F429209

General Info

Members Datasets Scaffolds Average Seq Length
382 215 764 310

Family's Representative Sequence

Representative Sequence 3300005530|Ga0070679_100022102|Ga0070679_1000221022
Length 329
Sequence MTQTSISATTESRAGTVPAVRIAGVTKDFGDVHAVRGIDLALEQGEVVAFLGPNGAGKTTTIDMVLGLSHPTTGSVEVLGLEPRQAIARGLVSAVMQTGGLLKDLSVRETVAYTASLFADTAGVDEVLRTAGIEGIADRKVGKCSGGEQQRLRFAMALLSDPALLLLDEPTTGMDVEGRRAFWSAIRADAQQGRTVLFATHYLEEADQYADRIVLISHGRIVADGTGSQIKALAAGRTVRATLPNADASALSSLPGVESVDVRGDSVFVHAKDTDAVARHLLTRTDAHDLEITARGLEDAFLSLTGDDHDVTPDPTSTDSTTDRQGASA

Samples

Sample ID Description Type Environment
1 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
2 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
18 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
23 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
32 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
33 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
34 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
38 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
39 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
40 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
41 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
42 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
43 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
44 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
45 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
46 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
47 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
50 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
52 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
53 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
54 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
57 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
58 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
59 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
60 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
61 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
62 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
63 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
64 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
65 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
66 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
67 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
68 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
69 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
70 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
71 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
72 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
107 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
108 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
111 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
112 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
113 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
114 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
115 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
116 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
117 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
118 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
119 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
120 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
121 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
122 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
123 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
124 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
125 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
126 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
127 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
128 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
129 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
130 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
131 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
132 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
133 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
134 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
135 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
136 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
137 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
138 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
139 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
140 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
141 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
142 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
143 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
144 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
145 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
146 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
147 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
148 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
149 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
150 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
151 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
152 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
153 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
154 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
155 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
156 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
169 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
170 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
171 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
172 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
173 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
174 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
175 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
176 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
177 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
178 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
179 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
180 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
183 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
184 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
185 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
186 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
187 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
188 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
189 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
190 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
191 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
192 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
193 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
194 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
195 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
196 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
197 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
198 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
199 2643221567 Phycicoccus sp. Root563 Isolate Unclassified
200 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
201 2643221615 Nocardioides sp. Root224 Isolate Unclassified
202 2643221617 Nocardioides sp. Root79 Isolate Unclassified
203 2643221620 Nocardioides sp. Root240 Isolate Unclassified
204 2643221624 Phycicoccus sp. Root101 Isolate Unclassified
205 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
206 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
207 2643221690 Cellulomonas sp. Root485 Isolate Unclassified
208 2654587600 Glutamicibacter halophytocola KLBMP5180 Isolate Unclassified
209 2728369276 Kineococcus rhizosphaerae DSM 19711 Isolate Rhizosphere
210 2738541305 Nocardioides sp. CF167 Isolate Unclassified
211 2739367654 Promicromonospora sp. YR516 Isolate Unclassified
212 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
213 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
214 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
215 2884994152 Cellulomonas sp. H30R-01 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.5
Metatranscriptomes 1.05
Isolates 4.45

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.19
Nodule 0
Rhizoplane 12.3
Rhizosphere 76.44
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070679_100022102 3300005530 Bacteria 6214
2 Ga0006562J51391_1193911 3300003578 Bacteria 1713
3 Ga0006562J51391_1193912 3300003578 Bacteria 1530
4 Ga0070658_10062644 3300005327 Bacteria 3031
5 Ga0070683_100005386 3300005329 Bacteria 10674
6 Ga0070683_100162060 3300005329 Bacteria 2122
7 Ga0070683_100188986 3300005329 Bacteria 1955
8 Ga0070683_100261922 3300005329 Bacteria 1645
9 Ga0070690_100173317 3300005330 Bacteria 1486
10 Ga0070682_100004637 3300005337 Bacteria 7632
11 Ga0070682_100244159 3300005337 Bacteria 1291
12 Ga0068868_100023782 3300005338 Bacteria 4640
13 Ga0068868_100072967 3300005338 Bacteria 2739
14 Ga0070687_100032401 3300005343 Bacteria 2571
15 Ga0070668_100360394 3300005347 Bacteria 1233
16 Ga0070671_100098716 3300005355 Bacteria 2449
17 Ga0070674_100012327 3300005356 Bacteria 5247
18 Ga0070659_100167739 3300005366 Bacteria 1797
19 Ga0070667_100032195 3300005367 Bacteria 4373
20 Ga0070667_100159507 3300005367 Bacteria 1986
21 Ga0070714_100094201 3300005435 Bacteria 2628
22 Ga0070700_100001727 3300005441 Bacteria 10973
23 Ga0070678_100043683 3300005456 Bacteria 3195
24 Ga0068867_100008705 3300005459 Bacteria 7165
25 Ga0068867_100524962 3300005459 Bacteria 1021
26 Ga0070685_10316751 3300005466 Bacteria 1056
27 Ga0070707_100132977 3300005468 Bacteria 2419
28 Ga0070684_100008937 3300005535 Bacteria 7865
29 Ga0070684_100355589 3300005535 Bacteria 1348
30 Ga0068853_100412225 3300005539 Bacteria 1266
31 Ga0070672_100343156 3300005543 Bacteria 1272
32 Ga0070693_100017415 3300005547 Bacteria 3735
33 Ga0070665_100000151 3300005548 Bacteria 127579
34 Ga0068857_100035580 3300005577 Bacteria 4410
35 Ga0068857_100096327 3300005577 Bacteria 2652
36 Ga0068854_100133184 3300005578 Bacteria 1900
37 Ga0068854_100137031 3300005578 Bacteria 1875
38 Ga0068856_100097641 3300005614 Bacteria 2927
39 Ga0068856_100453064 3300005614 Bacteria 1304
40 Ga0070702_100144532 3300005615 Bacteria 1519
41 Ga0068852_100012902 3300005616 Bacteria 6370
42 Ga0068852_100534925 3300005616 Bacteria 1171
43 Ga0068859_100449351 3300005617 Bacteria 1385
44 Ga0068864_100282051 3300005618 Bacteria 1551
45 Ga0068866_10104173 3300005718 Bacteria 1571
46 Ga0068861_100076207 3300005719 Bacteria 2613
47 Ga0068861_100130733 3300005719 Bacteria 2037
48 Ga0068870_10064592 3300005840 Bacteria 1977
49 Ga0068858_100045179 3300005842 Bacteria 4081
50 Ga0068858_100236377 3300005842 Bacteria 1733
51 Ga0068860_100000555 3300005843 Bacteria 45431
52 Ga0068860_100166864 3300005843 Bacteria 2126
53 Ga0081455_10005523 3300005937 Bacteria 13848
54 Ga0075365_10008958 3300006038 Bacteria 5720
55 Ga0075365_10023879 3300006038 Bacteria 3850
56 Ga0075365_10028963 3300006038 Bacteria 3534
57 Ga0075365_10035067 3300006038 Bacteria 3244
58 Ga0075368_10006071 3300006042 Bacteria 4198
59 Ga0075363_100007896 3300006048 Bacteria 4927
60 Ga0075367_10023969 3300006178 Bacteria 3439
61 Ga0075370_10010801 3300006353 Bacteria 4787
62 Ga0075428_100000727 3300006844 Bacteria 34188
63 Ga0075431_100003683 3300006847 Bacteria 14886
64 Ga0075429_100000574 3300006880 Bacteria 28250
65 Ga0075429_100004724 3300006880 Bacteria 11725
66 Ga0068865_100011390 3300006881 Bacteria 5563
67 Ga0068865_100041811 3300006881 Bacteria 3122
68 Ga0097620_100449360 3300006931 Bacteria 1385
69 Ga0111539_10093374 3300009094 Bacteria 3534
70 Ga0111539_10396641 3300009094 Bacteria 1607
71 Ga0111539_10705654 3300009094 Bacteria 1174
72 Ga0105245_10001836 3300009098 Bacteria 19327
73 Ga0105245_10061498 3300009098 Bacteria 3386
74 Ga0105245_10346596 3300009098 Bacteria 1470
75 Ga0114129_10010030 3300009147 Bacteria 13504
76 Ga0114129_10154796 3300009147 Bacteria 3135
77 Ga0105243_10027132 3300009148 Bacteria 4386
78 Ga0105243_10079067 3300009148 Bacteria 2679
79 Ga0105243_10285239 3300009148 Bacteria 1489
80 Ga0105243_10322083 3300009148 Bacteria 1409
81 Ga0105242_10020790 3300009176 Bacteria 5148
82 Ga0105248_10033312 3300009177 Bacteria 5755
83 Ga0105248_10042881 3300009177 Bacteria 5073
84 Ga0105248_10505957 3300009177 Bacteria 1362
85 Ga0105237_10335769 3300009545 Bacteria 1515
86 Ga0105238_10168268 3300009551 Bacteria 2168
87 Ga0105249_10045943 3300009553 Bacteria 3974
88 Ga0105239_10012813 3300010375 Bacteria 9329
89 Ga0105239_10030099 3300010375 Bacteria 5969
90 Ga0105239_10428912 3300010375 Bacteria 1498
91 Ga0105246_10001486 3300011119 Bacteria 13926
92 Ga0157370_10220512 3300013104 Bacteria 1756
93 Ga0163162_10058313 3300013306 Bacteria 3889
94 Ga0163162_10183241 3300013306 Bacteria 2220
95 Ga0157372_10022910 3300013307 Bacteria 6763
96 Ga0157372_10106443 3300013307 Bacteria 3208
97 Ga0157372_10251294 3300013307 Bacteria 2052
98 Ga0157372_10454086 3300013307 Bacteria 1493
99 Ga0157375_10019303 3300013308 Bacteria 6199
100 Ga0157375_10035342 3300013308 Bacteria 4769
101 Ga0157375_10143697 3300013308 Bacteria 2515
102 Ga0163163_10011806 3300014325 Bacteria 7941
103 Ga0157380_10009167 3300014326 Bacteria 7081
104 Ga0157377_10031271 3300014745 Bacteria 2891
105 Ga0157379_10272332 3300014968 Bacteria 1540
106 Ga0157376_10362705 3300014969 Bacteria 1390
107 Ga0182007_10068426 3300015262 Bacteria 1163
108 Ga0163161_10046906 3300017792 Bacteria 3119
109 Ga0163161_10099717 3300017792 Bacteria 2160
110 Ga0163161_10196612 3300017792 Bacteria 1552
111 Ga0154015_1336322 3300020610 Bacteria 2256
112 Ga0213876_10014184 3300021384 Bacteria 4226
113 Ga0207642_10024825 3300025899 Bacteria 2416
114 Ga0207642_10058020 3300025899 Bacteria 1784
115 Ga0207688_10012720 3300025901 Bacteria 4578
116 Ga0207688_10161849 3300025901 Bacteria 1327
117 Ga0207647_10017999 3300025904 Bacteria 4790
118 Ga0207647_10031317 3300025904 Bacteria 3423
119 Ga0207647_10115562 3300025904 Bacteria 1584
120 Ga0207643_10009000 3300025908 Bacteria 5361
121 Ga0207671_10082457 3300025914 Bacteria 2413
122 Ga0207657_10009901 3300025919 Bacteria 9542
123 Ga0207657_10032804 3300025919 Bacteria 4687
124 Ga0207649_10258467 3300025920 Bacteria 1257
125 Ga0207652_10053580 3300025921 Bacteria 3465
126 Ga0207646_10137702 3300025922 Bacteria 2198
127 Ga0207659_10472022 3300025926 Bacteria 1059
128 Ga0207687_10013854 3300025927 Bacteria 5267
129 Ga0207687_10143067 3300025927 Bacteria 1816
130 Ga0207687_10160518 3300025927 Bacteria 1725
131 Ga0207644_10083401 3300025931 Bacteria 2367
132 Ga0207690_10007279 3300025932 Bacteria 6573
133 Ga0207690_10272631 3300025932 Bacteria 1315
134 Ga0207686_10033316 3300025934 Bacteria 3074
135 Ga0207709_10009370 3300025935 Bacteria 5387
136 Ga0207709_10233348 3300025935 Bacteria 1334
137 Ga0207669_10009817 3300025937 Bacteria 4578
138 Ga0207669_10272399 3300025937 Bacteria 1272
139 Ga0207704_10051825 3300025938 Bacteria 2484
140 Ga0207704_10146018 3300025938 Bacteria 1662
141 Ga0207691_10001309 3300025940 Bacteria 24825
142 Ga0207691_10056485 3300025940 Bacteria 3575
143 Ga0207711_10110811 3300025941 Bacteria 2441
144 Ga0207661_10065578 3300025944 Bacteria 2948
145 Ga0207661_10133459 3300025944 Bacteria 2130
146 Ga0207679_10435616 3300025945 Bacteria 1160
147 Ga0207712_10096846 3300025961 Bacteria 2185
148 Ga0207712_10196444 3300025961 Bacteria 1596
149 Ga0207712_10273912 3300025961 Bacteria 1374
150 Ga0207640_10265892 3300025981 Bacteria 1339
151 Ga0207658_10031404 3300025986 Bacteria 3771
152 Ga0207677_10052468 3300026023 Bacteria 2770
153 Ga0207639_10202187 3300026041 Bacteria 1705
154 Ga0207708_10011997 3300026075 Bacteria 6457
155 Ga0207702_10406998 3300026078 Bacteria 1313
156 Ga0207648_10001262 3300026089 Bacteria 28251
157 Ga0207648_10012325 3300026089 Bacteria 8004
158 Ga0207648_10243129 3300026089 Bacteria 1603
159 Ga0207676_10155062 3300026095 Bacteria 1977
160 Ga0207676_10519968 3300026095 Bacteria 1133
161 Ga0207674_10005555 3300026116 Bacteria 14959
162 Ga0207674_10186147 3300026116 Bacteria 2027
163 Ga0207675_100002583 3300026118 Bacteria 17935
164 Ga0207675_100139591 3300026118 Bacteria 2301
165 Ga0207683_10029999 3300026121 Bacteria 4711
166 Ga0207683_10137307 3300026121 Bacteria 2201
167 Ga0207698_10312371 3300026142 Bacteria 1468
168 Ga0207698_10471469 3300026142 Bacteria 1216
169 Ga0209813_10000989 3300027866 Bacteria 6375
170 Ga0207428_10016662 3300027907 Bacteria 6320
171 Ga0268266_10005038 3300028379 Bacteria 12470
172 Ga0268264_10000264 3300028381 Bacteria 93499
173 Ga0268264_10307776 3300028381 Bacteria 1494
174 Ga0307511_10001458 3300030521 Bacteria 24986
175 Ga0307410_10117170 3300031852 Bacteria 1936
176 Ga0307416_100498660 3300032002 Bacteria 1281
177 Ga0307411_10182557 3300032005 Bacteria 1594
178 Ga0316214_1002009 3300033545 Bacteria 2467
179 Ga0316212_1004549 3300033547 Bacteria 2016
180 Ga0372808_005993 3300036459 Bacteria 1624
181 Ga0395899_0131333 3300037312 Bacteria 1788
182 Ga0395900_0016786 3300037418 Bacteria 7468
183 Ga0395900_0027655 3300037418 Bacteria 5810
184 Ga0395900_0051367 3300037418 Bacteria 4247
185 Ga0395900_0313833 3300037418 Bacteria 1550
186 Ga0395900_0384377 3300037418 Bacteria 1371
187 Ga0395898_0021584 3300037466 Bacteria 6526
188 Ga0395901_0024635 3300038443 Bacteria 6179
189 Ga0395901_0460594 3300038443 Bacteria 1299
190 Ga0436365_0826480 3300039437 Bacteria 11473
191 Ga0451843_0283890 3300041509 Bacteria 1167
192 Ga0466972_0017112 3300044658 Bacteria 3626
193 Ga0466965_0020453 3300044683 Bacteria 3182
194 Ga0466965_0119119 3300044683 Bacteria 1362
195 Ga0466965_0134481 3300044683 Bacteria 1284
196 Ga0466966_0036980 3300044684 Bacteria 3150
197 Ga0466966_0037332 3300044684 Bacteria 3133
198 Ga0466961_0035501 3300044693 Bacteria 3202
199 Ga0466961_0056090 3300044693 Bacteria 2510
200 Ga0466961_0167986 3300044693 Bacteria 1365
201 Ga0466963_0006187 3300044694 Bacteria 7067
202 Ga0466963_0138006 3300044694 Bacteria 1688
203 Ga0466964_0015425 3300044706 Bacteria 2908
204 Ga0466971_0053215 3300044719 Bacteria 1824
205 Ga0466970_0004171 3300044765 Bacteria 7108
206 Ga0466970_0007000 3300044765 Bacteria 5645
207 Ga0466970_0023878 3300044765 Bacteria 3196
208 Ga0466970_0033935 3300044765 Bacteria 2699
209 Ga0466970_0048272 3300044765 Bacteria 2270
210 Ga0466970_0055687 3300044765 Bacteria 2112
211 Ga0466970_0057861 3300044765 Bacteria 2074
212 Ga0466970_0166420 3300044765 Bacteria 1221
213 Ga0466957_0031404 3300044842 Bacteria 3174
214 Ga0466957_0078661 3300044842 Bacteria 2051
215 Ga0466957_0082630 3300044842 Bacteria 2002
216 Ga0466960_0000310 3300044901 Bacteria 16844
217 Ga0466960_0008676 3300044901 Bacteria 4170
218 Ga0466960_0020321 3300044901 Bacteria 2940
219 Ga0466960_0044815 3300044901 Bacteria 2110
220 Ga0466960_0064770 3300044901 Bacteria 1803
221 Ga0466960_0076761 3300044901 Bacteria 1674
222 Ga0466960_0192899 3300044901 Bacteria 1109
223 Ga0466959_0081892 3300045049 Bacteria 2326
224 Ga0466959_0119070 3300045049 Bacteria 1878
225 Ga0466959_0236458 3300045049 Bacteria 1263
226 Ga0466958_0020495 3300045836 Bacteria 3856
227 Ga0466958_0145790 3300045836 Bacteria 1492
228 Ga0466967_0002896 3300045976 Bacteria 10926
229 Ga0466967_0038411 3300045976 Bacteria 4106
230 Ga0466967_0068189 3300045976 Bacteria 3175
231 Ga0466967_0092788 3300045976 Bacteria 2746
232 Ga0466967_0177009 3300045976 Bacteria 2010
233 Ga0466967_0274756 3300045976 Bacteria 1615
234 Ga0466967_0342058 3300045976 Bacteria 1447
235 Ga0466967_0545947 3300045976 Bacteria 1140
236 Ga0495628_0378936 3300046516 Bacteria 1036
237 Ga0495669_0064206 3300046684 Bacteria 1666
238 Ga0495581_0089803 3300047315 Bacteria 1782
239 Ga0495602_0408338 3300048088 Bacteria 967
240 Ga0496100_0014619 3300048903 Bacteria 4561
241 Ga0496101_0030853 3300048904 Bacteria 3763
242 Ga0496101_0160947 3300048904 Bacteria 1721
243 Ga0496101_0284455 3300048904 Bacteria 1293
244 Ga0496101_0319752 3300048904 Bacteria 1217
245 Ga0496102_0080196 3300048905 Bacteria 3006
246 Ga0496102_0143121 3300048905 Bacteria 2243
247 Ga0496102_0280494 3300048905 Bacteria 1571
248 Ga0496102_0460638 3300048905 Bacteria 1192
249 Ga0496103_0004301 3300048906 Bacteria 8655
250 Ga0496103_0032021 3300048906 Bacteria 3207
251 Ga0496103_0167701 3300048906 Bacteria 1409
252 Ga0496105_0013553 3300048908 Bacteria 6476
253 Ga0496105_0103036 3300048908 Bacteria 2357
254 Ga0496105_0213398 3300048908 Bacteria 1572
255 Ga0496106_0021715 3300048909 Bacteria 4767
256 Ga0496107_0023405 3300048910 Bacteria 4368
257 Ga0496107_0024022 3300048910 Bacteria 4309
258 Ga0496107_0042401 3300048910 Bacteria 3268
259 Ga0496107_0161593 3300048910 Bacteria 1660
260 Ga0496108_0069535 3300048911 Bacteria 2971
261 Ga0496108_0109773 3300048911 Bacteria 2358
262 Ga0496108_0145320 3300048911 Bacteria 2044
263 Ga0496109_0008356 3300048912 Bacteria 8794
264 Ga0496109_0014705 3300048912 Bacteria 6811
265 Ga0496109_0073949 3300048912 Bacteria 3132
266 Ga0496109_0485092 3300048912 Bacteria 1167
267 Ga0496109_0664046 3300048912 Bacteria 979
268 Ga0496110_0002623 3300048913 Bacteria 13535
269 Ga0496110_0049593 3300048913 Bacteria 3683
270 Ga0496110_0076224 3300048913 Bacteria 2981
271 Ga0496110_0079066 3300048913 Bacteria 2928
272 Ga0496110_0301080 3300048913 Bacteria 1460
273 Ga0496111_0005728 3300048914 Bacteria 8011
274 Ga0496113_0275364 3300048916 Bacteria 1345
275 Ga0496114_0007668 3300048917 Bacteria 8534
276 Ga0496114_0030162 3300048917 Bacteria 4460
277 Ga0496114_0030593 3300048917 Bacteria 4430
278 Ga0496114_0059439 3300048917 Bacteria 3193
279 Ga0496114_0060173 3300048917 Bacteria 3174
280 Ga0496114_0177110 3300048917 Bacteria 1861
281 Ga0496114_0243584 3300048917 Bacteria 1581
282 Ga0496114_0307363 3300048917 Bacteria 1400
283 Ga0496114_0326298 3300048917 Bacteria 1357
284 Ga0496115_0012442 3300048918 Bacteria 6405
285 Ga0496115_0024777 3300048918 Bacteria 4666
286 Ga0496115_0384848 3300048918 Bacteria 1140
287 Ga0496124_0048663 3300048927 Bacteria 3621
288 Ga0496124_0120398 3300048927 Bacteria 2098
289 Ga0496125_0002329 3300048928 Bacteria 25018
290 Ga0501032_0001921 3300049569 Bacteria 16380
291 Ga0501032_0018734 3300049569 Bacteria 4845
292 Ga0501033_0000615 3300049570 Bacteria 32993
293 Ga0501033_0164090 3300049570 Bacteria 1598
294 Ga0501034_0002149 3300049571 Bacteria 24475
295 Ga0501034_0003964 3300049571 Bacteria 16636
296 Ga0501034_0054614 3300049571 Bacteria 4021
297 Ga0501034_0155598 3300049571 Bacteria 2260
298 Ga0501036_0013395 3300049572 Bacteria 6815
299 Ga0501036_0066846 3300049572 Bacteria 3042
300 Ga0501037_0009499 3300049573 Bacteria 7137
301 Ga0501037_0011427 3300049573 Bacteria 6534
302 Ga0501037_0058494 3300049573 Bacteria 2813
303 Ga0501038_0024202 3300049574 Bacteria 5418
304 Ga0501038_0053115 3300049574 Bacteria 3490
305 Ga0501039_0138316 3300049575 Bacteria 1913
306 Ga0501039_0162164 3300049575 Bacteria 1757
307 Ga0501042_0235022 3300049578 Bacteria 1322
308 Ga0501043_0082263 3300049579 Bacteria 2530
309 Ga0501043_0151854 3300049579 Bacteria 1812
310 Ga0501046_0000193 3300049580 Bacteria 62517
311 Ga0501046_0029865 3300049580 Bacteria 4429
312 Ga0501046_0043568 3300049580 Bacteria 3572
313 Ga0501047_0003864 3300049581 Bacteria 14097
314 Ga0501047_0100661 3300049581 Bacteria 2769
315 Ga0501048_0013388 3300049582 Bacteria 6088
316 Ga0501048_0033333 3300049582 Bacteria 3721
317 Ga0501048_0049070 3300049582 Bacteria 3009
318 Ga0501067_0005429 3300049583 Bacteria 7077
319 Ga0501067_0021519 3300049583 Bacteria 3569
320 Ga0501067_0048517 3300049583 Bacteria 2354
321 Ga0501068_0001425 3300049584 Bacteria 12697
322 Ga0501068_0034629 3300049584 Bacteria 3012
323 Ga0501069_0021076 3300049585 Bacteria 3535
324 Ga0501070_0001846 3300049586 Bacteria 18695
325 Ga0501070_0018420 3300049586 Bacteria 5859
326 Ga0501070_0073197 3300049586 Bacteria 2835
327 Ga0501071_0033630 3300049587 Bacteria 3642
328 Ga0501071_0136903 3300049587 Bacteria 1823
329 Ga0501072_0108134 3300049588 Bacteria 2212
330 Ga0501073_0023627 3300049589 Bacteria 4411
331 Ga0501073_0075699 3300049589 Bacteria 2343
332 Ga0501074_0199209 3300049590 Bacteria 1427
333 Ga0501076_0084829 3300049592 Bacteria 2545
334 Ga0501077_0008169 3300049593 Bacteria 6469
335 Ga0501080_0003208 3300049742 Bacteria 14423
336 Ga0501080_0128992 3300049742 Bacteria 2341
337 Ga0501080_0192859 3300049742 Bacteria 1872
338 Ga0501083_0010564 3300049744 Bacteria 6499
339 Ga0501035_0003234 3300049822 Bacteria 15607
340 Ga0501035_0024797 3300049822 Bacteria 5499
341 Ga0501035_0035133 3300049822 Bacteria 4549
342 Ga0501044_0001815 3300049823 Bacteria 24871
343 Ga0501044_0063716 3300049823 Bacteria 3765
344 Ga0501044_0092403 3300049823 Bacteria 3051
345 Ga0501045_0189414 3300049824 Bacteria 1533
346 Ga0501045_0298065 3300049824 Bacteria 1200
347 nmdc:mga03n38_8562_c1 3300050490 Bacteria 3679
348 nmdc:mga0yw44_264858_c1 3300050492 Bacteria 1146
349 nmdc:mga04h51_27644_c1 3300050495 Bacteria 1764
350 nmdc:mga07m45_32463_c1 3300050496 Bacteria 2557
351 nmdc:mga05p37_253_c1 3300050507 Bacteria 55097
352 nmdc:mga09592_192811_c1 3300050508 Bacteria 1764
353 nmdc:mga09592_502_c1 3300050508 Bacteria 29539
354 nmdc:mga0qj67_14356_c1 3300050509 Bacteria 5988
355 nmdc:mga06r32_742_c1 3300050510 Bacteria 28590
356 nmdc:mga08y16_3946_c1 3300050511 Bacteria 15445
357 Ga0495619_0177964 3300053085 Bacteria 1471
358 Ga0500556_0000598 3300053104 Bacteria 23494
359 Ga0500593_000164 3300053117 Bacteria 26696
360 Ga0500616_0000060 3300053153 Bacteria 252252
361 Ga0501084_0096176 3300054114 Bacteria 2487
362 Ga0501084_0286444 3300054114 Bacteria 1391
363 Ga0501082_0007643 3300060353 Bacteria 9321
364 Ga0466962_0014388 3300061719 Bacteria 3812
365 Ga0466962_0022377 3300061719 Bacteria 3038
366 2643853298 2643221567 Bacteria 4163945
367 2644013745 2643221601 Bacteria 7493239
368 2644093724 2643221615 Bacteria 5487866
369 2644098649 2643221617 Bacteria 5139111
370 2644116010 2643221620 Bacteria 5134593
371 2644137259 2643221624 Bacteria 4384879
372 2644178626 2643221631 Bacteria 8168043
373 2644323567 2643221657 Bacteria 5490246
374 2644503431 2643221690 Bacteria 4654705
375 2655033922 2654587600 Bacteria 3911798
376 2729905888 2728369276 Bacteria 5610032
377 2738871486 2738541305 Bacteria 4910150
378 2739606396 2739367654 Bacteria 6049412
379 2809198762 2808606439 Bacteria 5952208
380 2812352668 2811994878 Bacteria 5992952
381 2857482708 2857481737 Bacteria 4761446
382 2884995875 2884994152 Bacteria 4492978
383 Ga0070679_100022102
384 Ga0006562J51391_1193911
385 Ga0006562J51391_1193912
386 Ga0070658_10062644
387 Ga0070683_100005386
388 Ga0070683_100162060
389 Ga0070683_100188986
390 Ga0070683_100261922
391 Ga0070690_100173317
392 Ga0070682_100004637
393 Ga0070682_100244159
394 Ga0068868_100023782
395 Ga0068868_100072967
396 Ga0070687_100032401
397 Ga0070668_100360394
398 Ga0070671_100098716
399 Ga0070674_100012327
400 Ga0070659_100167739
401 Ga0070667_100032195
402 Ga0070667_100159507
403 Ga0070714_100094201
404 Ga0070700_100001727
405 Ga0070678_100043683
406 Ga0068867_100008705
407 Ga0068867_100524962
408 Ga0070685_10316751
409 Ga0070707_100132977
410 Ga0070684_100008937
411 Ga0070684_100355589
412 Ga0068853_100412225
413 Ga0070672_100343156
414 Ga0070693_100017415
415 Ga0070665_100000151
416 Ga0068857_100035580
417 Ga0068857_100096327
418 Ga0068854_100133184
419 Ga0068854_100137031
420 Ga0068856_100097641
421 Ga0068856_100453064
422 Ga0070702_100144532
423 Ga0068852_100012902
424 Ga0068852_100534925
425 Ga0068859_100449351
426 Ga0068864_100282051
427 Ga0068866_10104173
428 Ga0068861_100076207
429 Ga0068861_100130733
430 Ga0068870_10064592
431 Ga0068858_100045179
432 Ga0068858_100236377
433 Ga0068860_100000555
434 Ga0068860_100166864
435 Ga0081455_10005523
436 Ga0075365_10008958
437 Ga0075365_10023879
438 Ga0075365_10028963
439 Ga0075365_10035067
440 Ga0075368_10006071
441 Ga0075363_100007896
442 Ga0075367_10023969
443 Ga0075370_10010801
444 Ga0075428_100000727
445 Ga0075431_100003683
446 Ga0075429_100000574
447 Ga0075429_100004724
448 Ga0068865_100011390
449 Ga0068865_100041811
450 Ga0097620_100449360
451 Ga0111539_10093374
452 Ga0111539_10396641
453 Ga0111539_10705654
454 Ga0105245_10001836
455 Ga0105245_10061498
456 Ga0105245_10346596
457 Ga0114129_10010030
458 Ga0114129_10154796
459 Ga0105243_10027132
460 Ga0105243_10079067
461 Ga0105243_10285239
462 Ga0105243_10322083
463 Ga0105242_10020790
464 Ga0105248_10033312
465 Ga0105248_10042881
466 Ga0105248_10505957
467 Ga0105237_10335769
468 Ga0105238_10168268
469 Ga0105249_10045943
470 Ga0105239_10012813
471 Ga0105239_10030099
472 Ga0105239_10428912
473 Ga0105246_10001486
474 Ga0157370_10220512
475 Ga0163162_10058313
476 Ga0163162_10183241
477 Ga0157372_10022910
478 Ga0157372_10106443
479 Ga0157372_10251294
480 Ga0157372_10454086
481 Ga0157375_10019303
482 Ga0157375_10035342
483 Ga0157375_10143697
484 Ga0163163_10011806
485 Ga0157380_10009167
486 Ga0157377_10031271
487 Ga0157379_10272332
488 Ga0157376_10362705
489 Ga0182007_10068426
490 Ga0163161_10046906
491 Ga0163161_10099717
492 Ga0163161_10196612
493 Ga0154015_1336322
494 Ga0213876_10014184
495 Ga0207642_10024825
496 Ga0207642_10058020
497 Ga0207688_10012720
498 Ga0207688_10161849
499 Ga0207647_10017999
500 Ga0207647_10031317
501 Ga0207647_10115562
502 Ga0207643_10009000
503 Ga0207671_10082457
504 Ga0207657_10009901
505 Ga0207657_10032804
506 Ga0207649_10258467
507 Ga0207652_10053580
508 Ga0207646_10137702
509 Ga0207659_10472022
510 Ga0207687_10013854
511 Ga0207687_10143067
512 Ga0207687_10160518
513 Ga0207644_10083401
514 Ga0207690_10007279
515 Ga0207690_10272631
516 Ga0207686_10033316
517 Ga0207709_10009370
518 Ga0207709_10233348
519 Ga0207669_10009817
520 Ga0207669_10272399
521 Ga0207704_10051825
522 Ga0207704_10146018
523 Ga0207691_10001309
524 Ga0207691_10056485
525 Ga0207711_10110811
526 Ga0207661_10065578
527 Ga0207661_10133459
528 Ga0207679_10435616
529 Ga0207712_10096846
530 Ga0207712_10196444
531 Ga0207712_10273912
532 Ga0207640_10265892
533 Ga0207658_10031404
534 Ga0207677_10052468
535 Ga0207639_10202187
536 Ga0207708_10011997
537 Ga0207702_10406998
538 Ga0207648_10001262
539 Ga0207648_10012325
540 Ga0207648_10243129
541 Ga0207676_10155062
542 Ga0207676_10519968
543 Ga0207674_10005555
544 Ga0207674_10186147
545 Ga0207675_100002583
546 Ga0207675_100139591
547 Ga0207683_10029999
548 Ga0207683_10137307
549 Ga0207698_10312371
550 Ga0207698_10471469
551 Ga0209813_10000989
552 Ga0207428_10016662
553 Ga0268266_10005038
554 Ga0268264_10000264
555 Ga0268264_10307776
556 Ga0307511_10001458
557 Ga0307410_10117170
558 Ga0307416_100498660
559 Ga0307411_10182557
560 Ga0316214_1002009
561 Ga0316212_1004549
562 Ga0372808_005993
563 Ga0395899_0131333
564 Ga0395900_0016786
565 Ga0395900_0027655
566 Ga0395900_0051367
567 Ga0395900_0313833
568 Ga0395900_0384377
569 Ga0395898_0021584
570 Ga0395901_0024635
571 Ga0395901_0460594
572 Ga0436365_0826480
573 Ga0451843_0283890
574 Ga0466972_0017112
575 Ga0466965_0020453
576 Ga0466965_0119119
577 Ga0466965_0134481
578 Ga0466966_0036980
579 Ga0466966_0037332
580 Ga0466961_0035501
581 Ga0466961_0056090
582 Ga0466961_0167986
583 Ga0466963_0006187
584 Ga0466963_0138006
585 Ga0466964_0015425
586 Ga0466971_0053215
587 Ga0466970_0004171
588 Ga0466970_0007000
589 Ga0466970_0023878
590 Ga0466970_0033935
591 Ga0466970_0048272
592 Ga0466970_0055687
593 Ga0466970_0057861
594 Ga0466970_0166420
595 Ga0466957_0031404
596 Ga0466957_0078661
597 Ga0466957_0082630
598 Ga0466960_0000310
599 Ga0466960_0008676
600 Ga0466960_0020321
601 Ga0466960_0044815
602 Ga0466960_0064770
603 Ga0466960_0076761
604 Ga0466960_0192899
605 Ga0466959_0081892
606 Ga0466959_0119070
607 Ga0466959_0236458
608 Ga0466958_0020495
609 Ga0466958_0145790
610 Ga0466967_0002896
611 Ga0466967_0038411
612 Ga0466967_0068189
613 Ga0466967_0092788
614 Ga0466967_0177009
615 Ga0466967_0274756
616 Ga0466967_0342058
617 Ga0466967_0545947
618 Ga0495628_0378936
619 Ga0495669_0064206
620 Ga0495581_0089803
621 Ga0495602_0408338
622 Ga0496100_0014619
623 Ga0496101_0030853
624 Ga0496101_0160947
625 Ga0496101_0284455
626 Ga0496101_0319752
627 Ga0496102_0080196
628 Ga0496102_0143121
629 Ga0496102_0280494
630 Ga0496102_0460638
631 Ga0496103_0004301
632 Ga0496103_0032021
633 Ga0496103_0167701
634 Ga0496105_0013553
635 Ga0496105_0103036
636 Ga0496105_0213398
637 Ga0496106_0021715
638 Ga0496107_0023405
639 Ga0496107_0024022
640 Ga0496107_0042401
641 Ga0496107_0161593
642 Ga0496108_0069535
643 Ga0496108_0109773
644 Ga0496108_0145320
645 Ga0496109_0008356
646 Ga0496109_0014705
647 Ga0496109_0073949
648 Ga0496109_0485092
649 Ga0496109_0664046
650 Ga0496110_0002623
651 Ga0496110_0049593
652 Ga0496110_0076224
653 Ga0496110_0079066
654 Ga0496110_0301080
655 Ga0496111_0005728
656 Ga0496113_0275364
657 Ga0496114_0007668
658 Ga0496114_0030162
659 Ga0496114_0030593
660 Ga0496114_0059439
661 Ga0496114_0060173
662 Ga0496114_0177110
663 Ga0496114_0243584
664 Ga0496114_0307363
665 Ga0496114_0326298
666 Ga0496115_0012442
667 Ga0496115_0024777
668 Ga0496115_0384848
669 Ga0496124_0048663
670 Ga0496124_0120398
671 Ga0496125_0002329
672 Ga0501032_0001921
673 Ga0501032_0018734
674 Ga0501033_0000615
675 Ga0501033_0164090
676 Ga0501034_0002149
677 Ga0501034_0003964
678 Ga0501034_0054614
679 Ga0501034_0155598
680 Ga0501036_0013395
681 Ga0501036_0066846
682 Ga0501037_0009499
683 Ga0501037_0011427
684 Ga0501037_0058494
685 Ga0501038_0024202
686 Ga0501038_0053115
687 Ga0501039_0138316
688 Ga0501039_0162164
689 Ga0501042_0235022
690 Ga0501043_0082263
691 Ga0501043_0151854
692 Ga0501046_0000193
693 Ga0501046_0029865
694 Ga0501046_0043568
695 Ga0501047_0003864
696 Ga0501047_0100661
697 Ga0501048_0013388
698 Ga0501048_0033333
699 Ga0501048_0049070
700 Ga0501067_0005429
701 Ga0501067_0021519
702 Ga0501067_0048517
703 Ga0501068_0001425
704 Ga0501068_0034629
705 Ga0501069_0021076
706 Ga0501070_0001846
707 Ga0501070_0018420
708 Ga0501070_0073197
709 Ga0501071_0033630
710 Ga0501071_0136903
711 Ga0501072_0108134
712 Ga0501073_0023627
713 Ga0501073_0075699
714 Ga0501074_0199209
715 Ga0501076_0084829
716 Ga0501077_0008169
717 Ga0501080_0003208
718 Ga0501080_0128992
719 Ga0501080_0192859
720 Ga0501083_0010564
721 Ga0501035_0003234
722 Ga0501035_0024797
723 Ga0501035_0035133
724 Ga0501044_0001815
725 Ga0501044_0063716
726 Ga0501044_0092403
727 Ga0501045_0189414
728 Ga0501045_0298065
729 nmdc:mga03n38_8562_c1
730 nmdc:mga0yw44_264858_c1
731 nmdc:mga04h51_27644_c1
732 nmdc:mga07m45_32463_c1
733 nmdc:mga05p37_253_c1
734 nmdc:mga09592_192811_c1
735 nmdc:mga09592_502_c1
736 nmdc:mga0qj67_14356_c1
737 nmdc:mga06r32_742_c1
738 nmdc:mga08y16_3946_c1
739 Ga0495619_0177964
740 Ga0500556_0000598
741 Ga0500593_000164
742 Ga0500616_0000060
743 Ga0501084_0096176
744 Ga0501084_0286444
745 Ga0501082_0007643
746 Ga0466962_0014388
747 Ga0466962_0022377
748 2643853298
749 2644013745
750 2644093724
751 2644098649
752 2644116010
753 2644137259
754 2644178626
755 2644323567
756 2644503431
757 2655033922
758 2729905888
759 2738871486
760 2739606396
761 2809198762
762 2812352668
763 2857482708
764 2884995875

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

35

172

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1vpl-assembly1.cif.gz_A-2 crystal structure of abc transporter atp-binding protein (tm0544) from thermotoga maritima at 2.10 a resolution 0.9376 4 216
6z4w-assembly1.cif.gz_A ftse structure from streptococcus pneumoniae in complex with adp (space group p 1) 0.9286 3 212
6z67-assembly2.cif.gz_B ftse structure of streptococcus pneumoniae in complex with amppnp at 2.4 a resolution 0.9187 3 212
8i39-assembly1.cif.gz_B cryo-em structure of abscisic acid transporter atabcg25 with aba 0.9184 5 217
1ji0-assembly1.cif.gz_A crystal structure analysis of the abc transporter from thermotoga maritima 0.9162 1 215
ID Description Score Start End Superfamily
af_P9WQL9_1_244_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9447 2 216 3.40.50.300
af_O33189_10_251_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9418 3 216 3.40.50.300
af_A4HRM7_2286_2560_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9408 3 216 3.40.50.300
af_A4I2P8_1496_1744_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9397 2 216 3.40.50.300
af_O53149_2_239_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9376 3 215 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A1I2M2I1-F1-model_v4 ABC-2 type transport system ATP-binding protein/oleandomycin transport system ATP-binding protein 0.9548 3 214 GO:0005524
GO:0016887
AF-A0A2B9EER2-F1-model_v4 deleted 0.9498 3 208
AF-A0A348B4H2-F1-model_v4 ABC transporter domain-containing protein 0.9466 33 215 GO:0005524
GO:0016887
AF-A0A838S8A2-F1-model_v4 ATP-binding cassette domain-containing protein 0.9459 1 217 GO:0005524
GO:0016887
GO:0043215
GO:0046677
GO:1900753
AF-A0A7X0U3N5-F1-model_v4 ABC-2 type transport system ATP-binding protein 0.9443 2 216 GO:0005524
GO:0016887

Map