 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
210 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
211 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
212 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
213 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
214 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
215 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
216 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
217 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
218 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
219 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
220 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
221 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
222 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
223 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
224 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
225 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
226 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
227 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
228 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
229 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
230 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.43
Metatranscriptomes 0.26
Isolates 1.31

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.26
Nodule 0.52
Rhizoplane 2.09
Rhizosphere 84.29
Stem 0
Stem Tuber 0
Unclassified 8.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207676_10817776 3300026095 Bacteria 910
2 JGI25405J52794_10027144 3300003911 Bacteria 1178
3 Ga0070658_10000659 3300005327 Bacteria 29808
4 Ga0070676_10084915 3300005328 Bacteria 1928
5 Ga0070683_100120964 3300005329 Bacteria 2473
6 Ga0070690_100324997 3300005330 Bacteria 1110
7 Ga0070670_100392590 3300005331 Bacteria 1224
8 Ga0070666_10366306 3300005335 Bacteria 1033
9 Ga0070680_100039112 3300005336 Bacteria 3838
10 Ga0070660_100226782 3300005339 Bacteria 1519
11 Ga0070689_100146270 3300005340 Bacteria 1904
12 Ga0070691_10020645 3300005341 Bacteria 3045
13 Ga0070661_100079092 3300005344 Bacteria 2426
14 Ga0070669_100581237 3300005353 Bacteria 937
15 Ga0070674_100399461 3300005356 Bacteria 1123
16 Ga0070709_10010731 3300005434 Bacteria 5083
17 Ga0070714_100075554 3300005435 Bacteria 2923
18 Ga0070713_100165940 3300005436 Bacteria 1974
19 Ga0070713_100276856 3300005436 Bacteria 1538
20 Ga0070710_10148470 3300005437 Bacteria 1444
21 Ga0070711_100041752 3300005439 Bacteria 3099
22 Ga0070700_100106969 3300005441 Bacteria 1853
23 Ga0070708_100097126 3300005445 Bacteria 2693
24 Ga0070708_100255027 3300005445 Bacteria 1648
25 Ga0070678_100810130 3300005456 Bacteria 851
26 Ga0070681_10035353 3300005458 Bacteria 5019
27 Ga0070681_10104668 3300005458 Bacteria 2772
28 Ga0070681_10259078 3300005458 Bacteria 1651
29 Ga0070706_100008463 3300005467 Bacteria 9583
30 Ga0070707_100093389 3300005468 Bacteria 2913
31 Ga0070707_100136397 3300005468 Bacteria 2387
32 Ga0070707_100407167 3300005468 Bacteria 1320
33 Ga0070698_100000151 3300005471 Bacteria 62941
34 Ga0070699_100002609 3300005518 Bacteria 16103
35 Ga0070699_100117488 3300005518 Bacteria 2337
36 Ga0070679_100000932 3300005530 Bacteria 25387
37 Ga0070679_100018482 3300005530 Bacteria 6765
38 Ga0070684_100111685 3300005535 Bacteria 2451
39 Ga0070697_100313327 3300005536 Unclassified 1350
40 Ga0070697_100315360 3300005536 Bacteria 1346
41 Ga0070696_100183548 3300005546 Bacteria 1553
42 Ga0070693_100230838 3300005547 Bacteria 1217
43 Ga0070665_100015031 3300005548 Bacteria 7768
44 Ga0070665_100058728 3300005548 Bacteria 3856
45 Ga0070704_100029512 3300005549 Unclassified 3663
46 Ga0070704_100228867 3300005549 Unclassified 1515
47 Ga0068855_100147010 3300005563 Bacteria 2682
48 Ga0068855_100155716 3300005563 Bacteria 2596
49 Ga0068857_100083446 3300005577 Bacteria 2854
50 Ga0068854_100214057 3300005578 Bacteria 1521
51 Ga0068856_100152972 3300005614 Bacteria 2316
52 Ga0068856_100288740 3300005614 Bacteria 1657
53 Ga0068852_100011112 3300005616 Bacteria 6762
54 Ga0068852_100102748 3300005616 Bacteria 2583
55 Ga0068852_100164214 3300005616 Bacteria 2076
56 Ga0068852_100483692 3300005616 Bacteria 1230
57 Ga0068859_100267699 3300005617 Bacteria 1801
58 Ga0068864_100390394 3300005618 Bacteria 1321
59 Ga0081455_10000299 3300005937 Bacteria 65486
60 Ga0081455_10002056 3300005937 Bacteria 24066
61 Ga0081455_10007115 3300005937 Bacteria 11851
62 Ga0081455_10008518 3300005937 Bacteria 10651
63 Ga0081455_10010143 3300005937 Bacteria 9596
64 Ga0081455_10048691 3300005937 Unclassified 3660
65 Ga0081455_10183367 3300005937 Bacteria 1583
66 Ga0081538_10012692 3300005981 Bacteria 6736
67 Ga0081538_10012762 3300005981 Bacteria 6709
68 Ga0081540_1020970 3300005983 Bacteria 3910
69 Ga0081539_10013729 3300005985 Bacteria 6076
70 Ga0081539_10017352 3300005985 Bacteria 5060
71 Ga0070717_10012200 3300006028 Bacteria 6553
72 Ga0075365_10076797 3300006038 Bacteria 2256
73 Ga0075365_10117751 3300006038 Bacteria 1830
74 Ga0075365_10145766 3300006038 Bacteria 1645
75 Ga0075365_10254908 3300006038 Bacteria 1233
76 Ga0075364_10335845 3300006051 Bacteria 1030
77 Ga0075432_10090204 3300006058 Unclassified 1121
78 Ga0070715_10008184 3300006163 Bacteria 3634
79 Ga0070712_100243014 3300006175 Bacteria 1435
80 Ga0075362_10027317 3300006177 Bacteria 2442
81 Ga0075362_10068074 3300006177 Bacteria 1621
82 Ga0075362_10070038 3300006177 Bacteria 1600
83 Ga0075362_10139210 3300006177 Bacteria 1159
84 Ga0075362_10259186 3300006177 Bacteria 856
85 Ga0075367_10015340 3300006178 Bacteria 4162
86 Ga0075369_10000209 3300006186 Bacteria 17223
87 Ga0075369_10002917 3300006186 Bacteria 6170
88 Ga0075369_10074534 3300006186 Bacteria 1497
89 Ga0075369_10107048 3300006186 Bacteria 1258
90 Ga0075366_10061688 3300006195 Bacteria 2229
91 Ga0075366_10113455 3300006195 Bacteria 1632
92 Ga0075370_10118718 3300006353 Bacteria 1539
93 Ga0075428_100048677 3300006844 Bacteria 4652
94 Ga0075428_100110326 3300006844 Bacteria 2997
95 Ga0075428_100587629 3300006844 Bacteria 1190
96 Ga0075430_100075885 3300006846 Bacteria 2818
97 Ga0075431_100229371 3300006847 Bacteria 1892
98 Ga0075431_100309801 3300006847 Bacteria 1594
99 Ga0075431_100593742 3300006847 Unclassified 1092
100 Ga0075433_10061058 3300006852 Bacteria 3302
101 Ga0075433_10156968 3300006852 Bacteria 2024
102 Ga0075433_10751137 3300006852 Unclassified 853
103 Ga0075434_100354507 3300006871 Bacteria 1488
104 Ga0075434_100715277 3300006871 Bacteria 1019
105 Ga0075429_100179373 3300006880 Bacteria 1856
106 Ga0075429_100695017 3300006880 Bacteria 891
107 Ga0075436_100129000 3300006914 Bacteria 1772
108 Ga0097620_100267677 3300006931 Bacteria 1801
109 Ga0075435_100114799 3300007076 Bacteria 2242
110 Ga0075435_100279710 3300007076 Bacteria 1424
111 Ga0075435_100317767 3300007076 Bacteria 1333
112 Ga0075435_100403204 3300007076 Bacteria 1176
113 Ga0105240_10367902 3300009093 Bacteria 1626
114 Ga0105240_10511039 3300009093 Bacteria 1334
115 Ga0111539_10394954 3300009094 Bacteria 1611
116 Ga0111539_10686266 3300009094 Bacteria 1192
117 Ga0114129_10030184 3300009147 Bacteria 7678
118 Ga0114129_10095115 3300009147 Bacteria 4126
119 Ga0114129_10125439 3300009147 Unclassified 3530
120 Ga0114129_10347443 3300009147 Bacteria 1966
121 Ga0114129_10437006 3300009147 Bacteria 1718
122 Ga0114129_10765945 3300009147 Bacteria 1234
123 Ga0105241_10788494 3300009174 Bacteria 874
124 Ga0105238_10022461 3300009551 Bacteria 6429
125 Ga0105239_10169935 3300010375 Bacteria 2437
126 Ga0105239_10205008 3300010375 Bacteria 2210
127 Ga0157370_10000604 3300013104 Bacteria 44766
128 Ga0157370_10029148 3300013104 Bacteria 5421
129 Ga0157369_10098800 3300013105 Bacteria 3112
130 Ga0157369_10177486 3300013105 Bacteria 2242
131 Ga0157369_10571063 3300013105 Bacteria 1168
132 Ga0163162_10916273 3300013306 Bacteria 989
133 Ga0157372_10226033 3300013307 Bacteria 2170
134 Ga0157379_10074899 3300014968 Bacteria 3030
135 Ga0157376_10087454 3300014969 Bacteria 2689
136 Ga0206353_10111631 3300020082 Bacteria 1603
137 Ga0213872_10081072 3300021361 Bacteria 1458
138 Ga0213876_10013423 3300021384 Bacteria 4351
139 Ga0213875_10068240 3300021388 Bacteria 1661
140 Ga0213871_10008356 3300021441 Bacteria 2279
141 Ga0207647_10047112 3300025904 Bacteria 2683
142 Ga0207699_10104577 3300025906 Bacteria 1803
143 Ga0207645_10159218 3300025907 Bacteria 1476
144 Ga0207705_10039138 3300025909 Bacteria 3397
145 Ga0207707_10017301 3300025912 Bacteria 6284
146 Ga0207707_10056005 3300025912 Bacteria 3429
147 Ga0207707_10236953 3300025912 Bacteria 1587
148 Ga0207695_10185014 3300025913 Bacteria 2003
149 Ga0207695_10278966 3300025913 Bacteria 1565
150 Ga0207693_10066351 3300025915 Bacteria 2826
151 Ga0207663_10118528 3300025916 Bacteria 1808
152 Ga0207660_10016969 3300025917 Bacteria 4830
153 Ga0207662_10042671 3300025918 Bacteria 2674
154 Ga0207657_10115217 3300025919 Bacteria 2215
155 Ga0207652_10018548 3300025921 Bacteria 5709
156 Ga0207652_10033969 3300025921 Bacteria 4296
157 Ga0207700_10033173 3300025928 Bacteria 3692
158 Ga0207700_10052171 3300025928 Bacteria 3056
159 Ga0207664_10038531 3300025929 Bacteria 3707
160 Ga0207644_10091554 3300025931 Bacteria 2268
161 Ga0207670_10171470 3300025936 Bacteria 1627
162 Ga0207665_10059993 3300025939 Bacteria 2575
163 Ga0207691_10123635 3300025940 Bacteria 2290
164 Ga0207691_10486882 3300025940 Bacteria 1048
165 Ga0207667_10018005 3300025949 Bacteria 7934
166 Ga0207651_10384560 3300025960 Bacteria 1190
167 Ga0207712_10350407 3300025961 Bacteria 1227
168 Ga0207703_10965902 3300026035 Bacteria 817
169 Ga0207678_10517775 3300026067 Bacteria 1041
170 Ga0207708_10085154 3300026075 Bacteria 2431
171 Ga0207702_10216927 3300026078 Bacteria 1781
172 Ga0207674_10081667 3300026116 Bacteria 3234
173 Ga0207683_10059432 3300026121 Bacteria 3358
174 Ga0207683_10764790 3300026121 Bacteria 896
175 Ga0207698_10137227 3300026142 Bacteria 2101
176 Ga0207428_10392106 3300027907 Bacteria 1017
177 Ga0268266_10006365 3300028379 Bacteria 10820
178 Ga0268266_10168692 3300028379 Bacteria 1985
179 Ga0268266_10200448 3300028379 Bacteria 1826
180 Ga0265338_10034303 3300028800 Bacteria 4907
181 Ga0265325_10007362 3300031241 Bacteria 6593
182 Ga0265325_10008762 3300031241 Bacteria 5949
183 Ga0265325_10077560 3300031241 Bacteria 1656
184 Ga0265339_10000024 3300031249 Bacteria 169774
185 Ga0307408_100082900 3300031548 Bacteria 2401
186 Ga0307408_100491195 3300031548 Bacteria 1073
187 Ga0265313_10000006 3300031595 Bacteria 183184
188 Ga0307405_10210883 3300031731 Bacteria 1418
189 Ga0307410_10612067 3300031852 Bacteria 910
190 Ga0307412_10312908 3300031911 Bacteria 1246
191 Ga0307409_100066884 3300031995 Bacteria 2836
192 Ga0307411_10051632 3300032005 Bacteria 2684
193 Ga0307415_100183614 3300032126 Bacteria 1644
194 Ga0373928_0016600 3300035084 Bacteria 1508
195 Ga0373940_0039788 3300035088 Bacteria 1288
196 Ga0373960_0032409 3300035121 Bacteria 1468
197 Ga0373942_0017859 3300035207 Bacteria 1755
198 Ga0373931_0015907 3300035691 Bacteria 3695
199 Ga0373931_0031018 3300035691 Bacteria 2755
200 Ga0373931_0412523 3300035691 Bacteria 857
201 Ga0373931_0470921 3300035691 Bacteria 806
202 Ga0373935_0293515 3300035692 Bacteria 1147
203 Ga0373927_0066156 3300035695 Bacteria 2338
204 Ga0373937_0466035 3300036401 Bacteria 1200
205 Ga0373925_0590158 3300037068 Bacteria 915
206 Ga0395899_0014702 3300037312 Bacteria 5973
207 Ga0395899_0023194 3300037312 Bacteria 4704
208 Ga0395899_0029712 3300037312 Bacteria 4111
209 Ga0395900_0012873 3300037418 Bacteria 8545
210 Ga0395900_0016453 3300037418 Bacteria 7541
211 Ga0395900_0019605 3300037418 Bacteria 6896
212 Ga0395900_0076930 3300037418 Bacteria 3428
213 Ga0395898_0005520 3300037466 Bacteria 13649
214 Ga0395898_0033316 3300037466 Bacteria 5142
215 Ga0436364_0642257 3300037853 Bacteria 36643
216 Ga0395901_0004105 3300038443 Bacteria 14682
217 Ga0395901_0040133 3300038443 Bacteria 4846
218 Ga0395901_0072342 3300038443 Bacteria 3594
219 Ga0395901_0190633 3300038443 Bacteria 2150
220 Ga0436365_0073939 3300039437 Bacteria 5975
221 Ga0436360_0341097 3300039438 Bacteria 5371
222 Ga0436360_1130677 3300039438 Bacteria 1961
223 Ga0436361_0048131 3300039447 Bacteria 6626
224 Ga0436361_0596863 3300039447 Bacteria 7613
225 Ga0436361_0704169 3300039447 Bacteria 2817
226 Ga0451802_0217187 3300041460 Bacteria 766
227 Ga0439448_0018179 3300042005 Bacteria 2152
228 Ga0439459_0021647 3300042438 Bacteria 1237
229 Ga0466963_0181523 3300044694 Bacteria 1469
230 Ga0466963_0210578 3300044694 Bacteria 1360
231 Ga0466957_0543455 3300044842 Bacteria 809
232 Ga0451576_0389366 3300045051 Bacteria 1461
233 Ga0466967_0418601 3300045976 Bacteria 1305
234 Ga0495629_0002076 3300046459 Bacteria 15544
235 Ga0495638_0062778 3300046460 Bacteria 2292
236 Ga0495650_0002508 3300046471 Bacteria 14712
237 Ga0495607_0052582 3300046501 Bacteria 2359
238 Ga0495642_0005311 3300046528 Bacteria 4943
239 Ga0495587_0224504 3300046536 Unclassified 1059
240 Ga0495645_0051983 3300046543 Bacteria 2981
241 Ga0495667_0016514 3300046559 Bacteria 4987
242 Ga0495588_0050127 3300046674 Bacteria 2148
243 Ga0495623_0147978 3300046679 Bacteria 1391
244 Ga0495646_0147786 3300046680 Unclassified 1309
245 Ga0495669_0239100 3300046684 Unclassified 871
246 Ga0495589_0117210 3300046794 Unclassified 1283
247 Ga0495581_0019190 3300047315 Bacteria 3968
248 Ga0495675_0080161 3300047444 Bacteria 2056
249 Ga0496100_0437261 3300048903 Bacteria 1001
250 Ga0496107_0353764 3300048910 Bacteria 1093
251 Ga0496107_0554161 3300048910 Bacteria 851
252 Ga0496110_0078670 3300048913 Bacteria 2936
253 Ga0496112_0875337 3300048915 Bacteria 821
254 Ga0496114_0002631 3300048917 Bacteria 13697
255 Ga0496115_0019438 3300048918 Bacteria 5228
256 Ga0496126_0087023 3300048929 Bacteria 2753
257 Ga0501032_0311941 3300049569 Bacteria 1016
258 Ga0501033_0063402 3300049570 Bacteria 2720
259 Ga0501033_0078210 3300049570 Bacteria 2427
260 Ga0501034_0003023 3300049571 Bacteria 19459
261 Ga0501034_0006903 3300049571 Bacteria 12135
262 Ga0501034_0067644 3300049571 Bacteria 3584
263 Ga0501034_0103554 3300049571 Bacteria 2839
264 Ga0501034_0252503 3300049571 Bacteria 1708
265 Ga0501034_0585625 3300049571 Unclassified 1022
266 Ga0501036_0055974 3300049572 Unclassified 3341
267 Ga0501036_0392577 3300049572 Bacteria 1158
268 Ga0501037_0108000 3300049573 Unclassified 2005
269 Ga0501037_0129844 3300049573 Bacteria 1807
270 Ga0501038_0004927 3300049574 Bacteria 12398
271 Ga0501038_0190780 3300049574 Bacteria 1649
272 Ga0501039_0001145 3300049575 Bacteria 19562
273 Ga0501039_0028748 3300049575 Bacteria 4280
274 Ga0501040_0032790 3300049576 Bacteria 3515
275 Ga0501041_0001480 3300049577 Bacteria 13002
276 Ga0501042_0005490 3300049578 Bacteria 8172
277 Ga0501042_0203208 3300049578 Bacteria 1428
278 Ga0501043_0690836 3300049579 Unclassified 746
279 Ga0501046_0089344 3300049580 Bacteria 2371
280 Ga0501046_0490710 3300049580 Bacteria 880
281 Ga0501048_0009985 3300049582 Bacteria 7108
282 Ga0501048_0018840 3300049582 Bacteria 5074
283 Ga0501048_0096893 3300049582 Bacteria 2081
284 Ga0501068_0011413 3300049584 Bacteria 5018
285 Ga0501068_0018896 3300049584 Bacteria 3994
286 Ga0501068_0086921 3300049584 Unclassified 1925
287 Ga0501068_0370498 3300049584 Bacteria 921
288 Ga0501069_0046744 3300049585 Bacteria 2402
289 Ga0501070_0057073 3300049586 Bacteria 3236
290 Ga0501070_0065873 3300049586 Bacteria 3000
291 Ga0501071_0033591 3300049587 Bacteria 3644
292 Ga0501072_0000821 3300049588 Bacteria 22839
293 Ga0501073_0421091 3300049589 Bacteria 923
294 Ga0501074_0106165 3300049590 Bacteria 2010
295 Ga0501074_0358856 3300049590 Bacteria 1034
296 Ga0501075_0069946 3300049591 Unclassified 2653
297 Ga0501075_0072390 3300049591 Bacteria 2605
298 Ga0501076_0002902 3300049592 Bacteria 11869
299 Ga0501076_0028954 3300049592 Unclassified 4304
300 Ga0501077_0000240 3300049593 Bacteria 32375
301 Ga0501077_0062594 3300049593 Bacteria 2360
302 Ga0501077_0484898 3300049593 Bacteria 792
303 Ga0501216_042407 3300049660 Bacteria 874
304 Ga0501079_0007833 3300049741 Bacteria 8088
305 Ga0501079_0016804 3300049741 Bacteria 5587
306 Ga0501080_0016802 3300049742 Bacteria 6758
307 Ga0501080_0037002 3300049742 Bacteria 4556
308 Ga0501080_0120001 3300049742 Bacteria 2437
309 Ga0501080_0363401 3300049742 Bacteria 1306
310 Ga0501080_0467481 3300049742 Bacteria 1129
311 Ga0501081_0003287 3300049743 Bacteria 10272
312 Ga0501083_0055293 3300049744 Unclassified 2662
313 Ga0501035_0162953 3300049822 Bacteria 1929
314 Ga0501035_0432193 3300049822 Bacteria 1092
315 Ga0501044_0001140 3300049823 Bacteria 31522
316 Ga0501044_0037832 3300049823 Bacteria 5042
317 Ga0501045_0000697 3300049824 Bacteria 21376
318 Ga0501045_0211810 3300049824 Bacteria 1443
319 Ga0501045_0516945 3300049824 Bacteria 886
320 nmdc:mga03683_176147_c1 3300050489 Bacteria 974
321 nmdc:mga03683_45259_c1 3300050489 Bacteria 1820
322 nmdc:mga03683_73924_c1 3300050489 Bacteria 1462
323 nmdc:mga03683_775_c1 3300050489 Bacteria 9181
324 nmdc:mga0yw44_164256_c1 3300050492 Bacteria 1455
325 nmdc:mga0yw44_410411_c1 3300050492 Bacteria 916
326 nmdc:mga0k408_119716_c1 3300050493 Bacteria 1559
327 nmdc:mga0k408_279239_c1 3300050493 Bacteria 997
328 nmdc:mga0k408_67773_c1 3300050493 Bacteria 2080
329 nmdc:mga06z11_124867_c1 3300050494 Bacteria 1439
330 nmdc:mga06z11_248524_c1 3300050494 Bacteria 1047
331 nmdc:mga06z11_273139_c1 3300050494 Bacteria 1000
332 nmdc:mga04h51_185809_c1 3300050495 Bacteria 811
333 nmdc:mga07m45_138747_c1 3300050496 Bacteria 1408
334 nmdc:mga07m45_150537_c1 3300050496 Bacteria 1349
335 nmdc:mga05p37_166842_c1 3300050507 Bacteria 2687
336 nmdc:mga05p37_212215_c1 3300050507 Unclassified 2340
337 nmdc:mga05p37_239677_c2 3300050507 Bacteria 1662
338 nmdc:mga05p37_272694_c1 3300050507 Bacteria 2021
339 nmdc:mga05p37_434607_c1 3300050507 Bacteria 1524
340 nmdc:mga05p37_479047_c1 3300050507 Bacteria 1434
341 nmdc:mga05p37_488263_c1 3300050507 Bacteria 1417
342 nmdc:mga09592_180438_c1 3300050508 Bacteria 1826
343 nmdc:mga09592_96150_c1 3300050508 Bacteria 2534
344 nmdc:mga06r32_303096_c1 3300050510 Bacteria 1584
345 nmdc:mga06r32_482555_c1 3300050510 Unclassified 1217
346 nmdc:mga08y16_412435_c1 3300050511 Bacteria 1381
347 nmdc:mga08y16_655123_c1 3300050511 Bacteria 1054
348 nmdc:mga0n895_1026623_c1 3300050512 Unclassified 805
349 nmdc:mga0n895_312467_c1 3300050512 Unclassified 1593
350 nmdc:mga0n895_332477_c1 3300050512 Bacteria 1539
351 nmdc:mga0rr50_405913_c1 3300050513 Bacteria 1151
352 nmdc:mga08x19_210071_c1 3300050514 Unclassified 1336
353 nmdc:mga0a205_195264_c1 3300050515 Bacteria 1915
354 nmdc:mga0a205_244867_c1 3300050515 Bacteria 1673
355 nmdc:mga0a205_390662_c1 3300050515 Unclassified 1256
356 nmdc:mga0a205_471863_c1 3300050515 Bacteria 1113
357 nmdc:mga0a205_506000_c1 3300050515 Unclassified 1065
358 nmdc:mga0sz30_113014_c1 3300050516 Bacteria 1191
359 nmdc:mga0sz30_183843_c1 3300050516 Bacteria 928
360 nmdc:mga0sz30_28683_c1 3300050516 Bacteria 2292
361 nmdc:mga0sz30_61730_c1 3300050516 Bacteria 1602
362 Ga0500651_0111588 3300053093 Bacteria 1668
363 Ga0500641_0000134 3300053096 Bacteria 27669
364 Ga0500557_089439 3300053105 Bacteria 1020
365 Ga0500568_0000116 3300053139 Bacteria 71883
366 Ga0500616_0003466 3300053153 Bacteria 12025
367 Ga0500552_001332 3300053733 Bacteria 2350
368 Ga0501084_0004795 3300054114 Bacteria 11057
369 Ga0501084_0025769 3300054114 Unclassified 4904
370 Ga0501084_0216344 3300054114 Bacteria 1616
371 Ga0501082_0000327 3300060353 Bacteria 42286
372 Ga0501082_0003282 3300060353 Bacteria 14121
373 Ga0501082_0037382 3300060353 Unclassified 4185
374 Ga0530510_0002932 3300061734 Bacteria 11702
375 Ga0530510_0062604 3300061734 Unclassified 2693
376 Ga0530510_0107315 3300061734 Bacteria 2043
377 Ga0530510_0500550 3300061734 Unclassified 921
378 2513597238 2513237088 Bacteria 6927906
379 2535514952 2534681796 Bacteria 7146037
380 2585203528 2582581294 Bacteria 6626667
381 2792745488 2791355123 Bacteria 8049106
382 8005543624 8005542996 Bacteria 7077758
383 Ga0207676_10817776
384 JGI25405J52794_10027144
385 Ga0070658_10000659
386 Ga0070676_10084915
387 Ga0070683_100120964
388 Ga0070690_100324997
389 Ga0070670_100392590
390 Ga0070666_10366306
391 Ga0070680_100039112
392 Ga0070660_100226782
393 Ga0070689_100146270
394 Ga0070691_10020645
395 Ga0070661_100079092
396 Ga0070669_100581237
397 Ga0070674_100399461
398 Ga0070709_10010731
399 Ga0070714_100075554
400 Ga0070713_100165940
401 Ga0070713_100276856
402 Ga0070710_10148470
403 Ga0070711_100041752
404 Ga0070700_100106969
405 Ga0070708_100097126
406 Ga0070708_100255027
407 Ga0070678_100810130
408 Ga0070681_10035353
409 Ga0070681_10104668
410 Ga0070681_10259078
411 Ga0070706_100008463
412 Ga0070707_100093389
413 Ga0070707_100136397
414 Ga0070707_100407167
415 Ga0070698_100000151
416 Ga0070699_100002609
417 Ga0070699_100117488
418 Ga0070679_100000932
419 Ga0070679_100018482
420 Ga0070684_100111685
421 Ga0070697_100313327
422 Ga0070697_100315360
423 Ga0070696_100183548
424 Ga0070693_100230838
425 Ga0070665_100015031
426 Ga0070665_100058728
427 Ga0070704_100029512
428 Ga0070704_100228867
429 Ga0068855_100147010
430 Ga0068855_100155716
431 Ga0068857_100083446
432 Ga0068854_100214057
433 Ga0068856_100152972
434 Ga0068856_100288740
435 Ga0068852_100011112
436 Ga0068852_100102748
437 Ga0068852_100164214
438 Ga0068852_100483692
439 Ga0068859_100267699
440 Ga0068864_100390394
441 Ga0081455_10000299
442 Ga0081455_10002056
443 Ga0081455_10007115
444 Ga0081455_10008518
445 Ga0081455_10010143
446 Ga0081455_10048691
447 Ga0081455_10183367
448 Ga0081538_10012692
449 Ga0081538_10012762
450 Ga0081540_1020970
451 Ga0081539_10013729
452 Ga0081539_10017352
453 Ga0070717_10012200
454 Ga0075365_10076797
455 Ga0075365_10117751
456 Ga0075365_10145766
457 Ga0075365_10254908
458 Ga0075364_10335845
459 Ga0075432_10090204
460 Ga0070715_10008184
461 Ga0070712_100243014
462 Ga0075362_10027317
463 Ga0075362_10068074
464 Ga0075362_10070038
465 Ga0075362_10139210
466 Ga0075362_10259186
467 Ga0075367_10015340
468 Ga0075369_10000209
469 Ga0075369_10002917
470 Ga0075369_10074534
471 Ga0075369_10107048
472 Ga0075366_10061688
473 Ga0075366_10113455
474 Ga0075370_10118718
475 Ga0075428_100048677
476 Ga0075428_100110326
477 Ga0075428_100587629
478 Ga0075430_100075885
479 Ga0075431_100229371
480 Ga0075431_100309801
481 Ga0075431_100593742
482 Ga0075433_10061058
483 Ga0075433_10156968
484 Ga0075433_10751137
485 Ga0075434_100354507
486 Ga0075434_100715277
487 Ga0075429_100179373
488 Ga0075429_100695017
489 Ga0075436_100129000
490 Ga0097620_100267677
491 Ga0075435_100114799
492 Ga0075435_100279710
493 Ga0075435_100317767
494 Ga0075435_100403204
495 Ga0105240_10367902
496 Ga0105240_10511039
497 Ga0111539_10394954
498 Ga0111539_10686266
499 Ga0114129_10030184
500 Ga0114129_10095115
501 Ga0114129_10125439
502 Ga0114129_10347443
503 Ga0114129_10437006
504 Ga0114129_10765945
505 Ga0105241_10788494
506 Ga0105238_10022461
507 Ga0105239_10169935
508 Ga0105239_10205008
509 Ga0157370_10000604
510 Ga0157370_10029148
511 Ga0157369_10098800
512 Ga0157369_10177486
513 Ga0157369_10571063
514 Ga0163162_10916273
515 Ga0157372_10226033
516 Ga0157379_10074899
517 Ga0157376_10087454
518 Ga0206353_10111631
519 Ga0213872_10081072
520 Ga0213876_10013423
521 Ga0213875_10068240
522 Ga0213871_10008356
523 Ga0207647_10047112
524 Ga0207699_10104577
525 Ga0207645_10159218
526 Ga0207705_10039138
527 Ga0207707_10017301
528 Ga0207707_10056005
529 Ga0207707_10236953
530 Ga0207695_10185014
531 Ga0207695_10278966
532 Ga0207693_10066351
533 Ga0207663_10118528
534 Ga0207660_10016969
535 Ga0207662_10042671
536 Ga0207657_10115217
537 Ga0207652_10018548
538 Ga0207652_10033969
539 Ga0207700_10033173
540 Ga0207700_10052171
541 Ga0207664_10038531
542 Ga0207644_10091554
543 Ga0207670_10171470
544 Ga0207665_10059993
545 Ga0207691_10123635
546 Ga0207691_10486882
547 Ga0207667_10018005
548 Ga0207651_10384560
549 Ga0207712_10350407
550 Ga0207703_10965902
551 Ga0207678_10517775
552 Ga0207708_10085154
553 Ga0207702_10216927
554 Ga0207674_10081667
555 Ga0207683_10059432
556 Ga0207683_10764790
557 Ga0207698_10137227
558 Ga0207428_10392106
559 Ga0268266_10006365
560 Ga0268266_10168692
561 Ga0268266_10200448
562 Ga0265338_10034303
563 Ga0265325_10007362
564 Ga0265325_10008762
565 Ga0265325_10077560
566 Ga0265339_10000024
567 Ga0307408_100082900
568 Ga0307408_100491195
569 Ga0265313_10000006
570 Ga0307405_10210883
571 Ga0307410_10612067
572 Ga0307412_10312908
573 Ga0307409_100066884
574 Ga0307411_10051632
575 Ga0307415_100183614
576 Ga0373928_0016600
577 Ga0373940_0039788
578 Ga0373960_0032409
579 Ga0373942_0017859
580 Ga0373931_0015907
581 Ga0373931_0031018
582 Ga0373931_0412523
583 Ga0373931_0470921
584 Ga0373935_0293515
585 Ga0373927_0066156
586 Ga0373937_0466035
587 Ga0373925_0590158
588 Ga0395899_0014702
589 Ga0395899_0023194
590 Ga0395899_0029712
591 Ga0395900_0012873
592 Ga0395900_0016453
593 Ga0395900_0019605
594 Ga0395900_0076930
595 Ga0395898_0005520
596 Ga0395898_0033316
597 Ga0436364_0642257
598 Ga0395901_0004105
599 Ga0395901_0040133
600 Ga0395901_0072342
601 Ga0395901_0190633
602 Ga0436365_0073939
603 Ga0436360_0341097
604 Ga0436360_1130677
605 Ga0436361_0048131
606 Ga0436361_0596863
607 Ga0436361_0704169
608 Ga0451802_0217187
609 Ga0439448_0018179
610 Ga0439459_0021647
611 Ga0466963_0181523
612 Ga0466963_0210578
613 Ga0466957_0543455
614 Ga0451576_0389366
615 Ga0466967_0418601
616 Ga0495629_0002076
617 Ga0495638_0062778
618 Ga0495650_0002508
619 Ga0495607_0052582
620 Ga0495642_0005311
621 Ga0495587_0224504
622 Ga0495645_0051983
623 Ga0495667_0016514
624 Ga0495588_0050127
625 Ga0495623_0147978
626 Ga0495646_0147786
627 Ga0495669_0239100
628 Ga0495589_0117210
629 Ga0495581_0019190
630 Ga0495675_0080161
631 Ga0496100_0437261
632 Ga0496107_0353764
633 Ga0496107_0554161
634 Ga0496110_0078670
635 Ga0496112_0875337
636 Ga0496114_0002631
637 Ga0496115_0019438
638 Ga0496126_0087023
639 Ga0501032_0311941
640 Ga0501033_0063402
641 Ga0501033_0078210
642 Ga0501034_0003023
643 Ga0501034_0006903
644 Ga0501034_0067644
645 Ga0501034_0103554
646 Ga0501034_0252503
647 Ga0501034_0585625
648 Ga0501036_0055974
649 Ga0501036_0392577
650 Ga0501037_0108000
651 Ga0501037_0129844
652 Ga0501038_0004927
653 Ga0501038_0190780
654 Ga0501039_0001145
655 Ga0501039_0028748
656 Ga0501040_0032790
657 Ga0501041_0001480
658 Ga0501042_0005490
659 Ga0501042_0203208
660 Ga0501043_0690836
661 Ga0501046_0089344
662 Ga0501046_0490710
663 Ga0501048_0009985
664 Ga0501048_0018840
665 Ga0501048_0096893
666 Ga0501068_0011413
667 Ga0501068_0018896
668 Ga0501068_0086921
669 Ga0501068_0370498
670 Ga0501069_0046744
671 Ga0501070_0057073
672 Ga0501070_0065873
673 Ga0501071_0033591
674 Ga0501072_0000821
675 Ga0501073_0421091
676 Ga0501074_0106165
677 Ga0501074_0358856
678 Ga0501075_0069946
679 Ga0501075_0072390
680 Ga0501076_0002902
681 Ga0501076_0028954
682 Ga0501077_0000240
683 Ga0501077_0062594
684 Ga0501077_0484898
685 Ga0501216_042407
686 Ga0501079_0007833
687 Ga0501079_0016804
688 Ga0501080_0016802
689 Ga0501080_0037002
690 Ga0501080_0120001
691 Ga0501080_0363401
692 Ga0501080_0467481
693 Ga0501081_0003287
694 Ga0501083_0055293
695 Ga0501035_0162953
696 Ga0501035_0432193
697 Ga0501044_0001140
698 Ga0501044_0037832
699 Ga0501045_0000697
700 Ga0501045_0211810
701 Ga0501045_0516945
702 nmdc:mga03683_176147_c1
703 nmdc:mga03683_45259_c1
704 nmdc:mga03683_73924_c1
705 nmdc:mga03683_775_c1
706 nmdc:mga0yw44_164256_c1
707 nmdc:mga0yw44_410411_c1
708 nmdc:mga0k408_119716_c1
709 nmdc:mga0k408_279239_c1
710 nmdc:mga0k408_67773_c1
711 nmdc:mga06z11_124867_c1
712 nmdc:mga06z11_248524_c1
713 nmdc:mga06z11_273139_c1
714 nmdc:mga04h51_185809_c1
715 nmdc:mga07m45_138747_c1
716 nmdc:mga07m45_150537_c1
717 nmdc:mga05p37_166842_c1
718 nmdc:mga05p37_212215_c1
719 nmdc:mga05p37_239677_c2
720 nmdc:mga05p37_272694_c1
721 nmdc:mga05p37_434607_c1
722 nmdc:mga05p37_479047_c1
723 nmdc:mga05p37_488263_c1
724 nmdc:mga09592_180438_c1
725 nmdc:mga09592_96150_c1
726 nmdc:mga06r32_303096_c1
727 nmdc:mga06r32_482555_c1
728 nmdc:mga08y16_412435_c1
729 nmdc:mga08y16_655123_c1
730 nmdc:mga0n895_1026623_c1
731 nmdc:mga0n895_312467_c1
732 nmdc:mga0n895_332477_c1
733 nmdc:mga0rr50_405913_c1
734 nmdc:mga08x19_210071_c1
735 nmdc:mga0a205_195264_c1
736 nmdc:mga0a205_244867_c1
737 nmdc:mga0a205_390662_c1
738 nmdc:mga0a205_471863_c1
739 nmdc:mga0a205_506000_c1
740 nmdc:mga0sz30_113014_c1
741 nmdc:mga0sz30_183843_c1
742 nmdc:mga0sz30_28683_c1
743 nmdc:mga0sz30_61730_c1
744 Ga0500651_0111588
745 Ga0500641_0000134
746 Ga0500557_089439
747 Ga0500568_0000116
748 Ga0500616_0003466
749 Ga0500552_001332
750 Ga0501084_0004795
751 Ga0501084_0025769
752 Ga0501084_0216344
753 Ga0501082_0000327
754 Ga0501082_0003282
755 Ga0501082_0037382
756 Ga0530510_0002932
757 Ga0530510_0062604
758 Ga0530510_0107315
759 Ga0530510_0500550
760 2513597238
761 2535514952
762 2585203528
763 2792745488
764 8005543624

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

39

223

0.96

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

45

229

0.93

PF08659

KR

KR domain

40

213

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
3p19-assembly1.cif.gz_B improved nadph-dependent blue fluorescent protein 0.9295 4 231
2ehd-assembly1.cif.gz_A crystal structure analysis of oxidoreductase 0.9283 5 228
3p19-assembly1.cif.gz_B improved nadph-dependent blue fluorescent protein 0.9254 4 231
3tfo-assembly1.cif.gz_D crystal structure of a putative 3-oxoacyl-(acyl-carrier-protein) reductase from sinorhizobium meliloti 0.9253 5 228
4cql-assembly4.cif.gz_K crystal structure of heterotetrameric human ketoacyl reductase complexed with nad 0.9229 5 227
ID Description Score Start End Superfamily
af_F4J128_251_373_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9601 89 179 3.40.50.720
af_A0A1D6ED38_49_231_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9502 2 175 3.40.50.720
af_Q54Q52_3_240_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9333 4 233 3.40.50.720
af_A0A0P0Y501_3_211_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9287 5 180 3.40.50.720
2ehdA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9283 5 228 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A537C7T0-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9868 4 155
AF-A0A1Z4R3S8-F1-model_v4 Short-chain dehydrogenase/reductase SDR 0.9851 3 231
AF-A0A2E0YHD5-F1-model_v4 deleted 0.9846 3 174
AF-A0A395CT65-F1-model_v4 Oxidoreductase 0.9819 3 166
AF-A0A1Z4S5F9-F1-model_v4 deleted 0.9798 2 233

Map