F429224

General Info

Members Datasets Scaffolds Average Seq Length
382 219 382 195

Family's Representative Sequence

Representative Sequence 3300005844|Ga0068862_100687441|Ga0068862_1006874412
Length 231
Sequence MGAGGGFYGRSLDRSRQHLNLLAELNLNVFAIRHGETAWSLNGQHTGKTDIPLTDNGCRLAARMRPVLAANPFGLVLCSPMRRARETCELAGFGDRAIIDADLVEWSYGKYEGLTPKQIDEVAPGWLIFRDGCPGGEAPEQVSARVDRVIARSRAVPGNTALFAHGHLLRVLAARWIGLPATGGQHFTLNTGTLCVLGYYRQIPAVRIWNGPLVGEADDRATRNTQRELGK

Samples

Sample ID Description Type Environment
1 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
44 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
45 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
46 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
47 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
48 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
49 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
50 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
51 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
52 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
53 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
54 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
58 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
59 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
60 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
61 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
69 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
70 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
71 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
76 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
77 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
78 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
79 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
80 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
81 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
82 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
83 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
84 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
85 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
86 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
115 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
117 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
118 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
119 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
120 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
121 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
122 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
123 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
124 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
125 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
126 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
127 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
128 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
129 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
130 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
131 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
132 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
133 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
134 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
135 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
136 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
137 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
138 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
139 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
140 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
141 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
142 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
143 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
144 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
145 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
146 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
147 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
148 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
149 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
150 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
151 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
152 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
153 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
154 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
155 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
156 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
157 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
158 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
159 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
160 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
161 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
162 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
163 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
164 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
165 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
166 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
167 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
168 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
169 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
170 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
171 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
172 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
173 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
174 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
175 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
176 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
177 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
190 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
191 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
192 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
193 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
194 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
195 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
196 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
197 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
198 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
199 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
200 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
201 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
202 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
203 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
204 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
205 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
206 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
207 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
208 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
209 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
210 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
211 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
212 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
213 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
214 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
215 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
216 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
217 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
218 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
219 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.93
Nodule 0
Rhizoplane 6.02
Rhizosphere 88.22
Stem 0
Stem Tuber 0
Unclassified 1.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25405J52794_10023573 3300003911 Bacteria 1253
2 Ga0065712_10188138 3300005290 Bacteria 1160
3 Ga0065715_10007018 3300005293 Bacteria 3130
4 Ga0070690_100313414 3300005330 Unclassified 1128
5 Ga0070670_100083050 3300005331 Bacteria 2753
6 Ga0070670_100164814 3300005331 Bacteria 1921
7 Ga0070666_10175833 3300005335 Bacteria 1501
8 Ga0070680_100478655 3300005336 Bacteria 1064
9 Ga0070682_101002488 3300005337 Bacteria 693
10 Ga0068868_100421867 3300005338 Bacteria 1155
11 Ga0070689_100549006 3300005340 Bacteria 995
12 Ga0070668_100911800 3300005347 Bacteria 786
13 Ga0070669_100182115 3300005353 Bacteria 1644
14 Ga0070675_100010702 3300005354 Bacteria 7174
15 Ga0070671_100010806 3300005355 Bacteria 7328
16 Ga0070671_100194925 3300005355 Bacteria 1717
17 Ga0070674_100524997 3300005356 Bacteria 989
18 Ga0070673_100010189 3300005364 Bacteria 6348
19 Ga0070673_100037529 3300005364 Bacteria 3693
20 Ga0070688_100159183 3300005365 Bacteria 1550
21 Ga0070667_100007337 3300005367 Bacteria 9164
22 Ga0070667_100266099 3300005367 Bacteria 1536
23 Ga0070709_10094830 3300005434 Bacteria 1975
24 Ga0070709_10113658 3300005434 Bacteria 1824
25 Ga0070709_10162930 3300005434 Bacteria 1552
26 Ga0070714_100042473 3300005435 Bacteria 3842
27 Ga0070714_100063004 3300005435 Bacteria 3187
28 Ga0070714_100273051 3300005435 Bacteria 1568
29 Ga0070713_100022748 3300005436 Bacteria 4849
30 Ga0070713_100033621 3300005436 Bacteria 4109
31 Ga0070713_100166472 3300005436 Bacteria 1971
32 Ga0070713_100968512 3300005436 Unclassified 820
33 Ga0070710_10006379 3300005437 Bacteria 5664
34 Ga0070710_10068478 3300005437 Bacteria 2039
35 Ga0070710_10112590 3300005437 Bacteria 1637
36 Ga0070710_10247247 3300005437 Bacteria 1145
37 Ga0070710_10283700 3300005437 Bacteria 1075
38 Ga0070710_10458895 3300005437 Bacteria 865
39 Ga0070711_100071170 3300005439 Bacteria 2450
40 Ga0070708_100030772 3300005445 Bacteria 4642
41 Ga0070678_100040650 3300005456 Bacteria 3291
42 Ga0070678_100159498 3300005456 Unclassified 1826
43 Ga0070706_100003856 3300005467 Bacteria 14645
44 Ga0070706_100189645 3300005467 Bacteria 1921
45 Ga0070706_100745292 3300005467 Bacteria 908
46 Ga0070706_100928310 3300005467 Bacteria 804
47 Ga0070707_100009581 3300005468 Bacteria 8997
48 Ga0070707_100043920 3300005468 Bacteria 4278
49 Ga0070707_100377856 3300005468 Bacteria 1376
50 Ga0070698_100056279 3300005471 Bacteria 3986
51 Ga0070698_100072598 3300005471 Bacteria 3449
52 Ga0070698_100336296 3300005471 Bacteria 1441
53 Ga0070698_100698338 3300005471 Unclassified 956
54 Ga0070699_100195134 3300005518 Bacteria 1799
55 Ga0070699_100609723 3300005518 Bacteria 996
56 Ga0070697_100032946 3300005536 Bacteria 4172
57 Ga0070697_100050507 3300005536 Bacteria 3376
58 Ga0070697_100162558 3300005536 Bacteria 1886
59 Ga0070697_100315646 3300005536 Bacteria 1345
60 Ga0070672_100003706 3300005543 Bacteria 9942
61 Ga0070672_101053256 3300005543 Bacteria 722
62 Ga0070686_100078178 3300005544 Bacteria 2184
63 Ga0070696_100340870 3300005546 Bacteria 1158
64 Ga0070665_100415796 3300005548 Bacteria 1353
65 Ga0070664_100021908 3300005564 Bacteria 5269
66 Ga0070664_100022964 3300005564 Bacteria 5147
67 Ga0068856_100014896 3300005614 Bacteria 7505
68 Ga0068859_100022320 3300005617 Bacteria 6346
69 Ga0068864_100010048 3300005618 Bacteria 7814
70 Ga0068864_100589060 3300005618 Bacteria 1078
71 Ga0068863_100014682 3300005841 Bacteria 7539
72 Ga0068858_100058034 3300005842 Bacteria 3578
73 Ga0068860_100003375 3300005843 Bacteria 16425
74 Ga0068862_100687441 3300005844 Bacteria 990
75 Ga0081455_10001551 3300005937 Bacteria 28269
76 Ga0081455_10012178 3300005937 Bacteria 8591
77 Ga0081455_10087994 3300005937 Bacteria 2526
78 Ga0081538_10007708 3300005981 Bacteria 9274
79 Ga0081540_1069880 3300005983 Bacteria 1629
80 Ga0070717_10061025 3300006028 Bacteria 3123
81 Ga0070717_10062120 3300006028 Bacteria 3097
82 Ga0070717_10065515 3300006028 Bacteria 3020
83 Ga0070717_10088042 3300006028 Bacteria 2616
84 Ga0070717_10095148 3300006028 Unclassified 2521
85 Ga0070717_10151073 3300006028 Bacteria 2009
86 Ga0075365_10007542 3300006038 Bacteria 6106
87 Ga0075365_10149422 3300006038 Bacteria 1625
88 Ga0075363_100045186 3300006048 Bacteria 2335
89 Ga0075364_10012837 3300006051 Bacteria 5138
90 Ga0070715_10077768 3300006163 Bacteria 1498
91 Ga0070715_10101143 3300006163 Bacteria 1344
92 Ga0070716_100029234 3300006173 Bacteria 2977
93 Ga0070716_100173034 3300006173 Unclassified 1411
94 Ga0070716_100212171 3300006173 Bacteria 1294
95 Ga0070716_100396833 3300006173 Unclassified 991
96 Ga0070716_100403860 3300006173 Bacteria 983
97 Ga0070712_100025495 3300006175 Bacteria 3930
98 Ga0070712_100214722 3300006175 Bacteria 1519
99 Ga0070712_100246474 3300006175 Bacteria 1425
100 Ga0075362_10003668 3300006177 Bacteria 5418
101 Ga0075367_10525630 3300006178 Bacteria 751
102 Ga0097621_100077458 3300006237 Bacteria 2760
103 Ga0068871_100070304 3300006358 Bacteria 2877
104 Ga0075428_100006691 3300006844 Bacteria 12822
105 Ga0075428_100029350 3300006844 Bacteria 6084
106 Ga0075430_100006387 3300006846 Bacteria 9938
107 Ga0075431_100023869 3300006847 Bacteria 6261
108 Ga0075431_100447338 3300006847 Bacteria 1288
109 Ga0075433_10810553 3300006852 Bacteria 818
110 Ga0075429_100014439 3300006880 Bacteria 6844
111 Ga0075429_100466600 3300006880 Unclassified 1106
112 Ga0075429_100577365 3300006880 Bacteria 985
113 Ga0097620_100022322 3300006931 Bacteria 6346
114 Ga0099795_10002512 3300007788 Bacteria 4336
115 Ga0111539_10003176 3300009094 Bacteria 21748
116 Ga0111539_10008021 3300009094 Bacteria 13469
117 Ga0111539_10010223 3300009094 Bacteria 11825
118 Ga0111539_10030139 3300009094 Bacteria 6598
119 Ga0111539_10323265 3300009094 Bacteria 1795
120 Ga0111539_10601450 3300009094 Bacteria 1281
121 Ga0114129_10092810 3300009147 Bacteria 4182
122 Ga0114129_11066063 3300009147 Bacteria 1014
123 Ga0105242_10240293 3300009176 Bacteria 1628
124 Ga0105242_10672853 3300009176 Bacteria 1009
125 Ga0105248_10008062 3300009177 Bacteria 11564
126 Ga0105248_10432405 3300009177 Bacteria 1482
127 Ga0105238_10192689 3300009551 Unclassified 2014
128 Ga0157370_10428997 3300013104 Bacteria 1216
129 Ga0157374_11253766 3300013296 Unclassified 763
130 Ga0157378_10184904 3300013297 Bacteria 1962
131 Ga0163162_10427402 3300013306 Bacteria 1457
132 Ga0163162_10544591 3300013306 Bacteria 1289
133 Ga0157375_10012042 3300013308 Bacteria 7659
134 Ga0163163_10029172 3300014325 Bacteria 5306
135 Ga0163163_10037370 3300014325 Bacteria 4724
136 Ga0163163_10195442 3300014325 Bacteria 2071
137 Ga0157380_10070484 3300014326 Bacteria 2825
138 Ga0182008_10195155 3300014497 Bacteria 1028
139 Ga0157377_10308979 3300014745 Bacteria 1046
140 Ga0157379_10010708 3300014968 Bacteria 7990
141 Ga0157379_10462843 3300014968 Bacteria 1172
142 Ga0157376_10461119 3300014969 Bacteria 1242
143 Ga0182007_10246762 3300015262 Bacteria 639
144 Ga0213874_10049729 3300021377 Bacteria 1282
145 Ga0213876_10047469 3300021384 Bacteria 2270
146 Ga0209130_1001007 3300025284 Bacteria 21875
147 Ga0209025_1055388 3300025294 Bacteria 1534
148 Ga0207426_1001221 3300025302 Bacteria 22681
149 Ga0207692_10009471 3300025898 Bacteria 4071
150 Ga0207692_10045772 3300025898 Bacteria 2190
151 Ga0207692_10053934 3300025898 Bacteria 2050
152 Ga0207692_10087559 3300025898 Bacteria 1681
153 Ga0207692_10558978 3300025898 Bacteria 732
154 Ga0207642_10141104 3300025899 Bacteria 1271
155 Ga0207680_10168895 3300025903 Bacteria 1472
156 Ga0207685_10003021 3300025905 Bacteria 3997
157 Ga0207685_10058298 3300025905 Bacteria 1518
158 Ga0207699_10031033 3300025906 Bacteria 2997
159 Ga0207699_10121692 3300025906 Bacteria 1689
160 Ga0207699_10289671 3300025906 Bacteria 1140
161 Ga0207684_10007312 3300025910 Bacteria 9961
162 Ga0207684_10018620 3300025910 Bacteria 5945
163 Ga0207684_10262793 3300025910 Bacteria 1489
164 Ga0207684_10480866 3300025910 Bacteria 1065
165 Ga0207693_10040863 3300025915 Bacteria 3653
166 Ga0207693_10045839 3300025915 Bacteria 3435
167 Ga0207693_10115431 3300025915 Bacteria 2108
168 Ga0207693_10565839 3300025915 Bacteria 886
169 Ga0207663_10010522 3300025916 Bacteria 4929
170 Ga0207663_10063556 3300025916 Bacteria 2351
171 Ga0207663_10118164 3300025916 Bacteria 1811
172 Ga0207663_10145762 3300025916 Bacteria 1655
173 Ga0207663_10181037 3300025916 Bacteria 1505
174 Ga0207649_10158093 3300025920 Bacteria 1568
175 Ga0207646_10038887 3300025922 Bacteria 4282
176 Ga0207646_10050365 3300025922 Bacteria 3728
177 Ga0207694_10130181 3300025924 Bacteria 2016
178 Ga0207650_10037125 3300025925 Bacteria 3549
179 Ga0207659_10006458 3300025926 Bacteria 7184
180 Ga0207700_10018768 3300025928 Bacteria 4656
181 Ga0207700_10074112 3300025928 Bacteria 2632
182 Ga0207700_10155848 3300025928 Bacteria 1892
183 Ga0207700_10159936 3300025928 Bacteria 1869
184 Ga0207700_10162818 3300025928 Bacteria 1854
185 Ga0207700_10243086 3300025928 Bacteria 1535
186 Ga0207664_10064026 3300025929 Bacteria 2939
187 Ga0207664_10282731 3300025929 Bacteria 1456
188 Ga0207664_10773909 3300025929 Unclassified 863
189 Ga0207670_10086283 3300025936 Bacteria 2208
190 Ga0207665_10013361 3300025939 Bacteria 5397
191 Ga0207665_10079277 3300025939 Bacteria 2257
192 Ga0207691_10015106 3300025940 Bacteria 7348
193 Ga0207711_10004690 3300025941 Bacteria 11612
194 Ga0207679_10045343 3300025945 Bacteria 3179
195 Ga0207679_10061005 3300025945 Bacteria 2805
196 Ga0207651_10005516 3300025960 Bacteria 6507
197 Ga0207651_10027425 3300025960 Bacteria 3577
198 Ga0207658_10006077 3300025986 Bacteria 8247
199 Ga0207658_10140418 3300025986 Bacteria 1954
200 Ga0207703_10643377 3300026035 Bacteria 1005
201 Ga0207702_10142372 3300026078 Bacteria 2171
202 Ga0207702_10877068 3300026078 Bacteria 889
203 Ga0207641_10012796 3300026088 Bacteria 6877
204 Ga0207648_10884640 3300026089 Bacteria 834
205 Ga0207676_10000577 3300026095 Bacteria 30147
206 Ga0207683_10037481 3300026121 Bacteria 4222
207 Ga0207428_10001406 3300027907 Bacteria 25385
208 Ga0207428_10023890 3300027907 Bacteria 5134
209 Ga0207428_10154397 3300027907 Bacteria 1746
210 Ga0268264_10007837 3300028381 Bacteria 8889
211 Ga0307413_10333449 3300031824 Bacteria 1164
212 Ga0307409_100089314 3300031995 Bacteria 2519
213 Ga0373940_0134636 3300035088 Bacteria 777
214 Ga0373936_0058911 3300035113 Bacteria 1564
215 Ga0373945_0112498 3300035116 Bacteria 1075
216 Ga0373945_0147525 3300035116 Bacteria 952
217 Ga0373953_0008466 3300035117 Bacteria 3495
218 Ga0373935_0033681 3300035692 Bacteria 3190
219 Ga0373927_0142868 3300035695 Bacteria 1566
220 Ga0373933_0049822 3300035724 Bacteria 2498
221 Ga0373947_0001920 3300035725 Bacteria 12715
222 Ga0373937_0020339 3300036401 Bacteria 5951
223 Ga0373937_0030473 3300036401 Bacteria 4886
224 Ga0373937_0062485 3300036401 Bacteria 3424
225 Ga0373937_0084586 3300036401 Bacteria 2935
226 Ga0373925_0010689 3300037068 Bacteria 6655
227 Ga0373925_0552546 3300037068 Bacteria 947
228 Ga0395900_0005689 3300037418 Bacteria 13033
229 Ga0436364_0543497 3300037853 Bacteria 13090
230 Ga0395901_0049520 3300038443 Bacteria 4365
231 Ga0395901_0513132 3300038443 Bacteria 1219
232 Ga0436365_0903053 3300039437 Bacteria 4408
233 Ga0436360_0014177 3300039438 Unclassified 1293
234 Ga0436360_0136949 3300039438 Bacteria 2301
235 Ga0436360_1321081 3300039438 Bacteria 1964
236 Ga0436361_0381344 3300039447 Bacteria 2635
237 Ga0436361_1218618 3300039447 Bacteria 811
238 Ga0436363_0099507 3300039450 Bacteria 4503
239 Ga0436363_0156670 3300039450 Bacteria 4530
240 Ga0436363_0933804 3300039450 Bacteria 1056
241 Ga0436362_0958854 3300039453 Bacteria 2371
242 Ga0436362_1147277 3300039453 Bacteria 994
243 Ga0439464_0006213 3300042439 Bacteria 3108
244 Ga0466961_0001321 3300044693 Bacteria 15313
245 Ga0466963_0506416 3300044694 Bacteria 852
246 Ga0466959_0005885 3300045049 Bacteria 8447
247 Ga0466958_0086081 3300045836 Bacteria 1939
248 Ga0466967_0007178 3300045976 Bacteria 8004
249 Ga0495603_0263940 3300046455 Bacteria 991
250 Ga0495603_0433656 3300046455 Unclassified 753
251 Ga0495629_0000008 3300046459 Bacteria 352138
252 Ga0495651_0009134 3300046462 Bacteria 7609
253 Ga0495653_0063535 3300046463 Bacteria 2785
254 Ga0495580_0048931 3300046472 Bacteria 2991
255 Ga0495580_0667919 3300046472 Bacteria 682
256 Ga0495664_0041528 3300046477 Bacteria 2722
257 Ga0495618_0400176 3300046514 Bacteria 840
258 Ga0495628_0066929 3300046516 Bacteria 2807
259 Ga0495628_0423144 3300046516 Bacteria 970
260 Ga0495640_0077936 3300046533 Bacteria 2209
261 Ga0495586_0349244 3300046535 Bacteria 849
262 Ga0495587_0016406 3300046536 Bacteria 4608
263 Ga0495587_0083461 3300046536 Bacteria 1851
264 Ga0495609_0128979 3300046538 Bacteria 1084
265 Ga0495622_0007105 3300046557 Bacteria 5202
266 Ga0495667_0013200 3300046559 Bacteria 5593
267 Ga0495656_0273431 3300046615 Bacteria 859
268 Ga0495634_0063493 3300046642 Bacteria 2451
269 Ga0495613_0047312 3300046689 Bacteria 3178
270 Ga0495600_0283165 3300046809 Bacteria 1049
271 Ga0495604_0041400 3300047317 Bacteria 3613
272 Ga0495674_0575667 3300047319 Bacteria 894
273 Ga0495680_0005962 3300047322 Bacteria 11396
274 Ga0495602_0010966 3300048088 Bacteria 9389
275 Ga0496100_0123897 3300048903 Bacteria 1812
276 Ga0496100_0237114 3300048903 Bacteria 1345
277 Ga0496101_1136809 3300048904 Bacteria 613
278 Ga0496102_0033750 3300048905 Bacteria 4602
279 Ga0496102_0521547 3300048905 Bacteria 1111
280 Ga0496102_0932252 3300048905 Bacteria 790
281 Ga0496103_0077470 3300048906 Bacteria 2087
282 Ga0496104_0005193 3300048907 Bacteria 11386
283 Ga0496104_0006133 3300048907 Bacteria 10549
284 Ga0496104_0165771 3300048907 Bacteria 2119
285 Ga0496104_0507625 3300048907 Unclassified 1117
286 Ga0496105_0536129 3300048908 Bacteria 915
287 Ga0496107_0638024 3300048910 Bacteria 786
288 Ga0496108_0487496 3300048911 Bacteria 1077
289 Ga0496109_0064646 3300048912 Bacteria 3348
290 Ga0496109_1217746 3300048912 Bacteria 689
291 Ga0496112_0046931 3300048915 Bacteria 4237
292 Ga0496112_0227827 3300048915 Bacteria 1819
293 Ga0496113_0103818 3300048916 Bacteria 2205
294 Ga0496113_0124412 3300048916 Bacteria 2019
295 Ga0496114_0795223 3300048917 Bacteria 824
296 Ga0496115_0449185 3300048918 Bacteria 1041
297 Ga0496115_0768461 3300048918 Bacteria 752
298 Ga0501031_0322415 3300049568 Bacteria 1001
299 Ga0501033_0046097 3300049570 Bacteria 3242
300 Ga0501036_0339723 3300049572 Bacteria 1254
301 Ga0501036_0766861 3300049572 Bacteria 795
302 Ga0501037_0210093 3300049573 Bacteria 1373
303 Ga0501037_0271988 3300049573 Bacteria 1182
304 Ga0501037_0587858 3300049573 Bacteria 749
305 Ga0501038_0226301 3300049574 Bacteria 1491
306 Ga0501039_0104393 3300049575 Bacteria 2212
307 Ga0501039_0128168 3300049575 Bacteria 1991
308 Ga0501039_0220728 3300049575 Bacteria 1490
309 Ga0501039_0337805 3300049575 Bacteria 1184
310 Ga0501040_0017233 3300049576 Bacteria 4795
311 Ga0501040_0100897 3300049576 Bacteria 2013
312 Ga0501040_0415005 3300049576 Bacteria 967
313 Ga0501041_0008876 3300049577 Bacteria 5915
314 Ga0501041_0125757 3300049577 Bacteria 1596
315 Ga0501042_0082511 3300049578 Bacteria 2304
316 Ga0501042_0090805 3300049578 Bacteria 2192
317 Ga0501043_0740609 3300049579 Unclassified 715
318 Ga0501046_0050846 3300049580 Bacteria 3273
319 Ga0501048_0010954 3300049582 Bacteria 6765
320 Ga0501048_0117941 3300049582 Bacteria 1875
321 Ga0501068_0336096 3300049584 Bacteria 970
322 Ga0501070_0070239 3300049586 Bacteria 2900
323 Ga0501071_0022904 3300049587 Bacteria 4358
324 Ga0501071_0174327 3300049587 Bacteria 1610
325 Ga0501072_0040876 3300049588 Bacteria 3642
326 Ga0501072_0104286 3300049588 Bacteria 2254
327 Ga0501074_0033615 3300049590 Bacteria 3717
328 Ga0501075_0053335 3300049591 Bacteria 3041
329 Ga0501075_0106084 3300049591 Bacteria 2135
330 Ga0501075_0148167 3300049591 Bacteria 1789
331 Ga0501075_0351977 3300049591 Bacteria 1122
332 Ga0501075_0545190 3300049591 Unclassified 885
333 Ga0501076_0017608 3300049592 Bacteria 5432
334 Ga0501076_0071578 3300049592 Bacteria 2774
335 Ga0501076_0089169 3300049592 Bacteria 2479
336 Ga0501079_0000224 3300049741 Bacteria 33716
337 Ga0501079_0034199 3300049741 Bacteria 3911
338 Ga0501080_0275976 3300049742 Bacteria 1529
339 Ga0501081_0003856 3300049743 Bacteria 9606
340 Ga0501081_0119085 3300049743 Bacteria 1879
341 Ga0501081_0134788 3300049743 Bacteria 1767
342 Ga0501081_0250145 3300049743 Bacteria 1294
343 Ga0501081_0738998 3300049743 Bacteria 739
344 Ga0501083_0089877 3300049744 Bacteria 2029
345 Ga0501045_0096921 3300049824 Bacteria 2182
346 Ga0501045_0148129 3300049824 Bacteria 1746
347 nmdc:mga03683_2022_c1 3300050489 Bacteria 6210
348 nmdc:mga03n38_61367_c1 3300050490 Bacteria 1712
349 nmdc:mga00v17_3704_c1 3300050491 Bacteria 7899
350 nmdc:mga0yw44_100893_c1 3300050492 Bacteria 1838
351 nmdc:mga0yw44_29497_c1 3300050492 Bacteria 3168
352 nmdc:mga0k408_15680_c1 3300050493 Bacteria 4194
353 nmdc:mga05p37_41303_c1 3300050507 Bacteria 5663
354 nmdc:mga05p37_523647_c1 3300050507 Bacteria 1355
355 nmdc:mga05p37_85381_c1 3300050507 Bacteria 3889
356 nmdc:mga09592_168408_c1 3300050508 Bacteria 1894
357 nmdc:mga09592_65780_c1 3300050508 Bacteria 3072
358 nmdc:mga0qj67_5888_c1 3300050509 Bacteria 8983
359 nmdc:mga06r32_106829_c1 3300050510 Bacteria 2750
360 nmdc:mga06r32_2915_c1 3300050510 Bacteria 15345
361 nmdc:mga06r32_337791_c1 3300050510 Bacteria 1491
362 nmdc:mga06r32_371853_c1 3300050510 Bacteria 1412
363 nmdc:mga08y16_2547_c1 3300050511 Bacteria 18743
364 nmdc:mga08y16_41129_c1 3300050511 Bacteria 4842
365 nmdc:mga08y16_8565_c1 3300050511 Bacteria 10010
366 nmdc:mga0n895_471683_c1 3300050512 Bacteria 1266
367 nmdc:mga0n895_617278_c1 3300050512 Bacteria 1085
368 nmdc:mga0a205_268414_c1 3300050515 Bacteria 1583
369 Ga0495601_0033784 3300053077 Bacteria 3188
370 Ga0495612_0101957 3300053078 Bacteria 1223
371 Ga0495595_0019923 3300053084 Bacteria 2914
372 Ga0495619_0008193 3300053085 Bacteria 6608
373 Ga0501084_0007164 3300054114 Bacteria 9188
374 Ga0501084_0109261 3300054114 Bacteria 2323
375 Ga0501084_0765432 3300054114 Bacteria 813
376 Ga0501082_0005430 3300060353 Bacteria 11062
377 Ga0501082_0136864 3300060353 Bacteria 2125
378 Ga0501082_0264295 3300060353 Bacteria 1497
379 Ga0501082_0972266 3300060353 Bacteria 742
380 Ga0530510_0026280 3300061734 Bacteria 4166
381 Ga0530510_0030741 3300061734 Bacteria 3859
382 Ga0530510_0866371 3300061734 Bacteria 690

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300039438 Ga0436360_0136949 Ga0436360_0136949_132_743 167
2 3300005937 Ga0081455_10087994 Ga0081455_100879943 183
3 3300044693 Ga0466961_0001321 Ga0466961_0001321_2065_2628 185
4 3300045049 Ga0466959_0005885 Ga0466959_0005885_961_1524 185
5 3300039438 Ga0436360_0014177 Ga0436360_0014177_71_631 186
6 3300039453 Ga0436362_1147277 Ga0436362_1147277_341_901 186
7 3300005356 Ga0070674_100524997 Ga0070674_1005249972 187
8 3300005434 Ga0070709_10113658 Ga0070709_101136582 187
9 3300005437 Ga0070710_10283700 Ga0070710_102837001 187
10 3300006028 Ga0070717_10065515 Ga0070717_100655154 187
11 3300006173 Ga0070716_100212171 Ga0070716_1002121712 187
12 3300025898 Ga0207692_10053934 Ga0207692_100539342 187
13 3300025899 Ga0207642_10141104 Ga0207642_101411041 187
14 3300025915 Ga0207693_10045839 Ga0207693_100458394 187
15 3300025916 Ga0207663_10063556 Ga0207663_100635563 187
16 3300025928 Ga0207700_10162818 Ga0207700_101628181 187
17 3300025929 Ga0207664_10282731 Ga0207664_102827312 187
18 3300025939 Ga0207665_10079277 Ga0207665_100792772 187
19 3300037418 Ga0395900_0005689 Ga0395900_0005689_1841_2404 187
20 3300038443 Ga0395901_0049520 Ga0395901_0049520_3292_3855 187
21 3300039447 Ga0436361_0381344 Ga0436361_0381344_104_670 187
22 3300042439 Ga0439464_0006213 Ga0439464_0006213_2233_2811 187
23 3300044694 Ga0466963_0506416 Ga0466963_0506416_18_581 187
24 3300045836 Ga0466958_0086081 Ga0466958_0086081_489_1052 187
25 3300045976 Ga0466967_0007178 Ga0466967_0007178_3388_3951 187
26 3300049570 Ga0501033_0046097 Ga0501033_0046097_2358_2921 187
27 3300049573 Ga0501037_0587858 Ga0501037_0587858_15_578 187
28 3300049574 Ga0501038_0226301 Ga0501038_0226301_502_1065 187
29 3300049575 Ga0501039_0128168 Ga0501039_0128168_638_1201 187
30 3300049576 Ga0501040_0017233 Ga0501040_0017233_4086_4649 187
31 3300049577 Ga0501041_0008876 Ga0501041_0008876_3773_4336 187
32 3300049578 Ga0501042_0082511 Ga0501042_0082511_1164_1727 187
33 3300049579 Ga0501043_0740609 Ga0501043_0740609_38_601 187
34 3300049580 Ga0501046_0050846 Ga0501046_0050846_931_1494 187
35 3300049582 Ga0501048_0010954 Ga0501048_0010954_2406_2969 187
36 3300049586 Ga0501070_0070239 Ga0501070_0070239_1594_2157 187
37 3300049590 Ga0501074_0033615 Ga0501074_0033615_333_896 187
38 3300049591 Ga0501075_0106084 Ga0501075_0106084_314_877 187
39 3300049592 Ga0501076_0071578 Ga0501076_0071578_666_1229 187
40 3300049741 Ga0501079_0000224 Ga0501079_0000224_31448_32011 187
41 3300049742 Ga0501080_0275976 Ga0501080_0275976_613_1176 187
42 3300049743 Ga0501081_0003856 Ga0501081_0003856_776_1339 187
43 3300049743 Ga0501081_0250145 Ga0501081_0250145_188_751 187
44 3300049744 Ga0501083_0089877 Ga0501083_0089877_720_1283 187
45 3300054114 Ga0501084_0007164 Ga0501084_0007164_6206_6769 187
46 3300060353 Ga0501082_0005430 Ga0501082_0005430_6667_7230 187
47 3300060353 Ga0501082_0972266 Ga0501082_0972266_68_631 187
48 3300061734 Ga0530510_0030741 Ga0530510_0030741_286_849 187
49 3300006844 Ga0075428_100006691 Ga0075428_10000669110 188
50 3300009094 Ga0111539_10008021 Ga0111539_100080214 188
51 3300026078 Ga0207702_10877068 Ga0207702_108770682 188
52 3300027907 Ga0207428_10154397 Ga0207428_101543972 188
53 3300046615 Ga0495656_0273431 Ga0495656_0273431_82_648 188
54 3300050511 nmdc:mga08y16_8565_c1 nmdc:mga08y16_8565_c1_3130_3696 188
55 3300050512 nmdc:mga0n895_617278_c1 nmdc:mga0n895_617278_c1_22_588 188
56 3300060353 Ga0501082_0264295 Ga0501082_0264295_670_1239 188
57 3300005290 Ga0065712_10188138 Ga0065712_101881381 189
58 3300005293 Ga0065715_10007018 Ga0065715_100070182 189
59 3300005331 Ga0070670_100164814 Ga0070670_1001648142 189
60 3300005335 Ga0070666_10175833 Ga0070666_101758332 189
61 3300005336 Ga0070680_100478655 Ga0070680_1004786552 189
62 3300005338 Ga0068868_100421867 Ga0068868_1004218672 189
63 3300005340 Ga0070689_100549006 Ga0070689_1005490062 189
64 3300005347 Ga0070668_100911800 Ga0070668_1009118002 189
65 3300005353 Ga0070669_100182115 Ga0070669_1001821151 189
66 3300005354 Ga0070675_100010702 Ga0070675_1000107023 189
67 3300005355 Ga0070671_100010806 Ga0070671_1000108062 189
68 3300005355 Ga0070671_100194925 Ga0070671_1001949252 189
69 3300005364 Ga0070673_100010189 Ga0070673_1000101893 189
70 3300005364 Ga0070673_100037529 Ga0070673_1000375292 189
71 3300005365 Ga0070688_100159183 Ga0070688_1001591832 189
72 3300005367 Ga0070667_100007337 Ga0070667_1000073374 189
73 3300005367 Ga0070667_100266099 Ga0070667_1002660992 189
74 3300005434 Ga0070709_10094830 Ga0070709_100948301 189
75 3300005434 Ga0070709_10162930 Ga0070709_101629303 189
76 3300005435 Ga0070714_100042473 Ga0070714_1000424732 189
77 3300005435 Ga0070714_100063004 Ga0070714_1000630042 189
78 3300005435 Ga0070714_100273051 Ga0070714_1002730512 189
79 3300005436 Ga0070713_100022748 Ga0070713_1000227483 189
80 3300005436 Ga0070713_100033621 Ga0070713_1000336214 189
81 3300005436 Ga0070713_100166472 Ga0070713_1001664722 189
82 3300005436 Ga0070713_100968512 Ga0070713_1009685121 189
83 3300005437 Ga0070710_10006379 Ga0070710_100063793 189
84 3300005437 Ga0070710_10068478 Ga0070710_100684782 189
85 3300005437 Ga0070710_10112590 Ga0070710_101125902 189
86 3300005437 Ga0070710_10247247 Ga0070710_102472472 189
87 3300005437 Ga0070710_10458895 Ga0070710_104588952 189
88 3300005439 Ga0070711_100071170 Ga0070711_1000711702 189
89 3300005445 Ga0070708_100030772 Ga0070708_1000307724 189
90 3300005456 Ga0070678_100040650 Ga0070678_1000406502 189
91 3300005467 Ga0070706_100003856 Ga0070706_1000038567 189
92 3300005467 Ga0070706_100189645 Ga0070706_1001896454 189
93 3300005467 Ga0070706_100745292 Ga0070706_1007452921 189
94 3300005467 Ga0070706_100928310 Ga0070706_1009283101 189
95 3300005468 Ga0070707_100009581 Ga0070707_1000095812 189
96 3300005468 Ga0070707_100043920 Ga0070707_1000439202 189
97 3300005468 Ga0070707_100377856 Ga0070707_1003778562 189
98 3300005471 Ga0070698_100056279 Ga0070698_1000562792 189
99 3300005471 Ga0070698_100072598 Ga0070698_1000725982 189
100 3300005471 Ga0070698_100336296 Ga0070698_1003362962 189
101 3300005471 Ga0070698_100698338 Ga0070698_1006983382 189
102 3300005518 Ga0070699_100195134 Ga0070699_1001951342 189
103 3300005518 Ga0070699_100609723 Ga0070699_1006097232 189
104 3300005536 Ga0070697_100032946 Ga0070697_1000329463 189
105 3300005536 Ga0070697_100050507 Ga0070697_1000505072 189
106 3300005536 Ga0070697_100162558 Ga0070697_1001625582 189
107 3300005536 Ga0070697_100315646 Ga0070697_1003156462 189
108 3300005543 Ga0070672_100003706 Ga0070672_1000037063 189
109 3300005543 Ga0070672_101053256 Ga0070672_1010532562 189
110 3300005544 Ga0070686_100078178 Ga0070686_1000781782 189
111 3300005546 Ga0070696_100340870 Ga0070696_1003408702 189
112 3300005548 Ga0070665_100415796 Ga0070665_1004157962 189
113 3300005564 Ga0070664_100021908 Ga0070664_1000219082 189
114 3300005564 Ga0070664_100022964 Ga0070664_1000229642 189
115 3300005614 Ga0068856_100014896 Ga0068856_1000148964 189
116 3300005617 Ga0068859_100022320 Ga0068859_1000223203 189
117 3300005618 Ga0068864_100010048 Ga0068864_1000100482 189
118 3300005618 Ga0068864_100589060 Ga0068864_1005890602 189
119 3300005841 Ga0068863_100014682 Ga0068863_1000146823 189
120 3300005842 Ga0068858_100058034 Ga0068858_1000580343 189
121 3300005843 Ga0068860_100003375 Ga0068860_1000033754 189
122 3300005844 Ga0068862_100687441 Ga0068862_1006874412 189
123 3300005937 Ga0081455_10001551 Ga0081455_100015512 189
124 3300005981 Ga0081538_10007708 Ga0081538_100077083 189
125 3300005983 Ga0081540_1069880 Ga0081540_10698803 189
126 3300006028 Ga0070717_10061025 Ga0070717_100610253 189
127 3300006028 Ga0070717_10151073 Ga0070717_101510733 189
128 3300006038 Ga0075365_10007542 Ga0075365_100075423 189
129 3300006038 Ga0075365_10149422 Ga0075365_101494222 189
130 3300006048 Ga0075363_100045186 Ga0075363_1000451862 189
131 3300006051 Ga0075364_10012837 Ga0075364_100128373 189
132 3300006163 Ga0070715_10077768 Ga0070715_100777682 189
133 3300006163 Ga0070715_10101143 Ga0070715_101011432 189
134 3300006173 Ga0070716_100029234 Ga0070716_1000292343 189
135 3300006173 Ga0070716_100173034 Ga0070716_1001730342 189
136 3300006173 Ga0070716_100396833 Ga0070716_1003968332 189
137 3300006173 Ga0070716_100403860 Ga0070716_1004038601 189
138 3300006175 Ga0070712_100025495 Ga0070712_1000254953 189
139 3300006175 Ga0070712_100214722 Ga0070712_1002147222 189
140 3300006175 Ga0070712_100246474 Ga0070712_1002464742 189
141 3300006177 Ga0075362_10003668 Ga0075362_100036683 189
142 3300006178 Ga0075367_10525630 Ga0075367_105256301 189
143 3300006237 Ga0097621_100077458 Ga0097621_1000774582 189
144 3300006358 Ga0068871_100070304 Ga0068871_1000703042 189
145 3300006844 Ga0075428_100029350 Ga0075428_1000293504 189
146 3300006847 Ga0075431_100447338 Ga0075431_1004473382 189
147 3300006852 Ga0075433_10810553 Ga0075433_108105532 189
148 3300006880 Ga0075429_100466600 Ga0075429_1004666002 189
149 3300006880 Ga0075429_100577365 Ga0075429_1005773652 189
150 3300006931 Ga0097620_100022322 Ga0097620_1000223223 189
151 3300007788 Ga0099795_10002512 Ga0099795_100025122 189
152 3300009094 Ga0111539_10010223 Ga0111539_100102234 189
153 3300009094 Ga0111539_10030139 Ga0111539_100301394 189
154 3300009094 Ga0111539_10323265 Ga0111539_103232652 189
155 3300009094 Ga0111539_10601450 Ga0111539_106014502 189
156 3300009147 Ga0114129_10092810 Ga0114129_100928104 189
157 3300009147 Ga0114129_11066063 Ga0114129_110660632 189
158 3300009176 Ga0105242_10240293 Ga0105242_102402932 189
159 3300009176 Ga0105242_10672853 Ga0105242_106728532 189
160 3300009177 Ga0105248_10008062 Ga0105248_100080623 189
161 3300009177 Ga0105248_10432405 Ga0105248_104324052 189
162 3300013104 Ga0157370_10428997 Ga0157370_104289972 189
163 3300013297 Ga0157378_10184904 Ga0157378_101849042 189
164 3300013306 Ga0163162_10427402 Ga0163162_104274022 189
165 3300013306 Ga0163162_10544591 Ga0163162_105445912 189
166 3300013308 Ga0157375_10012042 Ga0157375_100120423 189
167 3300014325 Ga0163163_10029172 Ga0163163_100291722 189
168 3300014325 Ga0163163_10195442 Ga0163163_101954422 189
169 3300014326 Ga0157380_10070484 Ga0157380_100704842 189
170 3300014497 Ga0182008_10195155 Ga0182008_101951552 189
171 3300014745 Ga0157377_10308979 Ga0157377_103089791 189
172 3300014968 Ga0157379_10010708 Ga0157379_100107083 189
173 3300014968 Ga0157379_10462843 Ga0157379_104628432 189
174 3300014969 Ga0157376_10461119 Ga0157376_104611192 189
175 3300015262 Ga0182007_10246762 Ga0182007_102467621 189
176 3300021377 Ga0213874_10049729 Ga0213874_100497291 189
177 3300021384 Ga0213876_10047469 Ga0213876_100474692 189
178 3300025284 Ga0209130_1001007 Ga0209130_10010076 189
179 3300025294 Ga0209025_1055388 Ga0209025_10553882 189
180 3300025302 Ga0207426_1001221 Ga0207426_10012216 189
181 3300025898 Ga0207692_10009471 Ga0207692_100094714 189
182 3300025898 Ga0207692_10087559 Ga0207692_100875592 189
183 3300025898 Ga0207692_10558978 Ga0207692_105589781 189
184 3300025903 Ga0207680_10168895 Ga0207680_101688952 189
185 3300025905 Ga0207685_10003021 Ga0207685_100030212 189
186 3300025905 Ga0207685_10058298 Ga0207685_100582982 189
187 3300025906 Ga0207699_10031033 Ga0207699_100310332 189
188 3300025906 Ga0207699_10121692 Ga0207699_101216922 189
189 3300025906 Ga0207699_10289671 Ga0207699_102896712 189
190 3300025910 Ga0207684_10018620 Ga0207684_100186207 189
191 3300025910 Ga0207684_10262793 Ga0207684_102627932 189
192 3300025910 Ga0207684_10480866 Ga0207684_104808662 189
193 3300025915 Ga0207693_10040863 Ga0207693_100408632 189
194 3300025915 Ga0207693_10115431 Ga0207693_101154312 189
195 3300025915 Ga0207693_10565839 Ga0207693_105658392 189
196 3300025916 Ga0207663_10010522 Ga0207663_100105224 189
197 3300025916 Ga0207663_10181037 Ga0207663_101810371 189
198 3300025920 Ga0207649_10158093 Ga0207649_101580932 189
199 3300025922 Ga0207646_10038887 Ga0207646_100388872 189
200 3300025922 Ga0207646_10050365 Ga0207646_100503652 189
201 3300025924 Ga0207694_10130181 Ga0207694_101301812 189
202 3300025925 Ga0207650_10037125 Ga0207650_100371252 189
203 3300025926 Ga0207659_10006458 Ga0207659_100064582 189
204 3300025928 Ga0207700_10018768 Ga0207700_100187683 189
205 3300025928 Ga0207700_10074112 Ga0207700_100741122 189
206 3300025928 Ga0207700_10155848 Ga0207700_101558482 189
207 3300025928 Ga0207700_10243086 Ga0207700_102430862 189
208 3300025929 Ga0207664_10064026 Ga0207664_100640263 189
209 3300025929 Ga0207664_10773909 Ga0207664_107739092 189
210 3300025936 Ga0207670_10086283 Ga0207670_100862831 189
211 3300025939 Ga0207665_10013361 Ga0207665_100133614 189
212 3300025940 Ga0207691_10015106 Ga0207691_100151062 189
213 3300025941 Ga0207711_10004690 Ga0207711_100046903 189
214 3300025945 Ga0207679_10045343 Ga0207679_100453432 189
215 3300025945 Ga0207679_10061005 Ga0207679_100610052 189
216 3300025960 Ga0207651_10005516 Ga0207651_100055163 189
217 3300025960 Ga0207651_10027425 Ga0207651_100274252 189
218 3300025986 Ga0207658_10006077 Ga0207658_100060773 189
219 3300025986 Ga0207658_10140418 Ga0207658_101404182 189
220 3300026035 Ga0207703_10643377 Ga0207703_106433772 189
221 3300026078 Ga0207702_10142372 Ga0207702_101423721 189
222 3300026088 Ga0207641_10012796 Ga0207641_100127963 189
223 3300026089 Ga0207648_10884640 Ga0207648_108846402 189
224 3300026095 Ga0207676_10000577 Ga0207676_1000057711 189
225 3300026121 Ga0207683_10037481 Ga0207683_100374812 189
226 3300027907 Ga0207428_10001406 Ga0207428_100014065 189
227 3300028381 Ga0268264_10007837 Ga0268264_100078376 189
228 3300031824 Ga0307413_10333449 Ga0307413_103334492 189
229 3300031995 Ga0307409_100089314 Ga0307409_1000893142 189
230 3300035088 Ga0373940_0134636 Ga0373940_0134636_190_759 189
231 3300035113 Ga0373936_0058911 Ga0373936_0058911_466_1077 189
232 3300035116 Ga0373945_0112498 Ga0373945_0112498_224_835 189
233 3300035692 Ga0373935_0033681 Ga0373935_0033681_1821_2513 189
234 3300035695 Ga0373927_0142868 Ga0373927_0142868_422_1114 189
235 3300035725 Ga0373947_0001920 Ga0373947_0001920_823_1515 189
236 3300036401 Ga0373937_0030473 Ga0373937_0030473_2563_3132 189
237 3300036401 Ga0373937_0062485 Ga0373937_0062485_1202_1894 189
238 3300036401 Ga0373937_0084586 Ga0373937_0084586_1591_2160 189
239 3300037068 Ga0373925_0010689 Ga0373925_0010689_26_637 189
240 3300037068 Ga0373925_0552546 Ga0373925_0552546_25_630 189
241 3300037853 Ga0436364_0543497 Ga0436364_0543497_9868_10437 189
242 3300038443 Ga0395901_0513132 Ga0395901_0513132_130_699 189
243 3300039437 Ga0436365_0903053 Ga0436365_0903053_910_1500 189
244 3300039438 Ga0436360_1321081 Ga0436360_1321081_586_1161 189
245 3300039447 Ga0436361_1218618 Ga0436361_1218618_93_689 189
246 3300039450 Ga0436363_0099507 Ga0436363_0099507_138_722 189
247 3300039450 Ga0436363_0156670 Ga0436363_0156670_952_1542 189
248 3300039450 Ga0436363_0933804 Ga0436363_0933804_42_617 189
249 3300039453 Ga0436362_0958854 Ga0436362_0958854_1598_2167 189
250 3300046455 Ga0495603_0263940 Ga0495603_0263940_386_955 189
251 3300046455 Ga0495603_0433656 Ga0495603_0433656_109_687 189
252 3300046459 Ga0495629_0000008 Ga0495629_0000008_140981_141568 189
253 3300046472 Ga0495580_0048931 Ga0495580_0048931_1906_2475 189
254 3300046472 Ga0495580_0667919 Ga0495580_0667919_48_659 189
255 3300046516 Ga0495628_0423144 Ga0495628_0423144_230_811 189
256 3300046535 Ga0495586_0349244 Ga0495586_0349244_201_812 189
257 3300046536 Ga0495587_0083461 Ga0495587_0083461_271_840 189
258 3300046538 Ga0495609_0128979 Ga0495609_0128979_26_595 189
259 3300046557 Ga0495622_0007105 Ga0495622_0007105_1392_1976 189
260 3300046809 Ga0495600_0283165 Ga0495600_0283165_261_869 189
261 3300047319 Ga0495674_0575667 Ga0495674_0575667_26_718 189
262 3300048903 Ga0496100_0123897 Ga0496100_0123897_594_1163 189
263 3300048903 Ga0496100_0237114 Ga0496100_0237114_205_822 189
264 3300048904 Ga0496101_1136809 Ga0496101_1136809_34_603 189
265 3300048905 Ga0496102_0033750 Ga0496102_0033750_3726_4295 189
266 3300048905 Ga0496102_0521547 Ga0496102_0521547_311_928 189
267 3300048906 Ga0496103_0077470 Ga0496103_0077470_638_1207 189
268 3300048907 Ga0496104_0165771 Ga0496104_0165771_495_1064 189
269 3300048907 Ga0496104_0507625 Ga0496104_0507625_163_780 189
270 3300048910 Ga0496107_0638024 Ga0496107_0638024_115_684 189
271 3300048911 Ga0496108_0487496 Ga0496108_0487496_35_652 189
272 3300048912 Ga0496109_0064646 Ga0496109_0064646_2224_2793 189
273 3300048915 Ga0496112_0046931 Ga0496112_0046931_3366_3935 189
274 3300048915 Ga0496112_0227827 Ga0496112_0227827_768_1385 189
275 3300048918 Ga0496115_0768461 Ga0496115_0768461_45_650 189
276 3300049568 Ga0501031_0322415 Ga0501031_0322415_58_627 189
277 3300049572 Ga0501036_0339723 Ga0501036_0339723_265_834 189
278 3300049572 Ga0501036_0766861 Ga0501036_0766861_141_710 189
279 3300049573 Ga0501037_0210093 Ga0501037_0210093_632_1201 189
280 3300049573 Ga0501037_0271988 Ga0501037_0271988_71_640 189
281 3300049575 Ga0501039_0104393 Ga0501039_0104393_827_1396 189
282 3300049575 Ga0501039_0220728 Ga0501039_0220728_521_1165 189
283 3300049575 Ga0501039_0337805 Ga0501039_0337805_148_771 189
284 3300049576 Ga0501040_0100897 Ga0501040_0100897_865_1434 189
285 3300049576 Ga0501040_0415005 Ga0501040_0415005_45_668 189
286 3300049577 Ga0501041_0125757 Ga0501041_0125757_376_945 189
287 3300049578 Ga0501042_0090805 Ga0501042_0090805_1016_1585 189
288 3300049582 Ga0501048_0117941 Ga0501048_0117941_245_814 189
289 3300049584 Ga0501068_0336096 Ga0501068_0336096_283_939 189
290 3300049587 Ga0501071_0022904 Ga0501071_0022904_1646_2344 189
291 3300049587 Ga0501071_0174327 Ga0501071_0174327_423_992 189
292 3300049588 Ga0501072_0040876 Ga0501072_0040876_1929_2498 189
293 3300049588 Ga0501072_0104286 Ga0501072_0104286_524_1168 189
294 3300049591 Ga0501075_0053335 Ga0501075_0053335_20_664 189
295 3300049591 Ga0501075_0148167 Ga0501075_0148167_805_1374 189
296 3300049591 Ga0501075_0351977 Ga0501075_0351977_258_881 189
297 3300049591 Ga0501075_0545190 Ga0501075_0545190_167_736 189
298 3300049592 Ga0501076_0017608 Ga0501076_0017608_4087_4656 189
299 3300049592 Ga0501076_0089169 Ga0501076_0089169_1800_2423 189
300 3300049741 Ga0501079_0034199 Ga0501079_0034199_3211_3816 189
301 3300049743 Ga0501081_0119085 Ga0501081_0119085_117_815 189
302 3300049743 Ga0501081_0134788 Ga0501081_0134788_190_795 189
303 3300049743 Ga0501081_0738998 Ga0501081_0738998_97_666 189
304 3300049824 Ga0501045_0096921 Ga0501045_0096921_1295_1864 189
305 3300049824 Ga0501045_0148129 Ga0501045_0148129_1048_1617 189
306 3300050489 nmdc:mga03683_2022_c1 nmdc:mga03683_2022_c1_5004_5660 189
307 3300050490 nmdc:mga03n38_61367_c1 nmdc:mga03n38_61367_c1_116_772 189
308 3300050491 nmdc:mga00v17_3704_c1 nmdc:mga00v17_3704_c1_3159_3815 189
309 3300050492 nmdc:mga0yw44_100893_c1 nmdc:mga0yw44_100893_c1_926_1495 189
310 3300050492 nmdc:mga0yw44_29497_c1 nmdc:mga0yw44_29497_c1_54_710 189
311 3300050493 nmdc:mga0k408_15680_c1 nmdc:mga0k408_15680_c1_1331_1987 189
312 3300050507 nmdc:mga05p37_41303_c1 nmdc:mga05p37_41303_c1_4450_5076 189
313 3300050507 nmdc:mga05p37_523647_c1 nmdc:mga05p37_523647_c1_451_1029 189
314 3300050507 nmdc:mga05p37_85381_c1 nmdc:mga05p37_85381_c1_3231_3809 189
315 3300050508 nmdc:mga09592_168408_c1 nmdc:mga09592_168408_c1_152_778 189
316 3300050510 nmdc:mga06r32_2915_c1 nmdc:mga06r32_2915_c1_5394_6020 189
317 3300050510 nmdc:mga06r32_337791_c1 nmdc:mga06r32_337791_c1_425_1003 189
318 3300050510 nmdc:mga06r32_371853_c1 nmdc:mga06r32_371853_c1_208_873 189
319 3300050511 nmdc:mga08y16_41129_c1 nmdc:mga08y16_41129_c1_1968_2588 189
320 3300050512 nmdc:mga0n895_471683_c1 nmdc:mga0n895_471683_c1_220_789 189
321 3300050515 nmdc:mga0a205_268414_c1 nmdc:mga0a205_268414_c1_618_1187 189
322 3300054114 Ga0501084_0109261 Ga0501084_0109261_1278_1883 189
323 3300054114 Ga0501084_0765432 Ga0501084_0765432_119_688 189
324 3300060353 Ga0501082_0136864 Ga0501082_0136864_1501_2070 189
325 3300061734 Ga0530510_0026280 Ga0530510_0026280_282_905 189
326 3300061734 Ga0530510_0866371 Ga0530510_0866371_90_659 189
327 3300005331 Ga0070670_100083050 Ga0070670_1000830502 190
328 3300005456 Ga0070678_100159498 Ga0070678_1001594982 190
329 3300006028 Ga0070717_10095148 Ga0070717_100951483 190
330 3300013296 Ga0157374_11253766 Ga0157374_112537661 190
331 3300014325 Ga0163163_10037370 Ga0163163_100373702 190
332 3300025898 Ga0207692_10045772 Ga0207692_100457722 190
333 3300005337 Ga0070682_101002488 Ga0070682_1010024881 192
334 3300006028 Ga0070717_10062120 Ga0070717_100621204 192
335 3300006028 Ga0070717_10088042 Ga0070717_100880423 192
336 3300025916 Ga0207663_10118164 Ga0207663_101181642 192
337 3300025916 Ga0207663_10145762 Ga0207663_101457621 192
338 3300025928 Ga0207700_10159936 Ga0207700_101599362 192
339 3300035116 Ga0373945_0147525 Ga0373945_0147525_144_725 192
340 3300035117 Ga0373953_0008466 Ga0373953_0008466_2830_3411 192
341 3300035724 Ga0373933_0049822 Ga0373933_0049822_244_825 192
342 3300036401 Ga0373937_0020339 Ga0373937_0020339_2124_2705 192
343 3300046462 Ga0495651_0009134 Ga0495651_0009134_2969_3550 192
344 3300046463 Ga0495653_0063535 Ga0495653_0063535_84_665 192
345 3300046477 Ga0495664_0041528 Ga0495664_0041528_174_755 192
346 3300046514 Ga0495618_0400176 Ga0495618_0400176_144_725 192
347 3300046516 Ga0495628_0066929 Ga0495628_0066929_2150_2731 192
348 3300046533 Ga0495640_0077936 Ga0495640_0077936_1426_2007 192
349 3300046536 Ga0495587_0016406 Ga0495587_0016406_3869_4450 192
350 3300046559 Ga0495667_0013200 Ga0495667_0013200_891_1472 192
351 3300046642 Ga0495634_0063493 Ga0495634_0063493_93_674 192
352 3300046689 Ga0495613_0047312 Ga0495613_0047312_843_1424 192
353 3300047317 Ga0495604_0041400 Ga0495604_0041400_218_799 192
354 3300047322 Ga0495680_0005962 Ga0495680_0005962_6760_7341 192
355 3300048088 Ga0495602_0010966 Ga0495602_0010966_2070_2651 192
356 3300048905 Ga0496102_0932252 Ga0496102_0932252_188_769 192
357 3300048907 Ga0496104_0005193 Ga0496104_0005193_2954_3535 192
358 3300048907 Ga0496104_0006133 Ga0496104_0006133_6808_7389 192
359 3300048908 Ga0496105_0536129 Ga0496105_0536129_107_688 192
360 3300048912 Ga0496109_1217746 Ga0496109_1217746_59_640 192
361 3300048916 Ga0496113_0103818 Ga0496113_0103818_781_1362 192
362 3300048916 Ga0496113_0124412 Ga0496113_0124412_642_1223 192
363 3300048917 Ga0496114_0795223 Ga0496114_0795223_87_668 192
364 3300048918 Ga0496115_0449185 Ga0496115_0449185_147_728 192
365 3300053077 Ga0495601_0033784 Ga0495601_0033784_916_1497 192
366 3300053078 Ga0495612_0101957 Ga0495612_0101957_249_830 192
367 3300053084 Ga0495595_0019923 Ga0495595_0019923_1605_2186 192
368 3300053085 Ga0495619_0008193 Ga0495619_0008193_5740_6321 192
369 3300003911 JGI25405J52794_10023573 JGI25405J52794_100235731 194
370 3300005330 Ga0070690_100313414 Ga0070690_1003134141 194
371 3300005937 Ga0081455_10012178 Ga0081455_100121784 194
372 3300006846 Ga0075430_100006387 Ga0075430_1000063874 194
373 3300006847 Ga0075431_100023869 Ga0075431_1000238695 194
374 3300006880 Ga0075429_100014439 Ga0075429_1000144395 194
375 3300009094 Ga0111539_10003176 Ga0111539_1000317612 194
376 3300009551 Ga0105238_10192689 Ga0105238_101926892 194
377 3300025910 Ga0207684_10007312 Ga0207684_100073126 194
378 3300027907 Ga0207428_10023890 Ga0207428_100238904 194
379 3300050508 nmdc:mga09592_65780_c1 nmdc:mga09592_65780_c1_586_1194 194
380 3300050509 nmdc:mga0qj67_5888_c1 nmdc:mga0qj67_5888_c1_2269_2877 194
381 3300050510 nmdc:mga06r32_106829_c1 nmdc:mga06r32_106829_c1_565_1173 194
382 3300050511 nmdc:mga08y16_2547_c1 nmdc:mga08y16_2547_c1_9853_10485 194

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00300

His_Phos_1

Histidine phosphatase superfamily (branch 1)

29

212

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
2a6p-assembly1.cif.gz_B structure solution to 2.2 angstrom and functional characterisation of the open reading frame rv3214 from mycobacterium tuberculosis 0.9476 5 193
2a6p-assembly1.cif.gz_B structure solution to 2.2 angstrom and functional characterisation of the open reading frame rv3214 from mycobacterium tuberculosis 0.9238 5 193
4ij6-assembly1.cif.gz_B crystal structure of a novel-type phosphoserine phosphatase mutant (h9a) from <i>hydrogenobacter thermophilus</i> tk-6 in complex with l-phosphoserine 0.9118 5 193
4ij5-assembly1.cif.gz_B crystal structure of a novel-type phosphoserine phosphatase from <i>hydrogenobacter thermophilus</i> tk-6 0.8999 5 191
6s2q-assembly2.cif.gz_C mycobacterial hydrolase 1 0.8955 6 191
ID Description Score Start End Superfamily
af_Q6MWZ7_1_203_3.40.50.1240 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.9503 1 194 3.40.50.1240
af_Q6MWZ7_1_203_3.40.50.1240 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.9456 1 194 3.40.50.1240
4ij6B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.9118 5 193 3.40.50.1240
af_A0A1D8PHW0_6_236_3.40.50.1240 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.9005 5 185 3.40.50.1240
af_Q4DL01_2_181_3.40.50.1240 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.8933 8 163 3.40.50.1240
ID Description Score Start End GO Terms
AF-A0A554TVW1-F1-model_v4 deleted 1.001 8 146
AF-A0A1R3VA08-F1-model_v4 Phosphoglycerate mutase 0.9969 6 191 GO:0070297
GO:0101006
AF-A0A368YCH2-F1-model_v4 Broad specificity phosphatase PhoE 0.9961 7 194 GO:0070297
GO:0101006
AF-A0A524JAI9-F1-model_v4 Histidine phosphatase family protein 0.9934 12 116 GO:0070297
GO:0101006
AF-A0A357ZYI8-F1-model_v4 Histidine phosphatase family protein 0.9928 14 155 GO:0070297
GO:0101006

Feature Viewer

pLDDT pTM Quality
94.56 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map