F429281

General Info

Members Datasets Scaffolds Average Seq Length
382 180 362 177

Family's Representative Sequence

Representative Sequence 3300021361|Ga0213872_10044866|Ga0213872_100448661
Length 187
Sequence MNKRMNPLINRARPLALVVPLLLAGCGDSDVQEVRAWMKLTDSQAQVAVQPLSEPKTFIPFAYASADAIDPFNPNKLLAELARAARASGKGLKPDLDRPKEQLEAFPLDTIKMVGSLQKGSQIFAQLQIDRSYYQVKTGQHIGQNFGLITSVTENSVSIKEIVQDASGDWVERMSKLELQESKETTK

Samples

Sample ID Description Type Environment
1 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
2 2643221638 Duganella sp. Root336D2 Isolate Unclassified
3 2643221645 Massilia sp. Root351 Isolate Unclassified
4 2643221664 Massilia sp. Root418 Isolate Unclassified
5 2738541280 Massilia sp. GV090 Isolate Unclassified
6 2738541297 Duganella sp. GV083 Isolate Unclassified
7 2738541300 Massilia sp. GV016 Isolate Unclassified
8 2738541357 Duganella sp. GV053 Isolate Unclassified
9 2738543003 Duganella sp. GV066 Isolate Unclassified
10 2738543018 Massilia sp. GV045 Isolate Unclassified
11 2738543026 Duganella sp. GV089 Isolate Unclassified
12 2738543029 Duganella sp. GV039 Isolate Unclassified
13 2738543030 Massilia sp. GV097 Isolate Unclassified
14 2821131069 Duganella sp. 1224 Isolate Unclassified
15 2842711865 Duganella sp. R-73148 Isolate Unclassified
16 2857553236 Duganella sp. R-74557 Isolate Unclassified
17 2857558681 Duganella sp. R-74565 Isolate Unclassified
18 2857564685 Duganella sp. R-74599 Isolate Unclassified
19 2904424332 Duganella sp. 1411 Isolate Rhizosphere
20 2919476304 Duganella sp. 3397 Isolate Unclassified
21 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
22 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
23 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
24 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
25 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
26 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
27 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
28 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
29 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
30 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
31 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
32 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
33 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
34 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
35 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
36 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
37 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
38 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
39 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
40 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
41 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
42 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
45 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
46 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
47 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
48 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
49 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
50 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
51 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
52 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
53 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
54 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
55 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
56 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
58 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
59 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
60 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
61 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
62 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
63 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
65 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
66 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
71 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
72 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
73 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
74 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
75 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
76 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
77 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
78 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
79 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
80 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
81 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
82 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
83 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
84 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
85 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
86 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
87 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
88 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
89 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
90 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
91 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
92 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
93 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
94 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
95 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
96 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
97 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
98 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
99 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
100 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
101 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
102 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
103 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
104 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
105 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
106 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
107 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
108 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
109 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
110 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
111 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
112 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
113 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
114 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
115 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
116 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
117 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
118 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
119 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
120 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
121 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
122 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
123 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
124 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
125 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
126 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
127 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
128 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
129 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
130 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
131 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
132 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
133 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
134 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
135 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
136 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
137 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
138 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
139 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
140 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
141 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
142 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
143 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
144 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
145 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
146 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
147 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
148 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
149 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
150 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
151 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
152 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
153 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
154 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
155 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
156 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
157 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
158 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
159 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
160 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
161 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
162 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
163 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
164 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
165 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
166 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
167 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
168 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
169 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
170 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
171 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
172 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
173 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
174 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
175 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
176 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
177 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
178 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
179 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
180 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.67
Metatranscriptomes 2.09
Isolates 5.24

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 19.9
Nodule 0.79
Rhizoplane 1.05
Rhizosphere 67.54
Stem 0
Stem Tuber 0
Unclassified 10.73

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25154J39366_1002311 3300002738 Bacteria 5097
2 JGI25158J39367_1004283 3300002739 Bacteria 2149
3 JGI25152J39213_1000224 3300002773 Bacteria 38367
4 JGI25152J39213_1030272 3300002773 Bacteria 843
5 JGI25150J39212_1000695 3300002774 Bacteria 12175
6 JGI25150J39212_1003218 3300002774 Bacteria 3864
7 JGI25150J39212_1022086 3300002774 Bacteria 960
8 JGI25159J45721_1000892 3300002987 Bacteria 12977
9 JGI25151J46595_10109159 3300003187 Bacteria 727
10 JGI25153J46596_10002862 3300003215 Bacteria 9802
11 JGI25153J46596_10014209 3300003215 Bacteria 3323
12 rootH2_10106881 3300003320 Bacteria 2122
13 rootL2_10043261 3300003322 Bacteria 4959
14 rootL2_10117747 3300003322 Bacteria 2951
15 JGI25160J50197_1004010 3300003354 Bacteria 6424
16 JGI25161J50226_1004038 3300003374 Bacteria 3168
17 Ga0055529_1000079 3300003763 Bacteria 149370
18 Ga0055526_1000228 3300003771 Bacteria 47559
19 Ga0055526_1000337 3300003771 Bacteria 38516
20 Ga0055526_1000651 3300003771 Bacteria 26844
21 Ga0055526_1009451 3300003771 Bacteria 4684
22 Ga0055537_1000038 3300003773 Bacteria 92762
23 Ga0055537_1008149 3300003773 Bacteria 2447
24 Ga0055524_1000024 3300003775 Bacteria 217953
25 Ga0055524_1001031 3300003775 Bacteria 17211
26 Ga0055524_1013018 3300003775 Bacteria 3162
27 Ga0055524_1038195 3300003775 Bacteria 1260
28 Ga0055534_1000074 3300003784 Bacteria 77272
29 Ga0055534_1001588 3300003784 Bacteria 8816
30 Ga0055528_1000231 3300003790 Bacteria 46568
31 Ga0055528_1001043 3300003790 Bacteria 18281
32 Ga0055543_1006902 3300004625 Bacteria 2686
33 Ga0065165_1000504 3300005262 Bacteria 60378
34 Ga0065165_1050750 3300005262 Bacteria 1180
35 Ga0065715_10030871 3300005293 Bacteria 1725
36 Ga0068869_100286311 3300005334 Bacteria 1326
37 Ga0070682_101122185 3300005337 Bacteria 659
38 Ga0068867_101198689 3300005459 Bacteria 697
39 Ga0099826_10000010 3300006948 Bacteria 314346
40 Ga0105244_10000158 3300009036 Bacteria 70253
41 Ga0105244_10003379 3300009036 Bacteria 11424
42 Ga0105248_10533713 3300009177 Bacteria 1323
43 Ga0182006_1000141 3300015261 Bacteria 77478
44 Ga0182005_1000016 3300015265 Bacteria 346889
45 Ga0213872_10000005 3300021361 Bacteria 290165
46 Ga0213872_10000541 3300021361 Bacteria 29407
47 Ga0213872_10002380 3300021361 Bacteria 11120
48 Ga0213872_10044866 3300021361 Bacteria 2011
49 Ga0213872_10060394 3300021361 Bacteria 1714
50 Ga0209436_100928 3300025208 Bacteria 11575
51 Ga0209436_110096 3300025208 Bacteria 1748
52 Ga0207425_1000021 3300025245 Bacteria 367537
53 Ga0207425_1000223 3300025245 Bacteria 44555
54 Ga0207425_1000640 3300025245 Bacteria 19664
55 Ga0207425_1012715 3300025245 Bacteria 1963
56 Ga0209646_1000068 3300025246 Bacteria 233765
57 Ga0209129_1000020 3300025258 Bacteria 457053
58 Ga0209129_1004870 3300025258 Bacteria 5021
59 Ga0209129_1022167 3300025258 Bacteria 1152
60 Ga0209233_1040856 3300025261 Bacteria 1006
61 Ga0209565_1000123 3300025263 Bacteria 111069
62 Ga0209565_1001882 3300025263 Bacteria 8324
63 Ga0209565_1006129 3300025263 Bacteria 3413
64 Ga0209565_1006737 3300025263 Bacteria 3185
65 Ga0209565_1007111 3300025263 Bacteria 3054
66 Ga0209565_1013406 3300025263 Bacteria 1919
67 Ga0209455_1000070 3300025272 Bacteria 307867
68 Ga0209673_1000040 3300025273 Bacteria 312633
69 Ga0209673_1002575 3300025273 Bacteria 12297
70 Ga0209130_1000290 3300025284 Bacteria 61271
71 Ga0209130_1007638 3300025284 Bacteria 3307
72 Ga0209675_1000117 3300025291 Bacteria 111087
73 Ga0209675_1000650 3300025291 Bacteria 24546
74 Ga0209675_1003691 3300025291 Bacteria 7143
75 Ga0209025_1058436 3300025294 Bacteria 1465
76 Ga0209564_1000027 3300025295 Bacteria 518458
77 Ga0209564_1000047 3300025295 Bacteria 368031
78 Ga0209564_1000121 3300025295 Bacteria 204081
79 Ga0209564_1000780 3300025295 Bacteria 44199
80 Ga0209564_1006698 3300025295 Bacteria 6124
81 Ga0209564_1011409 3300025295 Bacteria 3984
82 Ga0209758_1000077 3300025297 Bacteria 268195
83 Ga0209758_1000322 3300025297 Bacteria 92458
84 Ga0209050_1000050 3300025298 Bacteria 362578
85 Ga0209050_1000795 3300025298 Bacteria 44648
86 Ga0209256_1000054 3300025299 Bacteria 298431
87 Ga0209256_1000288 3300025299 Bacteria 88470
88 Ga0209256_1000674 3300025299 Bacteria 46225
89 Ga0209256_1001001 3300025299 Bacteria 33573
90 Ga0209256_1002870 3300025299 Bacteria 13096
91 Ga0207426_1004227 3300025302 Bacteria 7136
92 Ga0209051_1025401 3300025303 Bacteria 2412
93 Ga0209257_1000075 3300025304 Bacteria 324855
94 Ga0207655_1000710 3300025728 Bacteria 38274
95 Ga0207655_1013418 3300025728 Bacteria 4706
96 Ga0207648_11061836 3300026089 Bacteria 759
97 Ga0209281_1002515 3300027111 Bacteria 7212
98 Ga0209282_1000072 3300027666 Bacteria 81137
99 Ga0265337_1070525 3300028556 Bacteria 961
100 Ga0265336_10000272 3300028666 Bacteria 36231
101 Ga0265336_10038807 3300028666 Bacteria 1461
102 Ga0265338_10027334 3300028800 Bacteria 5727
103 Ga0265324_10000004 3300029957 Bacteria 356972
104 Ga0265324_10001557 3300029957 Bacteria 12848
105 Ga0316181_1030715 3300030744 Bacteria 1369
106 Ga0316182_1083480 3300030745 Bacteria 1248
107 Ga0316182_1257485 3300030745 Bacteria 845
108 Ga0265325_10002699 3300031241 Bacteria 11862
109 Ga0265331_10029158 3300031250 Bacteria 2756
110 Ga0265316_10287757 3300031344 Unclassified 1200
111 Ga0307408_100000531 3300031548 Bacteria 32967
112 Ga0307408_100001492 3300031548 Bacteria 17360
113 Ga0307408_100002211 3300031548 Bacteria 13890
114 Ga0316575_10030052 3300031665 Bacteria 2123
115 Ga0265314_10003992 3300031711 Bacteria 13952
116 Ga0265314_10011332 3300031711 Bacteria 7369
117 Ga0265314_10049794 3300031711 Bacteria 2930
118 Ga0265314_10097456 3300031711 Bacteria 1899
119 Ga0307518_10013386 3300031838 Bacteria 5865
120 Ga0307416_100013029 3300032002 Bacteria 5633
121 Ga0373939_0004293 3300035114 Bacteria 3368
122 Ga0316582_0101418 3300036647 Bacteria 1907
123 Ga0395898_0335880 3300037466 Bacteria 1441
124 Ga0436361_0002419 3300039447 Bacteria 2615
125 Ga0436361_0235534 3300039447 Bacteria 12344
126 Ga0436361_0820978 3300039447 Bacteria 73779
127 Ga0436361_0906875 3300039447 Bacteria 3330
128 Ga0436361_0938421 3300039447 Bacteria 11081
129 Ga0439455_0064969 3300042012 Bacteria 973
130 Ga0450911_057040 3300042115 Bacteria 507
131 Ga0450893_0003027 3300042532 Bacteria 2646
132 Ga0451577_0000002 3300042876 Bacteria 1731375
133 Ga0451577_0000375 3300042876 Bacteria 83271
134 Ga0451577_0068618 3300042876 Bacteria 3162
135 Ga0466982_0078051 3300044672 Bacteria 2049
136 Ga0453683_0000013 3300044673 Bacteria 371932
137 Ga0453683_0028559 3300044673 Bacteria 3531
138 Ga0466965_0003099 3300044683 Bacteria 7247
139 Ga0453684_0000002 3300044712 Bacteria 1731375
140 Ga0453684_0000040 3300044712 Bacteria 690210
141 Ga0453684_0261508 3300044712 Bacteria 1982
142 Ga0466968_0003648 3300044735 Bacteria 5707
143 Ga0451576_0000006 3300045051 Bacteria 949698
144 Ga0451576_0000037 3300045051 Bacteria 372173
145 Ga0451576_0005709 3300045051 Bacteria 15522
146 Ga0495617_000245 3300046452 Bacteria 32248
147 Ga0495617_004444 3300046452 Bacteria 5103
148 Ga0495617_005143 3300046452 Bacteria 4670
149 Ga0495617_024214 3300046452 Bacteria 2048
150 Ga0495617_148003 3300046452 Bacteria 747
151 Ga0495627_000011 3300046453 Bacteria 354522
152 Ga0495627_048776 3300046453 Bacteria 1280
153 Ga0495627_057028 3300046453 Bacteria 1163
154 Ga0495590_0000020 3300046457 Bacteria 212352
155 Ga0495590_0008308 3300046457 Bacteria 3966
156 Ga0495591_021444 3300046458 Bacteria 2108
157 Ga0495629_0001463 3300046459 Bacteria 18603
158 Ga0495638_0000235 3300046460 Bacteria 75760
159 Ga0495638_0002305 3300046460 Bacteria 15718
160 Ga0495638_0005619 3300046460 Bacteria 9256
161 Ga0495638_0011136 3300046460 Bacteria 6213
162 Ga0495638_0069208 3300046460 Bacteria 2163
163 Ga0495653_0000067 3300046463 Bacteria 90116
164 Ga0495653_0440275 3300046463 Bacteria 821
165 Ga0495650_0000436 3300046471 Bacteria 67167
166 Ga0495650_0000864 3300046471 Bacteria 36231
167 Ga0495650_0004386 3300046471 Bacteria 9699
168 Ga0495650_0006085 3300046471 Bacteria 7609
169 Ga0495650_0013779 3300046471 Bacteria 4252
170 Ga0495650_0018453 3300046471 Bacteria 3465
171 Ga0495605_0000061 3300046474 Bacteria 145286
172 Ga0495605_0000764 3300046474 Bacteria 23490
173 Ga0495605_0059479 3300046474 Bacteria 1835
174 Ga0495639_0040830 3300046475 Bacteria 2089
175 Ga0495584_0005003 3300046491 Bacteria 7054
176 Ga0495584_0016308 3300046491 Bacteria 3788
177 Ga0495584_0090112 3300046491 Bacteria 1546
178 Ga0495585_0018339 3300046492 Bacteria 4037
179 Ga0495585_0028549 3300046492 Bacteria 3181
180 Ga0495585_0167801 3300046492 Bacteria 1135
181 Ga0495607_0000514 3300046501 Bacteria 38263
182 Ga0495607_0004516 3300046501 Bacteria 10213
183 Ga0495607_0074363 3300046501 Bacteria 1886
184 Ga0495607_0137403 3300046501 Bacteria 1264
185 Ga0495607_0194350 3300046501 Bacteria 1008
186 Ga0495583_0000214 3300046506 Bacteria 97639
187 Ga0495583_0000317 3300046506 Bacteria 76193
188 Ga0495583_0000900 3300046506 Bacteria 35357
189 Ga0495583_0005716 3300046506 Bacteria 8350
190 Ga0495606_0000120 3300046507 Bacteria 133907
191 Ga0495606_0000262 3300046507 Bacteria 92896
192 Ga0495606_0002563 3300046507 Bacteria 20868
193 Ga0495606_0003347 3300046507 Bacteria 17098
194 Ga0495606_0003569 3300046507 Bacteria 16403
195 Ga0495606_0007596 3300046507 Bacteria 9646
196 Ga0495606_0039459 3300046507 Bacteria 3181
197 Ga0495606_0059224 3300046507 Bacteria 2457
198 Ga0495610_0000017 3300046512 Bacteria 365675
199 Ga0495610_0003795 3300046512 Bacteria 11523
200 Ga0495610_0006344 3300046512 Bacteria 8172
201 Ga0495610_0064710 3300046512 Bacteria 1727
202 Ga0495610_0139651 3300046512 Bacteria 1044
203 Ga0495616_0001575 3300046513 Bacteria 15690
204 Ga0495616_0005282 3300046513 Bacteria 7963
205 Ga0495616_0036761 3300046513 Bacteria 2525
206 Ga0495637_0000179 3300046520 Bacteria 49260
207 Ga0495637_0004230 3300046520 Bacteria 7457
208 Ga0495643_0001510 3300046522 Bacteria 21024
209 Ga0495643_0002282 3300046522 Bacteria 15491
210 Ga0495644_0004709 3300046523 Bacteria 5365
211 Ga0495644_0018436 3300046523 Bacteria 2666
212 Ga0495648_0000350 3300046524 Bacteria 50788
213 Ga0495648_0002610 3300046524 Bacteria 16463
214 Ga0495648_0009718 3300046524 Bacteria 7410
215 Ga0495648_0010369 3300046524 Bacteria 7100
216 Ga0495648_0035985 3300046524 Bacteria 3202
217 Ga0495648_0052546 3300046524 Bacteria 2474
218 Ga0495648_0184069 3300046524 Bacteria 1059
219 Ga0495663_0102530 3300046525 Bacteria 944
220 Ga0495642_0001943 3300046528 Bacteria 8727
221 Ga0495642_0009415 3300046528 Bacteria 3739
222 Ga0495642_0014244 3300046528 Bacteria 3081
223 Ga0495642_0143057 3300046528 Bacteria 1033
224 Ga0495654_0000060 3300046530 Bacteria 134307
225 Ga0495654_0003528 3300046530 Bacteria 9549
226 Ga0495654_0094064 3300046530 Bacteria 1387
227 Ga0495609_0001337 3300046538 Bacteria 16700
228 Ga0495609_0002743 3300046538 Bacteria 10602
229 Ga0495609_0003502 3300046538 Bacteria 8970
230 Ga0495609_0063156 3300046538 Bacteria 1634
231 Ga0495609_0146335 3300046538 Bacteria 1006
232 Ga0495597_0001017 3300046542 Bacteria 21453
233 Ga0495597_0001085 3300046542 Bacteria 20660
234 Ga0495597_0025389 3300046542 Bacteria 2727
235 Ga0495622_0000210 3300046557 Bacteria 46319
236 Ga0495622_0000292 3300046557 Bacteria 37769
237 Ga0495622_0027453 3300046557 Bacteria 2657
238 Ga0495633_0001329 3300046558 Bacteria 19396
239 Ga0495633_0002397 3300046558 Bacteria 13276
240 Ga0495633_0016905 3300046558 Bacteria 3744
241 Ga0495633_0024806 3300046558 Bacteria 2958
242 Ga0495633_0071246 3300046558 Bacteria 1621
243 Ga0495633_0149361 3300046558 Bacteria 1079
244 Ga0495656_0014975 3300046615 Bacteria 2917
245 Ga0495668_0000162 3300046616 Bacteria 101114
246 Ga0495668_0000427 3300046616 Bacteria 54797
247 Ga0495668_0000769 3300046616 Bacteria 37454
248 Ga0495668_0002786 3300046616 Bacteria 13924
249 Ga0495668_0006299 3300046616 Bacteria 7815
250 Ga0495668_0149885 3300046616 Bacteria 1277
251 Ga0495625_0001192 3300046660 Bacteria 33259
252 Ga0495625_0001372 3300046660 Bacteria 29946
253 Ga0495625_0001954 3300046660 Bacteria 23300
254 Ga0495625_0003285 3300046660 Bacteria 16318
255 Ga0495625_0007946 3300046660 Bacteria 9118
256 Ga0495625_0095897 3300046660 Bacteria 2044
257 Ga0495625_0180233 3300046660 Bacteria 1405
258 Ga0495659_0000114 3300046664 Bacteria 35846
259 Ga0495659_0001470 3300046664 Bacteria 7989
260 Ga0495659_0001963 3300046664 Bacteria 6766
261 Ga0495661_0015210 3300046665 Bacteria 5138
262 Ga0495661_0015705 3300046665 Bacteria 5047
263 Ga0495661_0094679 3300046665 Bacteria 1692
264 Ga0495588_0160896 3300046674 Bacteria 1187
265 Ga0495623_0146114 3300046679 Bacteria 1402
266 Ga0495669_0000844 3300046684 Bacteria 13033
267 Ga0495670_0004436 3300046691 Bacteria 6884
268 Ga0495670_0018028 3300046691 Bacteria 3478
269 Ga0495670_0043035 3300046691 Bacteria 2253
270 Ga0495670_0145396 3300046691 Bacteria 1242
271 Ga0495670_0347554 3300046691 Unclassified 798
272 Ga0495671_0000037 3300046692 Bacteria 177605
273 Ga0495671_0000437 3300046692 Bacteria 33043
274 Ga0495671_0015212 3300046692 Bacteria 4129
275 Ga0495671_0069641 3300046692 Bacteria 1729
276 Ga0495671_0086301 3300046692 Bacteria 1538
277 Ga0495671_0090165 3300046692 Bacteria 1500
278 Ga0495671_0110878 3300046692 Bacteria 1340
279 Ga0495649_0007513 3300046694 Bacteria 6632
280 Ga0495649_0027194 3300046694 Bacteria 3175
281 Ga0495660_0000980 3300046810 Bacteria 20850
282 Ga0495660_0001240 3300046810 Bacteria 17748
283 Ga0495660_0003025 3300046810 Bacteria 10486
284 Ga0495660_0004378 3300046810 Bacteria 8553
285 Ga0495660_0009294 3300046810 Bacteria 5737
286 Ga0495660_0021388 3300046810 Bacteria 3705
287 Ga0495660_0185408 3300046810 Bacteria 1003
288 Ga0495636_0001201 3300047318 Bacteria 9794
289 Ga0495636_0012088 3300047318 Bacteria 3420
290 Ga0495636_0032332 3300047318 Bacteria 2146
291 Ga0495636_0032665 3300047318 Bacteria 2135
292 Ga0495674_0000762 3300047319 Bacteria 30538
293 Ga0495672_0000297 3300047320 Bacteria 68017
294 Ga0495672_0000353 3300047320 Bacteria 58748
295 Ga0495672_0024677 3300047320 Bacteria 3867
296 Ga0495672_0047519 3300047320 Bacteria 2551
297 Ga0495683_0000773 3300047323 Bacteria 22984
298 Ga0495683_0043314 3300047323 Bacteria 2267
299 Ga0495687_000342 3300047443 Bacteria 59692
300 Ga0495687_013104 3300047443 Bacteria 4342
301 Ga0495677_0002300 3300047445 Bacteria 7531
302 Ga0495677_0004779 3300047445 Bacteria 5160
303 Ga0495679_006195 3300047446 Bacteria 5192
304 Ga0495685_000088 3300047447 Bacteria 33952
305 Ga0495685_043343 3300047447 Bacteria 1535
306 Ga0495673_0000179 3300047469 Bacteria 102128
307 Ga0495673_0000201 3300047469 Bacteria 92885
308 Ga0495673_0000248 3300047469 Bacteria 75224
309 Ga0495673_0004072 3300047469 Bacteria 9300
310 Ga0495681_0012354 3300047470 Bacteria 5022
311 Ga0495681_0020287 3300047470 Bacteria 3609
312 Ga0495686_0001233 3300047472 Bacteria 29192
313 Ga0495686_0002872 3300047472 Bacteria 15482
314 Ga0495686_0010721 3300047472 Bacteria 6503
315 Ga0495686_0025863 3300047472 Bacteria 3844
316 Ga0495686_0075751 3300047472 Bacteria 2062
317 Ga0495686_0167568 3300047472 Bacteria 1279
318 Ga0495615_0017385 3300048090 Bacteria 1566
319 Ga0496102_0756293 3300048905 Bacteria 894
320 Ga0496103_0002217 3300048906 Bacteria 12309
321 Ga0496110_1538122 3300048913 Bacteria 575
322 Ga0496114_0065855 3300048917 Bacteria 3036
323 Ga0496116_0048163 3300048919 Bacteria 2862
324 Ga0496116_0171499 3300048919 Bacteria 1175
325 Ga0496116_0298258 3300048919 Bacteria 769
326 Ga0496120_0087668 3300048923 Bacteria 1670
327 Ga0496121_0169425 3300048924 Bacteria 1588
328 Ga0496122_0011421 3300048925 Bacteria 8992
329 Ga0496122_0063246 3300048925 Bacteria 2702
330 Ga0496123_0004566 3300048926 Bacteria 14439
331 Ga0496124_0054348 3300048927 Bacteria 3390
332 Ga0496124_0057347 3300048927 Bacteria 3282
333 Ga0496124_0064848 3300048927 Bacteria 3048
334 Ga0496124_0324293 3300048927 Bacteria 1101
335 Ga0496125_0114112 3300048928 Bacteria 1947
336 Ga0496126_0006579 3300048929 Bacteria 12945
337 Ga0496126_0472267 3300048929 Bacteria 1006
338 Ga0501306_004281 3300049127 Bacteria 1592
339 Ga0501309_001993 3300049129 Bacteria 2130
340 Ga0501310_007132 3300049130 Bacteria 1189
341 Ga0501305_006085 3300049161 Bacteria 1487
342 Ga0501307_009086 3300049162 Bacteria 1130
343 Ga0495678_000010 3300049459 Bacteria 357896
344 Ga0495678_001298 3300049459 Bacteria 20180
345 Ga0495678_006816 3300049459 Bacteria 6012
346 Ga0495678_034719 3300049459 Bacteria 2072
347 Ga0495682_0001031 3300049460 Bacteria 16453
348 Ga0495682_0009029 3300049460 Bacteria 3911
349 Ga0501311_000115 3300049527 Bacteria 4029
350 Ga0501315_015797 3300049531 Bacteria 971
351 Ga0501323_003508 3300049539 Bacteria 1606
352 Ga0501227_000633 3300049665 Bacteria 7650
353 Ga0501238_014268 3300049671 Bacteria 1088
354 Ga0501229_016137 3300049706 Bacteria 971
355 Ga0501269_000202 3300049766 Bacteria 17720
356 Ga0501269_008932 3300049766 Bacteria 1214
357 Ga0501279_002391 3300049775 Bacteria 2463
358 Ga0501279_006138 3300049775 Bacteria 1586
359 Ga0501279_080001 3300049775 Bacteria 562
360 Ga0500618_000139 3300053125 Bacteria 60811
361 Ga0500618_016037 3300053125 Bacteria 1882
362 Ga0500586_001237 3300053145 Bacteria 5335

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005293 Ga0065715_10030871 Ga0065715_100308712 145
2 3300046506 Ga0495583_0005716 Ga0495583_0005716_6571_7113 145
3 3300047318 Ga0495636_0032332 Ga0495636_0032332_1573_2115 145
4 3300048905 Ga0496102_0756293 Ga0496102_0756293_121_663 145
5 3300042115 Ga0450911_057040 Ga0450911_057040_42_494 150
6 3300046452 Ga0495617_148003 Ga0495617_148003_18_470 150
7 3300044712 Ga0453684_0000040 Ga0453684_0000040_520243_520719 154
8 3300042876 Ga0451577_0000002 Ga0451577_0000002_1539393_1539881 158
9 3300044673 Ga0453683_0000013 Ga0453683_0000013_179950_180438 158
10 3300044712 Ga0453684_0000002 Ga0453684_0000002_191495_191983 158
11 3300045051 Ga0451576_0000037 Ga0451576_0000037_180191_180679 158
12 3300030745 Ga0316182_1083480 Ga0316182_10834802 160
13 3300042876 Ga0451577_0000375 Ga0451577_0000375_80391_80888 161
14 3300045051 Ga0451576_0005709 Ga0451576_0005709_12599_13096 161
15 3300046507 Ga0495606_0003347 Ga0495606_0003347_15869_16411 161
16 3300036647 Ga0316582_0101418 Ga0316582_0101418_367_876 164
17 3300048917 Ga0496114_0065855 Ga0496114_0065855_1640_2185 164
18 3300028556 Ga0265337_1070525 Ga0265337_10705252 165
19 3300028666 Ga0265336_10000272 Ga0265336_1000027218 165
20 3300028666 Ga0265336_10038807 Ga0265336_100388072 165
21 3300028800 Ga0265338_10027334 Ga0265338_100273343 165
22 3300029957 Ga0265324_10000004 Ga0265324_1000000433 165
23 3300029957 Ga0265324_10001557 Ga0265324_100015575 165
24 3300031241 Ga0265325_10002699 Ga0265325_100026996 165
25 3300031250 Ga0265331_10029158 Ga0265331_100291584 165
26 3300031344 Ga0265316_10287757 Ga0265316_102877572 165
27 3300031665 Ga0316575_10030052 Ga0316575_100300522 165
28 3300031711 Ga0265314_10003992 Ga0265314_100039927 165
29 3300031711 Ga0265314_10049794 Ga0265314_100497943 165
30 3300031711 Ga0265314_10097456 Ga0265314_100974562 165
31 3300042876 Ga0451577_0068618 Ga0451577_0068618_1462_1974 165
32 3300044673 Ga0453683_0028559 Ga0453683_0028559_1280_1789 165
33 3300044712 Ga0453684_0261508 Ga0453684_0261508_852_1364 165
34 3300045051 Ga0451576_0000006 Ga0451576_0000006_445963_446472 165
35 3300046528 Ga0495642_0143057 Ga0495642_0143057_152_664 165
36 3300046501 Ga0495607_0074363 Ga0495607_0074363_1287_1841 166
37 3300046453 Ga0495627_000011 Ga0495627_000011_298474_298986 168
38 3300046810 Ga0495660_0003025 Ga0495660_0003025_4892_5404 168
39 3300048906 Ga0496103_0002217 Ga0496103_0002217_5606_6151 168
40 3300049162 Ga0501307_009086 Ga0501307_009086_63_569 168
41 3300049527 Ga0501311_000115 Ga0501311_000115_1017_1523 168
42 3300049531 Ga0501315_015797 Ga0501315_015797_405_911 168
43 3300046810 Ga0495660_0001240 Ga0495660_0001240_15374_15892 169
44 3300049459 Ga0495678_000010 Ga0495678_000010_304819_305361 169
45 3300046524 Ga0495648_0035985 Ga0495648_0035985_575_1090 170
46 3300046691 Ga0495670_0347554 Ga0495670_0347554_131_673 170
47 3300047318 Ga0495636_0012088 Ga0495636_0012088_952_1494 170
48 3300048927 Ga0496124_0054348 Ga0496124_0054348_770_1288 170
49 3300046460 Ga0495638_0069208 Ga0495638_0069208_1139_1657 171
50 3300046616 Ga0495668_0002786 Ga0495668_0002786_9148_9666 171
51 3300046660 Ga0495625_0095897 Ga0495625_0095897_245_763 171
52 3300046665 Ga0495661_0015210 Ga0495661_0015210_1794_2312 171
53 3300046810 Ga0495660_0004378 Ga0495660_0004378_3229_3747 171
54 3300047323 Ga0495683_0043314 Ga0495683_0043314_1123_1641 171
55 3300049766 Ga0501269_000202 Ga0501269_000202_5172_5690 171
56 iso_pu_bacteria 2643221554 2643792042 171
57 iso_pu_bacteria 2643221638 2644216477 171
58 3300046460 Ga0495638_0011136 Ga0495638_0011136_3715_4251 172
59 3300046471 Ga0495650_0013779 Ga0495650_0013779_480_1016 172
60 3300046542 Ga0495597_0001085 Ga0495597_0001085_5523_6041 172
61 3300046660 Ga0495625_0003285 Ga0495625_0003285_5710_6246 172
62 3300047470 Ga0495681_0020287 Ga0495681_0020287_675_1208 172
63 3300046501 Ga0495607_0004516 Ga0495607_0004516_4171_4731 173
64 3300046507 Ga0495606_0003569 Ga0495606_0003569_10262_10822 173
65 3300046679 Ga0495623_0146114 Ga0495623_0146114_360_887 173
66 iso_pu_bacteria 2643221664 2644360330 173
67 iso_pu_bacteria 2738541280 2738738085 173
68 iso_pu_bacteria 2738541297 2738826822 173
69 iso_pu_bacteria 2738541300 2738843124 173
70 iso_pu_bacteria 2738541357 2739150619 173
71 iso_pu_bacteria 2738543003 2739192538 173
72 iso_pu_bacteria 2738543018 2739273875 173
73 iso_pu_bacteria 2738543026 2739319015 173
74 iso_pu_bacteria 2738543029 2739337256 173
75 iso_pu_bacteria 2738543030 2739342919 173
76 iso_pu_bacteria 2919476304 2919476998 173
77 3300046457 Ga0495590_0000020 Ga0495590_0000020_153477_154034 174
78 3300046460 Ga0495638_0000235 Ga0495638_0000235_19339_19896 174
79 3300046471 Ga0495650_0006085 Ga0495650_0006085_1614_2171 174
80 3300046506 Ga0495583_0000900 Ga0495583_0000900_5560_6117 174
81 3300046522 Ga0495643_0002282 Ga0495643_0002282_9224_9781 174
82 3300046524 Ga0495648_0000350 Ga0495648_0000350_30926_31483 174
83 3300046530 Ga0495654_0094064 Ga0495654_0094064_731_1267 174
84 3300046542 Ga0495597_0001017 Ga0495597_0001017_16414_16971 174
85 3300046616 Ga0495668_0000769 Ga0495668_0000769_35904_36461 174
86 3300046691 Ga0495670_0018028 Ga0495670_0018028_20_577 174
87 3300046692 Ga0495671_0086301 Ga0495671_0086301_609_1166 174
88 3300046810 Ga0495660_0009294 Ga0495660_0009294_4882_5439 174
89 3300047443 Ga0495687_013104 Ga0495687_013104_3671_4228 174
90 3300002739 JGI25158J39367_1004283 JGI25158J39367_10042832 175
91 3300002773 JGI25152J39213_1000224 JGI25152J39213_10002244 175
92 3300002773 JGI25152J39213_1030272 JGI25152J39213_10302722 175
93 3300002774 JGI25150J39212_1000695 JGI25150J39212_10006958 175
94 3300002774 JGI25150J39212_1003218 JGI25150J39212_10032182 175
95 3300002987 JGI25159J45721_1000892 JGI25159J45721_10008925 175
96 3300003215 JGI25153J46596_10002862 JGI25153J46596_100028623 175
97 3300003322 rootL2_10117747 rootL2_101177474 175
98 3300003354 JGI25160J50197_1004010 JGI25160J50197_10040102 175
99 3300003374 JGI25161J50226_1004038 JGI25161J50226_10040382 175
100 3300003771 Ga0055526_1000651 Ga0055526_100065119 175
101 3300003771 Ga0055526_1009451 Ga0055526_10094513 175
102 3300003773 Ga0055537_1000038 Ga0055537_100003833 175
103 3300003773 Ga0055537_1008149 Ga0055537_10081493 175
104 3300003775 Ga0055524_1000024 Ga0055524_100002436 175
105 3300003775 Ga0055524_1001031 Ga0055524_10010313 175
106 3300003775 Ga0055524_1013018 Ga0055524_10130182 175
107 3300003775 Ga0055524_1038195 Ga0055524_10381951 175
108 3300003784 Ga0055534_1000074 Ga0055534_100007425 175
109 3300003784 Ga0055534_1001588 Ga0055534_10015883 175
110 3300003790 Ga0055528_1000231 Ga0055528_100023120 175
111 3300003790 Ga0055528_1001043 Ga0055528_100104310 175
112 3300004625 Ga0055543_1006902 Ga0055543_10069022 175
113 3300005262 Ga0065165_1000504 Ga0065165_100050422 175
114 3300005262 Ga0065165_1050750 Ga0065165_10507502 175
115 3300005334 Ga0068869_100286311 Ga0068869_1002863112 175
116 3300005459 Ga0068867_101198689 Ga0068867_1011986892 175
117 3300006948 Ga0099826_10000010 Ga0099826_10000010225 175
118 3300009177 Ga0105248_10533713 Ga0105248_105337132 175
119 3300015261 Ga0182006_1000141 Ga0182006_100014113 175
120 3300015265 Ga0182005_1000016 Ga0182005_1000016244 175
121 3300025208 Ga0209436_100928 Ga0209436_1009286 175
122 3300025208 Ga0209436_110096 Ga0209436_1100962 175
123 3300025245 Ga0207425_1000021 Ga0207425_100002163 175
124 3300025245 Ga0207425_1000223 Ga0207425_100022327 175
125 3300025245 Ga0207425_1012715 Ga0207425_10127152 175
126 3300025258 Ga0209129_1000020 Ga0209129_1000020134 175
127 3300025258 Ga0209129_1004870 Ga0209129_10048704 175
128 3300025258 Ga0209129_1022167 Ga0209129_10221672 175
129 3300025263 Ga0209565_1000123 Ga0209565_100012370 175
130 3300025263 Ga0209565_1001882 Ga0209565_10018825 175
131 3300025263 Ga0209565_1006129 Ga0209565_10061292 175
132 3300025263 Ga0209565_1006737 Ga0209565_10067374 175
133 3300025263 Ga0209565_1007111 Ga0209565_10071111 175
134 3300025263 Ga0209565_1013406 Ga0209565_10134062 175
135 3300025273 Ga0209673_1000040 Ga0209673_1000040258 175
136 3300025273 Ga0209673_1002575 Ga0209673_10025753 175
137 3300025284 Ga0209130_1000290 Ga0209130_100029022 175
138 3300025284 Ga0209130_1007638 Ga0209130_10076382 175
139 3300025291 Ga0209675_1000117 Ga0209675_100011735 175
140 3300025291 Ga0209675_1000650 Ga0209675_100065020 175
141 3300025291 Ga0209675_1003691 Ga0209675_10036916 175
142 3300025295 Ga0209564_1000121 Ga0209564_1000121153 175
143 3300025295 Ga0209564_1000780 Ga0209564_100078026 175
144 3300025295 Ga0209564_1006698 Ga0209564_10066981 175
145 3300025295 Ga0209564_1011409 Ga0209564_10114092 175
146 3300025297 Ga0209758_1000077 Ga0209758_1000077201 175
147 3300025298 Ga0209050_1000050 Ga0209050_100005065 175
148 3300025298 Ga0209050_1000795 Ga0209050_100079526 175
149 3300025299 Ga0209256_1000054 Ga0209256_1000054216 175
150 3300025299 Ga0209256_1000288 Ga0209256_100028816 175
151 3300025299 Ga0209256_1000674 Ga0209256_100067426 175
152 3300025299 Ga0209256_1001001 Ga0209256_100100122 175
153 3300025299 Ga0209256_1002870 Ga0209256_10028705 175
154 3300025302 Ga0207426_1004227 Ga0207426_10042276 175
155 3300025303 Ga0209051_1025401 Ga0209051_10254013 175
156 3300025304 Ga0209257_1000075 Ga0209257_100007565 175
157 3300027111 Ga0209281_1002515 Ga0209281_10025153 175
158 3300027666 Ga0209282_1000072 Ga0209282_100007269 175
159 3300031548 Ga0307408_100000531 Ga0307408_10000053122 175
160 3300031548 Ga0307408_100002211 Ga0307408_1000022115 175
161 3300031838 Ga0307518_10013386 Ga0307518_100133862 175
162 3300032002 Ga0307416_100013029 Ga0307416_1000130294 175
163 3300042012 Ga0439455_0064969 Ga0439455_0064969_229_759 175
164 3300042532 Ga0450893_0003027 Ga0450893_0003027_604_1131 175
165 3300046460 Ga0495638_0005619 Ga0495638_0005619_7580_8113 175
166 3300046474 Ga0495605_0059479 Ga0495605_0059479_643_1176 175
167 3300046475 Ga0495639_0040830 Ga0495639_0040830_945_1481 175
168 3300046491 Ga0495584_0016308 Ga0495584_0016308_2710_3243 175
169 3300046501 Ga0495607_0000514 Ga0495607_0000514_24038_24571 175
170 3300046513 Ga0495616_0001575 Ga0495616_0001575_9206_9739 175
171 3300046525 Ga0495663_0102530 Ga0495663_0102530_11_541 175
172 3300046528 Ga0495642_0001943 Ga0495642_0001943_2758_3294 175
173 3300046538 Ga0495609_0001337 Ga0495609_0001337_9392_9925 175
174 3300046557 Ga0495622_0000292 Ga0495622_0000292_31654_32190 175
175 3300046558 Ga0495633_0001329 Ga0495633_0001329_12817_13353 175
176 3300046616 Ga0495668_0000427 Ga0495668_0000427_26599_27132 175
177 3300046660 Ga0495625_0001372 Ga0495625_0001372_24566_25099 175
178 3300046660 Ga0495625_0001954 Ga0495625_0001954_5760_6296 175
179 3300046664 Ga0495659_0001470 Ga0495659_0001470_6569_7102 175
180 3300046665 Ga0495661_0015705 Ga0495661_0015705_3739_4272 175
181 3300046684 Ga0495669_0000844 Ga0495669_0000844_2277_2810 175
182 3300046691 Ga0495670_0145396 Ga0495670_0145396_81_614 175
183 3300046692 Ga0495671_0069641 Ga0495671_0069641_980_1510 175
184 3300046694 Ga0495649_0007513 Ga0495649_0007513_6037_6570 175
185 3300046810 Ga0495660_0021388 Ga0495660_0021388_1680_2213 175
186 3300047318 Ga0495636_0032665 Ga0495636_0032665_1540_2073 175
187 3300047445 Ga0495677_0004779 Ga0495677_0004779_2351_2884 175
188 3300047447 Ga0495685_043343 Ga0495685_043343_111_644 175
189 3300047470 Ga0495681_0012354 Ga0495681_0012354_2822_3355 175
190 3300047472 Ga0495686_0001233 Ga0495686_0001233_10953_11486 175
191 3300048090 Ga0495615_0017385 Ga0495615_0017385_581_1117 175
192 3300048913 Ga0496110_1538122 Ga0496110_1538122_31_558 175
193 3300049129 Ga0501309_001993 Ga0501309_001993_399_926 175
194 3300049130 Ga0501310_007132 Ga0501310_007132_388_915 175
195 3300049459 Ga0495678_034719 Ga0495678_034719_1284_1820 175
196 3300049665 Ga0501227_000633 Ga0501227_000633_2879_3406 175
197 3300049671 Ga0501238_014268 Ga0501238_014268_497_1024 175
198 3300049775 Ga0501279_002391 Ga0501279_002391_1575_2102 175
199 3300049775 Ga0501279_006138 Ga0501279_006138_599_1126 175
200 3300049775 Ga0501279_080001 Ga0501279_080001_14_541 175
201 3300003320 rootH2_10106881 rootH2_101068812 176
202 3300003322 rootL2_10043261 rootL2_100432613 176
203 3300003763 Ga0055529_1000079 Ga0055529_100007956 176
204 3300025261 Ga0209233_1040856 Ga0209233_10408561 176
205 3300025272 Ga0209455_1000070 Ga0209455_1000070217 176
206 3300031548 Ga0307408_100001492 Ga0307408_10000149214 176
207 3300037466 Ga0395898_0335880 Ga0395898_0335880_783_1325 176
208 3300044672 Ga0466982_0078051 Ga0466982_0078051_291_833 176
209 3300044683 Ga0466965_0003099 Ga0466965_0003099_836_1378 176
210 3300044735 Ga0466968_0003648 Ga0466968_0003648_1818_2360 176
211 iso_pu_bacteria 2821131069 2821135845 176
212 iso_pu_bacteria 2842711865 2842712307 176
213 iso_pu_bacteria 2904424332 2904428829 176
214 3300021361 Ga0213872_10000005 Ga0213872_1000000524 177
215 3300021361 Ga0213872_10000541 Ga0213872_1000054115 177
216 3300021361 Ga0213872_10002380 Ga0213872_1000238010 177
217 3300021361 Ga0213872_10044866 Ga0213872_100448661 177
218 3300021361 Ga0213872_10060394 Ga0213872_100603942 177
219 3300031711 Ga0265314_10011332 Ga0265314_100113323 177
220 3300039447 Ga0436361_0002419 Ga0436361_0002419_397_939 177
221 3300039447 Ga0436361_0235534 Ga0436361_0235534_2600_3151 177
222 3300039447 Ga0436361_0820978 Ga0436361_0820978_29246_29794 177
223 3300039447 Ga0436361_0906875 Ga0436361_0906875_1388_1951 177
224 3300039447 Ga0436361_0938421 Ga0436361_0938421_957_1496 177
225 3300046452 Ga0495617_000245 Ga0495617_000245_27322_27858 177
226 3300046452 Ga0495617_004444 Ga0495617_004444_2249_2800 177
227 3300046452 Ga0495617_024214 Ga0495617_024214_663_1214 177
228 3300046453 Ga0495627_057028 Ga0495627_057028_316_852 177
229 3300046457 Ga0495590_0008308 Ga0495590_0008308_1568_2119 177
230 3300046458 Ga0495591_021444 Ga0495591_021444_303_851 177
231 3300046459 Ga0495629_0001463 Ga0495629_0001463_16332_16874 177
232 3300046460 Ga0495638_0002305 Ga0495638_0002305_9174_9725 177
233 3300046463 Ga0495653_0440275 Ga0495653_0440275_108_647 177
234 3300046471 Ga0495650_0000436 Ga0495650_0000436_42939_43481 177
235 3300046471 Ga0495650_0004386 Ga0495650_0004386_4536_5072 177
236 3300046471 Ga0495650_0018453 Ga0495650_0018453_2819_3355 177
237 3300046474 Ga0495605_0000764 Ga0495605_0000764_8982_9533 177
238 3300046491 Ga0495584_0005003 Ga0495584_0005003_5612_6163 177
239 3300046491 Ga0495584_0090112 Ga0495584_0090112_910_1461 177
240 3300046492 Ga0495585_0018339 Ga0495585_0018339_2017_2553 177
241 3300046492 Ga0495585_0028549 Ga0495585_0028549_1784_2335 177
242 3300046492 Ga0495585_0167801 Ga0495585_0167801_355_906 177
243 3300046501 Ga0495607_0137403 Ga0495607_0137403_693_1244 177
244 3300046501 Ga0495607_0194350 Ga0495607_0194350_437_988 177
245 3300046506 Ga0495583_0000214 Ga0495583_0000214_84090_84632 177
246 3300046506 Ga0495583_0000317 Ga0495583_0000317_33011_33562 177
247 3300046507 Ga0495606_0007596 Ga0495606_0007596_4481_5023 177
248 3300046507 Ga0495606_0039459 Ga0495606_0039459_1439_1981 177
249 3300046507 Ga0495606_0059224 Ga0495606_0059224_687_1244 177
250 3300046512 Ga0495610_0000017 Ga0495610_0000017_296136_296672 177
251 3300046512 Ga0495610_0139651 Ga0495610_0139651_221_757 177
252 3300046513 Ga0495616_0005282 Ga0495616_0005282_1059_1607 177
253 3300046513 Ga0495616_0036761 Ga0495616_0036761_1068_1619 177
254 3300046520 Ga0495637_0000179 Ga0495637_0000179_33375_33911 177
255 3300046523 Ga0495644_0004709 Ga0495644_0004709_703_1245 177
256 3300046523 Ga0495644_0018436 Ga0495644_0018436_1631_2182 177
257 3300046524 Ga0495648_0002610 Ga0495648_0002610_5643_6194 177
258 3300046524 Ga0495648_0009718 Ga0495648_0009718_4434_4970 177
259 3300046524 Ga0495648_0010369 Ga0495648_0010369_1930_2466 177
260 3300046524 Ga0495648_0184069 Ga0495648_0184069_320_868 177
261 3300046528 Ga0495642_0014244 Ga0495642_0014244_100_642 177
262 3300046530 Ga0495654_0000060 Ga0495654_0000060_80631_81167 177
263 3300046530 Ga0495654_0003528 Ga0495654_0003528_4751_5293 177
264 3300046538 Ga0495609_0002743 Ga0495609_0002743_4621_5163 177
265 3300046538 Ga0495609_0003502 Ga0495609_0003502_1025_1576 177
266 3300046538 Ga0495609_0063156 Ga0495609_0063156_799_1356 177
267 3300046542 Ga0495597_0025389 Ga0495597_0025389_1052_1594 177
268 3300046557 Ga0495622_0000210 Ga0495622_0000210_5593_6144 177
269 3300046557 Ga0495622_0027453 Ga0495622_0027453_1776_2327 177
270 3300046558 Ga0495633_0024806 Ga0495633_0024806_1387_1938 177
271 3300046558 Ga0495633_0071246 Ga0495633_0071246_765_1313 177
272 3300046558 Ga0495633_0149361 Ga0495633_0149361_494_1030 177
273 3300046615 Ga0495656_0014975 Ga0495656_0014975_2347_2898 177
274 3300046616 Ga0495668_0149885 Ga0495668_0149885_605_1147 177
275 3300046660 Ga0495625_0001192 Ga0495625_0001192_6739_7281 177
276 3300046660 Ga0495625_0007946 Ga0495625_0007946_6736_7287 177
277 3300046664 Ga0495659_0000114 Ga0495659_0000114_29928_30470 177
278 3300046664 Ga0495659_0001963 Ga0495659_0001963_5120_5671 177
279 3300046665 Ga0495661_0094679 Ga0495661_0094679_261_812 177
280 3300046674 Ga0495588_0160896 Ga0495588_0160896_424_978 177
281 3300046691 Ga0495670_0004436 Ga0495670_0004436_5204_5752 177
282 3300046691 Ga0495670_0043035 Ga0495670_0043035_972_1523 177
283 3300046692 Ga0495671_0000037 Ga0495671_0000037_144023_144559 177
284 3300046692 Ga0495671_0000437 Ga0495671_0000437_5445_5987 177
285 3300046692 Ga0495671_0090165 Ga0495671_0090165_21_572 177
286 3300046810 Ga0495660_0000980 Ga0495660_0000980_5747_6304 177
287 3300046810 Ga0495660_0185408 Ga0495660_0185408_360_902 177
288 3300047318 Ga0495636_0001201 Ga0495636_0001201_6210_6761 177
289 3300047319 Ga0495674_0000762 Ga0495674_0000762_25762_26304 177
290 3300047320 Ga0495672_0000297 Ga0495672_0000297_26366_26908 177
291 3300047320 Ga0495672_0024677 Ga0495672_0024677_1477_2028 177
292 3300047320 Ga0495672_0047519 Ga0495672_0047519_44_595 177
293 3300047323 Ga0495683_0000773 Ga0495683_0000773_16625_17176 177
294 3300047443 Ga0495687_000342 Ga0495687_000342_42632_43183 177
295 3300047445 Ga0495677_0002300 Ga0495677_0002300_202_753 177
296 3300047446 Ga0495679_006195 Ga0495679_006195_3437_3973 177
297 3300047447 Ga0495685_000088 Ga0495685_000088_7552_8103 177
298 3300047469 Ga0495673_0000179 Ga0495673_0000179_32742_33278 177
299 3300047469 Ga0495673_0004072 Ga0495673_0004072_4209_4760 177
300 3300047472 Ga0495686_0002872 Ga0495686_0002872_1405_1962 177
301 3300047472 Ga0495686_0025863 Ga0495686_0025863_465_1016 177
302 3300047472 Ga0495686_0167568 Ga0495686_0167568_585_1121 177
303 3300048919 Ga0496116_0171499 Ga0496116_0171499_327_869 177
304 3300048924 Ga0496121_0169425 Ga0496121_0169425_37_573 177
305 3300048925 Ga0496122_0063246 Ga0496122_0063246_16_552 177
306 3300048927 Ga0496124_0064848 Ga0496124_0064848_1963_2499 177
307 3300049459 Ga0495678_006816 Ga0495678_006816_3999_4550 177
308 3300049460 Ga0495682_0001031 Ga0495682_0001031_15418_15969 177
309 3300049460 Ga0495682_0009029 Ga0495682_0009029_485_1036 177
310 3300049766 Ga0501269_008932 Ga0501269_008932_378_920 177
311 3300053125 Ga0500618_000139 Ga0500618_000139_53353_53889 177
312 3300053145 Ga0500586_001237 Ga0500586_001237_2945_3481 177
313 iso_pu_bacteria 2643221645 2644254777 177
314 iso_pu_bacteria 2857553236 2857556244 177
315 iso_pu_bacteria 2857558681 2857560832 177
316 iso_pu_bacteria 2857564685 2857568032 177
317 3300003771 Ga0055526_1000228 Ga0055526_100022836 178
318 3300025295 Ga0209564_1000047 Ga0209564_100004769 178
319 3300026089 Ga0207648_11061836 Ga0207648_110618362 178
320 3300046463 Ga0495653_0000067 Ga0495653_0000067_31120_31659 178
321 3300046507 Ga0495606_0000262 Ga0495606_0000262_57301_57840 178
322 3300046692 Ga0495671_0015212 Ga0495671_0015212_3087_3626 178
323 3300046694 Ga0495649_0027194 Ga0495649_0027194_2314_2853 178
324 3300047469 Ga0495673_0000201 Ga0495673_0000201_61543_62082 178
325 3300047472 Ga0495686_0075751 Ga0495686_0075751_1120_1662 178
326 3300048919 Ga0496116_0298258 Ga0496116_0298258_170_709 178
327 3300048923 Ga0496120_0087668 Ga0496120_0087668_573_1112 178
328 3300048925 Ga0496122_0011421 Ga0496122_0011421_2527_3066 178
329 3300048926 Ga0496123_0004566 Ga0496123_0004566_6005_6544 178
330 3300048927 Ga0496124_0057347 Ga0496124_0057347_1162_1704 178
331 3300048929 Ga0496126_0006579 Ga0496126_0006579_5787_6326 178
332 3300048929 Ga0496126_0472267 Ga0496126_0472267_273_812 178
333 3300053125 Ga0500618_016037 Ga0500618_016037_860_1396 178
334 3300002774 JGI25150J39212_1022086 JGI25150J39212_10220862 179
335 3300003187 JGI25151J46595_10109159 JGI25151J46595_101091591 179
336 3300003215 JGI25153J46596_10014209 JGI25153J46596_100142092 179
337 3300003771 Ga0055526_1000337 Ga0055526_10003374 179
338 3300005337 Ga0070682_101122185 Ga0070682_1011221851 179
339 3300009036 Ga0105244_10003379 Ga0105244_100033793 179
340 3300025245 Ga0207425_1000640 Ga0207425_100064014 179
341 3300025294 Ga0209025_1058436 Ga0209025_10584363 179
342 3300025295 Ga0209564_1000027 Ga0209564_1000027296 179
343 3300025297 Ga0209758_1000322 Ga0209758_100032260 179
344 3300025728 Ga0207655_1013418 Ga0207655_10134183 179
345 3300030745 Ga0316182_1257485 Ga0316182_12574851 179
346 3300035114 Ga0373939_0004293 Ga0373939_0004293_896_1438 179
347 3300046471 Ga0495650_0000864 Ga0495650_0000864_14525_15067 179
348 3300046474 Ga0495605_0000061 Ga0495605_0000061_105316_105858 179
349 3300046507 Ga0495606_0000120 Ga0495606_0000120_100744_101295 179
350 3300046512 Ga0495610_0006344 Ga0495610_0006344_2541_3092 179
351 3300046528 Ga0495642_0009415 Ga0495642_0009415_1312_1854 179
352 3300046558 Ga0495633_0016905 Ga0495633_0016905_2504_3055 179
353 3300046616 Ga0495668_0000162 Ga0495668_0000162_20818_21369 179
354 3300046616 Ga0495668_0006299 Ga0495668_0006299_4241_4783 179
355 3300047469 Ga0495673_0000248 Ga0495673_0000248_54620_55162 179
356 3300047472 Ga0495686_0010721 Ga0495686_0010721_857_1408 179
357 3300048919 Ga0496116_0048163 Ga0496116_0048163_1710_2261 179
358 3300048927 Ga0496124_0324293 Ga0496124_0324293_151_693 179
359 3300048928 Ga0496125_0114112 Ga0496125_0114112_511_1053 179
360 3300049706 Ga0501229_016137 Ga0501229_016137_394_939 179
361 3300009036 Ga0105244_10000158 Ga0105244_1000015825 180
362 3300025728 Ga0207655_1000710 Ga0207655_100071021 180
363 3300030744 Ga0316181_1030715 Ga0316181_10307152 180
364 3300046512 Ga0495610_0064710 Ga0495610_0064710_689_1240 180
365 3300046660 Ga0495625_0180233 Ga0495625_0180233_185_727 180
366 3300049127 Ga0501306_004281 Ga0501306_004281_876_1433 180
367 3300049161 Ga0501305_006085 Ga0501305_006085_367_924 180
368 3300049539 Ga0501323_003508 Ga0501323_003508_366_923 180
369 3300002738 JGI25154J39366_1002311 JGI25154J39366_10023114 181
370 3300025246 Ga0209646_1000068 Ga0209646_100006865 181
371 3300046452 Ga0495617_005143 Ga0495617_005143_1159_1707 181
372 3300046453 Ga0495627_048776 Ga0495627_048776_79_636 181
373 3300046507 Ga0495606_0002563 Ga0495606_0002563_14831_15379 181
374 3300046512 Ga0495610_0003795 Ga0495610_0003795_9046_9591 181
375 3300046520 Ga0495637_0004230 Ga0495637_0004230_4477_5025 181
376 3300046522 Ga0495643_0001510 Ga0495643_0001510_5680_6225 181
377 3300046524 Ga0495648_0052546 Ga0495648_0052546_382_927 181
378 3300046538 Ga0495609_0146335 Ga0495609_0146335_294_839 181
379 3300046558 Ga0495633_0002397 Ga0495633_0002397_7105_7662 181
380 3300046692 Ga0495671_0110878 Ga0495671_0110878_104_649 181
381 3300047320 Ga0495672_0000353 Ga0495672_0000353_28263_28808 181
382 3300049459 Ga0495678_001298 Ga0495678_001298_14128_14673 181

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04351

PilP

Pilus assembly protein, PilP

33

179

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2y4y-assembly1.cif.gz_C-2 structure of a domain from the type iv pilus biogenesis lipoprotein pilp, from pseudomonas aeruginosa 0.9675 92 174
2y4y-assembly1.cif.gz_D-2 structure of a domain from the type iv pilus biogenesis lipoprotein pilp, from pseudomonas aeruginosa 0.9622 87 173
2y4y-assembly1.cif.gz_B-2 structure of a domain from the type iv pilus biogenesis lipoprotein pilp, from pseudomonas aeruginosa 0.9595 92 174
2y4y-assembly1.cif.gz_A-2 structure of a domain from the type iv pilus biogenesis lipoprotein pilp, from pseudomonas aeruginosa 0.9577 86 174
2y4y-assembly1.cif.gz_D-2 structure of a domain from the type iv pilus biogenesis lipoprotein pilp, from pseudomonas aeruginosa 0.9506 87 173
ID Description Score Start End Superfamily
2y4yC00 Mainly Beta;Roll;SH3 type barrels.; 0.9675 92 174 2.30.30.830
2y4yC00 Mainly Beta;Roll;SH3 type barrels.; 0.932 92 174 2.30.30.830
af_Q7KRR5_243_283_3.10.620.30 Alpha Beta;Roll;C8orf32 fold; 0.8853 106 130 3.10.620.30
2lc4A00 Mainly Beta;Roll;SH3 type barrels.; 0.8521 84 175 2.30.30.830
5qj4D00 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.8342 141 170 3.90.79.10
ID Description Score Start End GO Terms
AF-A0A0P9HM69-F1-model_v4 Pilus assembly protein, PilQ 0.9675 87 175
AF-A0A382ZGV8-F1-model_v4 Pilus assembly protein PilP 0.9607 86 177
AF-A0A534C7M9-F1-model_v4 Pilus assembly protein PilP 0.9599 87 175
AF-A0A1B3PKD3-F1-model_v4 Pilus assembly, PilP family protein 0.9295 106 177
AF-A0A4Q3QI10-F1-model_v4 deleted 0.9268 104 174

Feature Viewer

pLDDT pTM Quality
77.26 0.5 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map