F429205

General Info

Members Datasets Scaffolds Average Seq Length
382 229 372 355

Family's Representative Sequence

Representative Sequence 3300005468|Ga0070707_100001851|Ga0070707_10000185111
Length 391
Sequence MTPGGNVGSRSGVSRAVTPDSQEPIGVAVVGAGYWGPNLARNFAASGQFRLAWVADLDESRAQRAVGSYSTVGITDDLRAVLADERVHAVAIATPAATHLPIALDALRAGKHVLVEKPLAATYADGLALVEEADRRRAVLMCDHTYCYTPAVTKIRQLVRSGELGDVHFIDSVRINLGIVQRDIDVLWDLAPHDLSILDSVLPAGMEPLAVAAHGADPIGAGRSCVAFVTLQLTGGAIAHVHVNWLSPTKVRTTLIGGSKRALLWDDLNPIQRVAIFDRGVDLIPPEEARAEDRLEAIVSYRSGDMVSPALSEQEPLREVVEEFAACIRTGRAPLTDGRSGLRVLDILEAASRSMAFHGAVVGLRVGSQARAPEASNPAPPHEVSTLGSSP

Samples

Sample ID Description Type Environment
1 2643221694 Cellulomonas sp. Root137 Isolate Unclassified
2 2643221722 Cellulomonas sp. Root930 Isolate Unclassified
3 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
4 2795385472 Herbihabitans rhizosphaerae DSM 101727 Isolate Rhizosphere
5 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
6 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
7 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
8 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
9 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
10 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
11 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
12 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
13 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
47 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
48 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
49 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
50 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
51 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
52 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
53 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
54 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
55 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
59 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
65 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
66 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
67 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
68 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
69 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
70 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
71 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
72 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
73 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
74 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
75 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
76 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
77 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
105 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
106 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
108 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
109 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
110 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
111 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
112 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
113 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
114 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
115 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
116 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
117 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
118 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
119 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
120 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
121 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
122 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
123 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
124 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
125 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
126 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
127 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
128 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
129 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
130 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
131 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
132 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
133 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
134 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
135 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
136 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
137 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
138 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
139 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
140 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
141 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
142 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
143 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
144 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
145 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
146 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
147 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
148 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
149 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
150 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
151 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
152 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
153 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
154 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
155 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
156 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
157 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
158 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
159 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
160 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
161 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
162 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
163 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
164 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
165 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
166 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
167 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
168 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
169 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
170 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
171 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
172 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
173 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
174 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
175 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
176 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
177 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
193 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
194 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
195 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
196 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
197 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
198 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
199 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
200 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
201 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
202 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
203 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
204 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
205 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
206 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
209 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
210 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
211 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
212 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
213 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
214 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
215 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
216 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
217 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
218 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
219 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
220 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
221 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
222 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
223 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
224 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
225 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
226 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
227 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
228 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
229 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.34
Metatranscriptomes 1.05
Isolates 2.62

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.97
Nodule 0
Rhizoplane 1.57
Rhizosphere 88.74
Stem 0
Stem Tuber 0
Unclassified 4.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10025465 3300003320 Bacteria 7856
2 rootL2_10013363 3300003322 Bacteria 5395
3 rootH1_10122018 3300003323 Bacteria 5307
4 Ga0070658_10035727 3300005327 Bacteria 4003
5 Ga0070683_100002596 3300005329 Bacteria 14443
6 Ga0070683_100039322 3300005329 Bacteria 4341
7 Ga0070683_100157472 3300005329 Bacteria 2154
8 Ga0070670_100128567 3300005331 Bacteria 2187
9 Ga0068869_100002126 3300005334 Bacteria 11912
10 Ga0070680_100011008 3300005336 Bacteria 6993
11 Ga0070680_100101317 3300005336 Bacteria 2390
12 Ga0070682_100201874 3300005337 Bacteria 1403
13 Ga0070660_100069203 3300005339 Bacteria 2752
14 Ga0070660_100092050 3300005339 Bacteria 2393
15 Ga0070661_100035792 3300005344 Bacteria 3608
16 Ga0070661_100079549 3300005344 Bacteria 2419
17 Ga0070668_100058008 3300005347 Bacteria 2994
18 Ga0070668_100266990 3300005347 Bacteria 1425
19 Ga0070659_100032021 3300005366 Bacteria 4076
20 Ga0070659_100270171 3300005366 Bacteria 1413
21 Ga0070709_10091352 3300005434 Bacteria 2009
22 Ga0070714_100000960 3300005435 Bacteria 20565
23 Ga0070714_100028801 3300005435 Bacteria 4612
24 Ga0070713_100019975 3300005436 Bacteria 5128
25 Ga0070700_100039202 3300005441 Bacteria 2892
26 Ga0070694_100169269 3300005444 Bacteria 1608
27 Ga0070708_100000958 3300005445 Bacteria 21905
28 Ga0070708_100018274 3300005445 Bacteria 5866
29 Ga0070663_100005157 3300005455 Bacteria 7736
30 Ga0070681_10004181 3300005458 Bacteria 13668
31 Ga0070681_10083969 3300005458 Bacteria 3137
32 Ga0070706_100006148 3300005467 Bacteria 11360
33 Ga0070707_100001851 3300005468 Bacteria 20321
34 Ga0070707_100069369 3300005468 Bacteria 3394
35 Ga0070699_100000200 3300005518 Bacteria 59093
36 Ga0070679_100000645 3300005530 Bacteria 29710
37 Ga0070679_100030080 3300005530 Bacteria 5359
38 Ga0070684_100002504 3300005535 Bacteria 13532
39 Ga0070684_100017325 3300005535 Bacteria 5910
40 Ga0070684_100061513 3300005535 Bacteria 3286
41 Ga0070684_100064206 3300005535 Bacteria 3220
42 Ga0070697_100002591 3300005536 Bacteria 13911
43 Ga0068853_100176917 3300005539 Bacteria 1933
44 Ga0070664_100002003 3300005564 Bacteria 16337
45 Ga0070664_100013057 3300005564 Bacteria 6758
46 Ga0070664_100251734 3300005564 Bacteria 1588
47 Ga0068857_100007082 3300005577 Bacteria 9657
48 Ga0068857_100169169 3300005577 Bacteria 1986
49 Ga0070702_100032309 3300005615 Bacteria 2871
50 Ga0070702_100046848 3300005615 Bacteria 2453
51 Ga0068852_100017705 3300005616 Bacteria 5597
52 Ga0068852_100180448 3300005616 Bacteria 1985
53 Ga0068864_100011304 3300005618 Bacteria 7375
54 Ga0068861_100255201 3300005719 Bacteria 1498
55 Ga0068863_100217962 3300005841 Bacteria 1838
56 Ga0070717_10005261 3300006028 Bacteria 9429
57 Ga0075368_10004692 3300006042 Bacteria 4648
58 Ga0075363_100007177 3300006048 Bacteria 5103
59 Ga0075364_10163615 3300006051 Bacteria 1502
60 Ga0075367_10003243 3300006178 Bacteria 7698
61 Ga0075370_10056076 3300006353 Bacteria 2239
62 Ga0075428_100113061 3300006844 Bacteria 2958
63 Ga0075431_100115959 3300006847 Bacteria 2765
64 Ga0075429_100039737 3300006880 Bacteria 4095
65 Ga0075429_100163076 3300006880 Bacteria 1952
66 Ga0111539_10007280 3300009094 Bacteria 14168
67 Ga0105245_10005115 3300009098 Bacteria 11525
68 Ga0105245_10342317 3300009098 Bacteria 1479
69 Ga0114129_10365672 3300009147 Bacteria 1908
70 Ga0105243_10236952 3300009148 Bacteria 1622
71 Ga0105241_10092458 3300009174 Bacteria 2389
72 Ga0105241_10256916 3300009174 Bacteria 1484
73 Ga0105248_10242809 3300009177 Bacteria 2027
74 Ga0105238_10283535 3300009551 Bacteria 1638
75 Ga0105249_10154512 3300009553 Bacteria 2212
76 Ga0105239_10226660 3300010375 Bacteria 2096
77 Ga0105246_10086088 3300011119 Bacteria 2252
78 Ga0105246_10223313 3300011119 Bacteria 1478
79 Ga0157369_10025159 3300013105 Bacteria 6610
80 Ga0157369_10073400 3300013105 Bacteria 3671
81 Ga0157369_10127169 3300013105 Bacteria 2701
82 Ga0157374_10221906 3300013296 Bacteria 1855
83 Ga0157372_10118330 3300013307 Bacteria 3040
84 Ga0157372_10341356 3300013307 Bacteria 1744
85 Ga0157372_10427338 3300013307 Bacteria 1544
86 Ga0157375_10082418 3300013308 Bacteria 3259
87 Ga0163163_10037723 3300014325 Bacteria 4703
88 Ga0182008_10001334 3300014497 Bacteria 16808
89 Ga0157377_10073020 3300014745 Bacteria 1987
90 Ga0157377_10149368 3300014745 Bacteria 1443
91 Ga0182007_10000534 3300015262 Bacteria 22387
92 Ga0183367_1003 3300015688 Bacteria 814276
93 Ga0163161_10048158 3300017792 Bacteria 3078
94 Ga0206353_11076454 3300020082 Bacteria 5359
95 Ga0206353_11379736 3300020082 Bacteria 2722
96 Ga0213875_10005956 3300021388 Bacteria 6468
97 Ga0207692_10000068 3300025898 Bacteria 30322
98 Ga0207688_10086214 3300025901 Bacteria 1799
99 Ga0207647_10031238 3300025904 Bacteria 3428
100 Ga0207699_10055724 3300025906 Bacteria 2354
101 Ga0207684_10007511 3300025910 Bacteria 9808
102 Ga0207707_10064425 3300025912 Bacteria 3190
103 Ga0207660_10054096 3300025917 Bacteria 2864
104 Ga0207657_10077649 3300025919 Bacteria 2798
105 Ga0207657_10095437 3300025919 Bacteria 2474
106 Ga0207657_10320931 3300025919 Bacteria 1225
107 Ga0207649_10064390 3300025920 Bacteria 2318
108 Ga0207646_10004629 3300025922 Bacteria 14855
109 Ga0207646_10011521 3300025922 Bacteria 8553
110 Ga0207650_10073501 3300025925 Bacteria 2575
111 Ga0207700_10265603 3300025928 Bacteria 1471
112 Ga0207664_10020639 3300025929 Bacteria 4887
113 Ga0207664_10188409 3300025929 Bacteria 1775
114 Ga0207664_10195904 3300025929 Bacteria 1742
115 Ga0207690_10067532 3300025932 Bacteria 2453
116 Ga0207690_10132967 3300025932 Bacteria 1823
117 Ga0207706_10036264 3300025933 Bacteria 4381
118 Ga0207704_10089712 3300025938 Bacteria 2015
119 Ga0207689_10022195 3300025942 Bacteria 5336
120 Ga0207661_10000835 3300025944 Bacteria 20192
121 Ga0207661_10002410 3300025944 Bacteria 12877
122 Ga0207661_10003563 3300025944 Bacteria 10824
123 Ga0207661_10015365 3300025944 Bacteria 5632
124 Ga0207661_10027447 3300025944 Bacteria 4349
125 Ga0207679_10017198 3300025945 Bacteria 4818
126 Ga0207679_10211613 3300025945 Bacteria 1626
127 Ga0207639_10161432 3300026041 Bacteria 1889
128 Ga0207678_10021068 3300026067 Bacteria 5715
129 Ga0207708_10072931 3300026075 Bacteria 2631
130 Ga0207702_10026487 3300026078 Bacteria 4813
131 Ga0207641_10163598 3300026088 Bacteria 2025
132 Ga0207674_10009409 3300026116 Bacteria 11169
133 Ga0207674_10219847 3300026116 Bacteria 1848
134 Ga0207675_100315350 3300026118 Bacteria 1526
135 Ga0207675_100317602 3300026118 Bacteria 1520
136 Ga0207698_10036405 3300026142 Bacteria 3612
137 Ga0207698_10268753 3300026142 Bacteria 1571
138 Ga0209813_10003652 3300027866 Bacteria 3616
139 Ga0207428_10013705 3300027907 Bacteria 7068
140 Ga0268264_10175294 3300028381 Bacteria 1943
141 Ga0268264_10206752 3300028381 Bacteria 1799
142 Ga0307517_10008697 3300028786 Bacteria 14527
143 Ga0307517_10079421 3300028786 Bacteria 2823
144 Ga0265760_10034563 3300031090 Bacteria 1495
145 Ga0265340_10001742 3300031247 Bacteria 12478
146 Ga0307513_10005478 3300031456 Bacteria 16770
147 Ga0307513_10009989 3300031456 Bacteria 11973
148 Ga0307408_100115442 3300031548 Bacteria 2071
149 Ga0307508_10012815 3300031616 Bacteria 7665
150 Ga0307508_10019471 3300031616 Bacteria 6170
151 Ga0307508_10275591 3300031616 Bacteria 1276
152 Ga0316576_10007570 3300031727 Bacteria 6852
153 Ga0307405_10203112 3300031731 Bacteria 1441
154 Ga0307413_10060919 3300031824 Bacteria 2326
155 Ga0307406_10046032 3300031901 Bacteria 2743
156 Ga0307407_10050090 3300031903 Bacteria 2388
157 Ga0307415_100031931 3300032126 Bacteria 3400
158 Ga0307507_10000007 3300033179 Bacteria 269525
159 Ga0307507_10097718 3300033179 Bacteria 2476
160 Ga0316596_1020329 3300033541 Bacteria 1687
161 Ga0316574_0168275 3300035398 Bacteria 1411
162 Ga0373937_0007908 3300036401 Bacteria 9215
163 Ga0316584_0019542 3300036712 Bacteria 4898
164 Ga0316584_0220950 3300036712 Bacteria 1392
165 Ga0395899_0001011 3300037312 Bacteria 25761
166 Ga0395900_0338025 3300037418 Bacteria 1482
167 Ga0395898_0001659 3300037466 Bacteria 29889
168 Ga0436364_0667106 3300037853 Bacteria 14641
169 Ga0395901_0086659 3300038443 Bacteria 3274
170 Ga0395901_0160650 3300038443 Bacteria 2360
171 Ga0439448_0049071 3300042005 Bacteria 1379
172 Ga0439455_0001518 3300042012 Bacteria 3912
173 Ga0439463_011291 3300042016 Bacteria 2195
174 Ga0450903_000166 3300042138 Bacteria 14496
175 Ga0439458_0002647 3300042157 Bacteria 4316
176 Ga0466969_0007040 3300044656 Bacteria 5979
177 Ga0466972_0017652 3300044658 Bacteria 3571
178 Ga0466965_0003737 3300044683 Bacteria 6717
179 Ga0466966_0077671 3300044684 Bacteria 2071
180 Ga0466966_0158434 3300044684 Bacteria 1379
181 Ga0466961_0059058 3300044693 Bacteria 2439
182 Ga0466961_0100732 3300044693 Bacteria 1820
183 Ga0466963_0004391 3300044694 Bacteria 8194
184 Ga0466971_0064064 3300044719 Bacteria 1664
185 Ga0466970_0004080 3300044765 Bacteria 7177
186 Ga0466957_0023833 3300044842 Bacteria 3620
187 Ga0466957_0038842 3300044842 Bacteria 2870
188 Ga0466957_0159592 3300044842 Bacteria 1464
189 Ga0466960_0080940 3300044901 Bacteria 1636
190 Ga0466959_0014333 3300045049 Bacteria 5755
191 Ga0466959_0021915 3300045049 Bacteria 4719
192 Ga0466958_0002788 3300045836 Bacteria 8888
193 Ga0466958_0124377 3300045836 Bacteria 1616
194 Ga0466958_0172984 3300045836 Bacteria 1368
195 Ga0495592_0055595 3300046454 Bacteria 2927
196 Ga0495629_0005232 3300046459 Bacteria 9704
197 Ga0495629_0033974 3300046459 Bacteria 3606
198 Ga0495638_0124119 3300046460 Bacteria 1523
199 Ga0495651_0009578 3300046462 Bacteria 7443
200 Ga0495653_0053482 3300046463 Bacteria 3089
201 Ga0495585_0025692 3300046492 Bacteria 3370
202 Ga0495608_0070489 3300046511 Bacteria 2281
203 Ga0495618_0005133 3300046514 Bacteria 7998
204 Ga0495618_0082591 3300046514 Bacteria 2052
205 Ga0495628_0024491 3300046516 Bacteria 4940
206 Ga0495628_0049832 3300046516 Bacteria 3314
207 Ga0495643_0003734 3300046522 Bacteria 11019
208 Ga0495652_0105039 3300046529 Bacteria 2283
209 Ga0495640_0004894 3300046533 Bacteria 10659
210 Ga0495622_0096868 3300046557 Bacteria 1354
211 Ga0495667_0060633 3300046559 Bacteria 2481
212 Ga0495667_0106703 3300046559 Bacteria 1810
213 Ga0495634_0019544 3300046642 Bacteria 4812
214 Ga0495657_0001709 3300046675 Bacteria 18827
215 Ga0495623_0013861 3300046679 Bacteria 5227
216 Ga0495658_0005981 3300046683 Bacteria 5976
217 Ga0495613_0017640 3300046689 Bacteria 5316
218 Ga0495670_0002828 3300046691 Bacteria 8587
219 Ga0495589_0020541 3300046794 Bacteria 3377
220 Ga0495600_0011124 3300046809 Bacteria 5603
221 Ga0495600_0046575 3300046809 Bacteria 2829
222 Ga0495604_0051670 3300047317 Bacteria 3184
223 Ga0495676_0005474 3300047321 Bacteria 11640
224 Ga0495675_0029330 3300047444 Bacteria 3509
225 Ga0495675_0065917 3300047444 Bacteria 2290
226 Ga0495685_000351 3300047447 Bacteria 14734
227 Ga0495681_0001621 3300047470 Bacteria 16724
228 Ga0496108_0035401 3300048911 Bacteria 4150
229 Ga0496112_0032269 3300048915 Bacteria 5084
230 Ga0496112_0047915 3300048915 Bacteria 4192
231 Ga0496113_0022708 3300048916 Bacteria 4442
232 Ga0496113_0307086 3300048916 Bacteria 1271
233 Ga0496114_0173460 3300048917 Bacteria 1880
234 Ga0501031_0003814 3300049568 Bacteria 9696
235 Ga0501031_0039300 3300049568 Bacteria 3087
236 Ga0501031_0060821 3300049568 Bacteria 2461
237 Ga0501031_0076545 3300049568 Bacteria 2179
238 Ga0501032_0018242 3300049569 Bacteria 4919
239 Ga0501033_0000988 3300049570 Bacteria 25880
240 Ga0501033_0007726 3300049570 Bacteria 8340
241 Ga0501033_0080299 3300049570 Bacteria 2393
242 Ga0501034_0045045 3300049571 Bacteria 4459
243 Ga0501034_0093087 3300049571 Bacteria 3010
244 Ga0501036_0025495 3300049572 Bacteria 4988
245 Ga0501036_0027117 3300049572 Bacteria 4840
246 Ga0501036_0037355 3300049572 Bacteria 4109
247 Ga0501036_0052410 3300049572 Bacteria 3455
248 Ga0501036_0069364 3300049572 Bacteria 2982
249 Ga0501037_0074372 3300049573 Bacteria 2469
250 Ga0501038_0036742 3300049574 Bacteria 4298
251 Ga0501038_0172017 3300049574 Bacteria 1753
252 Ga0501039_0001679 3300049575 Bacteria 16318
253 Ga0501039_0005216 3300049575 Bacteria 9837
254 Ga0501039_0025724 3300049575 Bacteria 4524
255 Ga0501039_0028895 3300049575 Bacteria 4269
256 Ga0501039_0068142 3300049575 Bacteria 2763
257 Ga0501039_0077937 3300049575 Bacteria 2577
258 Ga0501040_0003209 3300049576 Bacteria 10582
259 Ga0501040_0019953 3300049576 Bacteria 4463
260 Ga0501041_0000953 3300049577 Bacteria 15727
261 Ga0501041_0009481 3300049577 Bacteria 5739
262 Ga0501041_0059288 3300049577 Bacteria 2343
263 Ga0501042_0004767 3300049578 Bacteria 8659
264 Ga0501042_0059478 3300049578 Bacteria 2729
265 Ga0501042_0074080 3300049578 Bacteria 2436
266 Ga0501042_0111751 3300049578 Bacteria 1967
267 Ga0501042_0283544 3300049578 Bacteria 1196
268 Ga0501043_0064778 3300049579 Bacteria 2870
269 Ga0501046_0016069 3300049580 Bacteria 6276
270 Ga0501046_0029528 3300049580 Bacteria 4457
271 Ga0501046_0059135 3300049580 Bacteria 3004
272 Ga0501046_0070877 3300049580 Bacteria 2709
273 Ga0501046_0345406 3300049580 Unclassified 1081
274 Ga0501047_0002599 3300049581 Bacteria 17192
275 Ga0501047_0056408 3300049581 Bacteria 3798
276 Ga0501048_0004844 3300049582 Bacteria 10258
277 Ga0501048_0064615 3300049582 Bacteria 2588
278 Ga0501048_0069355 3300049582 Bacteria 2490
279 Ga0501048_0181386 3300049582 Bacteria 1492
280 Ga0501067_0030395 3300049583 Bacteria 2996
281 Ga0501067_0140149 3300049583 Bacteria 1346
282 Ga0501068_0026831 3300049584 Bacteria 3397
283 Ga0501068_0071011 3300049584 Bacteria 2125
284 Ga0501069_0002696 3300049585 Bacteria 9065
285 Ga0501069_0084630 3300049585 Bacteria 1789
286 Ga0501070_0006970 3300049586 Bacteria 9613
287 Ga0501070_0051821 3300049586 Bacteria 3406
288 Ga0501070_0120157 3300049586 Bacteria 2172
289 Ga0501070_0124486 3300049586 Bacteria 2131
290 Ga0501071_0004562 3300049587 Bacteria 8781
291 Ga0501071_0022872 3300049587 Bacteria 4360
292 Ga0501071_0029515 3300049587 Bacteria 3871
293 Ga0501071_0042358 3300049587 Bacteria 3262
294 Ga0501071_0140223 3300049587 Bacteria 1800
295 Ga0501072_0001582 3300049588 Bacteria 17003
296 Ga0501072_0004131 3300049588 Bacteria 10988
297 Ga0501072_0015317 3300049588 Bacteria 5881
298 Ga0501072_0134395 3300049588 Bacteria 1972
299 Ga0501073_0030913 3300049589 Bacteria 3823
300 Ga0501074_0006682 3300049590 Bacteria 8326
301 Ga0501074_0006901 3300049590 Bacteria 8199
302 Ga0501074_0015930 3300049590 Bacteria 5467
303 Ga0501074_0030982 3300049590 Bacteria 3876
304 Ga0501075_0000994 3300049591 Bacteria 18091
305 Ga0501075_0014929 3300049591 Bacteria 5571
306 Ga0501075_0023441 3300049591 Bacteria 4520
307 Ga0501075_0028011 3300049591 Bacteria 4156
308 Ga0501075_0223608 3300049591 Bacteria 1436
309 Ga0501076_0001042 3300049592 Bacteria 18203
310 Ga0501076_0003208 3300049592 Bacteria 11417
311 Ga0501076_0008331 3300049592 Bacteria 7597
312 Ga0501076_0031272 3300049592 Bacteria 4150
313 Ga0501076_0137788 3300049592 Bacteria 1982
314 Ga0501077_0003951 3300049593 Bacteria 8940
315 Ga0501077_0022340 3300049593 Bacteria 4006
316 Ga0501077_0026964 3300049593 Bacteria 3648
317 Ga0501077_0080800 3300049593 Bacteria 2059
318 Ga0501077_0160104 3300049593 Bacteria 1429
319 Ga0501079_0000612 3300049741 Bacteria 23624
320 Ga0501079_0009645 3300049741 Bacteria 7321
321 Ga0501079_0014860 3300049741 Bacteria 5935
322 Ga0501079_0014878 3300049741 Bacteria 5930
323 Ga0501079_0032070 3300049741 Bacteria 4038
324 Ga0501079_0084117 3300049741 Bacteria 2461
325 Ga0501079_0203580 3300049741 Bacteria 1546
326 Ga0501080_0019885 3300049742 Bacteria 6218
327 Ga0501080_0064870 3300049742 Bacteria 3397
328 Ga0501080_0201741 3300049742 Bacteria 1826
329 Ga0501081_0218659 3300049743 Bacteria 1385
330 Ga0501081_0287635 3300049743 Bacteria 1204
331 Ga0501035_0003509 3300049822 Bacteria 14988
332 Ga0501035_0032571 3300049822 Bacteria 4741
333 Ga0501044_0054741 3300049823 Bacteria 4099
334 Ga0501044_0285306 3300049823 Bacteria 1583
335 Ga0501045_0012974 3300049824 Bacteria 5873
336 Ga0501045_0019230 3300049824 Bacteria 4866
337 Ga0501045_0043226 3300049824 Bacteria 3280
338 Ga0501045_0100759 3300049824 Bacteria 2138
339 nmdc:mga03n38_4190_c1 3300050490 Bacteria 4744
340 nmdc:mga06z11_8513_c1 3300050494 Bacteria 4284
341 nmdc:mga04h51_2994_c1 3300050495 Bacteria 4065
342 nmdc:mga07m45_71912_c1 3300050496 Bacteria 1968
343 nmdc:mga09592_147683_c1 3300050508 Bacteria 2027
344 nmdc:mga09592_196295_c1 3300050508 Bacteria 1747
345 nmdc:mga06r32_211849_c1 3300050510 Bacteria 1925
346 nmdc:mga06r32_92406_c1 3300050510 Bacteria 2958
347 nmdc:mga08y16_4395_c1 3300050511 Bacteria 14734
348 Ga0495601_0000115 3300053077 Bacteria 44158
349 Ga0495595_0038088 3300053084 Bacteria 2189
350 Ga0495619_0030222 3300053085 Bacteria 3506
351 Ga0500652_005067 3300053131 Bacteria 4120
352 Ga0500658_0034718 3300053134 Bacteria 1992
353 Ga0500559_0007246 3300053136 Bacteria 4929
354 Ga0500561_0000243 3300053137 Bacteria 9747
355 Ga0500600_0014647 3300053149 Bacteria 4763
356 Ga0500616_0002017 3300053153 Bacteria 17938
357 Ga0500616_0020735 3300053153 Bacteria 3690
358 Ga0500634_0004375 3300053161 Bacteria 6512
359 Ga0500587_000876 3300053739 Bacteria 3994
360 Ga0501084_0004613 3300054114 Bacteria 11256
361 Ga0501084_0006806 3300054114 Bacteria 9405
362 Ga0501084_0015484 3300054114 Bacteria 6324
363 Ga0501084_0023827 3300054114 Bacteria 5105
364 Ga0501084_0059516 3300054114 Bacteria 3197
365 Ga0501082_0019475 3300060353 Bacteria 5850
366 Ga0501082_0019574 3300060353 Bacteria 5837
367 Ga0501082_0055602 3300060353 Bacteria 3409
368 Ga0501082_0062895 3300060353 Bacteria 3196
369 Ga0530510_0001068 3300061734 Bacteria 18198
370 Ga0530510_0003082 3300061734 Bacteria 11444
371 Ga0530510_0003375 3300061734 Bacteria 10988
372 Ga0530510_0013240 3300061734 Bacteria 5799

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049580 Ga0501046_0345406 Ga0501046_0345406_21_1007 303
2 3300053084 Ga0495595_0038088 Ga0495595_0038088_1172_2146 311
3 3300036712 Ga0316584_0019542 Ga0316584_0019542_2581_3528 312
4 3300044684 Ga0466966_0158434 Ga0466966_0158434_128_1087 312
5 3300046454 Ga0495592_0055595 Ga0495592_0055595_87_1076 312
6 3300046459 Ga0495629_0005232 Ga0495629_0005232_5694_6683 312
7 3300046514 Ga0495618_0082591 Ga0495618_0082591_118_1107 312
8 3300046516 Ga0495628_0024491 Ga0495628_0024491_67_1056 312
9 3300046529 Ga0495652_0105039 Ga0495652_0105039_1061_2050 312
10 3300046533 Ga0495640_0004894 Ga0495640_0004894_285_1274 312
11 3300046559 Ga0495667_0060633 Ga0495667_0060633_955_1944 312
12 3300046642 Ga0495634_0019544 Ga0495634_0019544_1195_2184 312
13 3300046689 Ga0495613_0017640 Ga0495613_0017640_4261_5250 312
14 3300046809 Ga0495600_0011124 Ga0495600_0011124_4531_5520 312
15 3300047317 Ga0495604_0051670 Ga0495604_0051670_158_1147 312
16 3300047321 Ga0495676_0005474 Ga0495676_0005474_1597_2586 312
17 3300048917 Ga0496114_0173460 Ga0496114_0173460_458_1435 322
18 3300049593 Ga0501077_0160104 Ga0501077_0160104_19_999 323
19 3300049583 Ga0501067_0030395 Ga0501067_0030395_1931_2986 326
20 3300049592 Ga0501076_0137788 Ga0501076_0137788_948_1937 326
21 3300006048 Ga0075363_100007177 Ga0075363_1000071775 331
22 3300006353 Ga0075370_10056076 Ga0075370_100560762 331
23 3300050490 nmdc:mga03n38_4190_c1 nmdc:mga03n38_4190_c1_2843_3892 331
24 3300050496 nmdc:mga07m45_71912_c1 nmdc:mga07m45_71912_c1_40_1089 331
25 3300036401 Ga0373937_0007908 Ga0373937_0007908_2952_4022 334
26 3300046462 Ga0495651_0009578 Ga0495651_0009578_201_1271 334
27 3300046463 Ga0495653_0053482 Ga0495653_0053482_188_1258 334
28 3300046511 Ga0495608_0070489 Ga0495608_0070489_29_1099 334
29 3300046559 Ga0495667_0106703 Ga0495667_0106703_386_1456 334
30 3300046675 Ga0495657_0001709 Ga0495657_0001709_13415_14485 334
31 3300046679 Ga0495623_0013861 Ga0495623_0013861_3789_4859 334
32 3300046809 Ga0495600_0046575 Ga0495600_0046575_784_1854 334
33 3300047444 Ga0495675_0029330 Ga0495675_0029330_2323_3393 334
34 3300053085 Ga0495619_0030222 Ga0495619_0030222_176_1246 334
35 3300005329 Ga0070683_100039322 Ga0070683_1000393222 335
36 3300005535 Ga0070684_100017325 Ga0070684_1000173252 335
37 3300025944 Ga0207661_10027447 Ga0207661_100274472 335
38 3300031456 Ga0307513_10009989 Ga0307513_100099896 336
39 3300009177 Ga0105248_10242809 Ga0105248_102428092 339
40 3300049568 Ga0501031_0039300 Ga0501031_0039300_1335_2363 339
41 3300049570 Ga0501033_0080299 Ga0501033_0080299_1118_2146 339
42 3300049571 Ga0501034_0093087 Ga0501034_0093087_475_1503 339
43 3300049572 Ga0501036_0052410 Ga0501036_0052410_1116_2144 339
44 3300049575 Ga0501039_0068142 Ga0501039_0068142_1170_2198 339
45 3300049579 Ga0501043_0064778 Ga0501043_0064778_1632_2660 339
46 3300049581 Ga0501047_0002599 Ga0501047_0002599_4176_5204 339
47 3300049824 Ga0501045_0100759 Ga0501045_0100759_230_1258 339
48 3300050508 nmdc:mga09592_147683_c1 nmdc:mga09592_147683_c1_13_1041 339
49 3300005434 Ga0070709_10091352 Ga0070709_100913522 340
50 3300005435 Ga0070714_100028801 Ga0070714_1000288012 340
51 3300025898 Ga0207692_10000068 Ga0207692_100000683 340
52 3300025906 Ga0207699_10055724 Ga0207699_100557242 340
53 3300015688 Ga0183367_1003 Ga0183367_1003470 341
54 3300033541 Ga0316596_1020329 Ga0316596_10203292 341
55 3300037418 Ga0395900_0338025 Ga0395900_0338025_432_1466 341
56 3300042005 Ga0439448_0049071 Ga0439448_0049071_302_1336 341
57 3300042012 Ga0439455_0001518 Ga0439455_0001518_1416_2450 341
58 3300042138 Ga0450903_000166 Ga0450903_000166_367_1401 341
59 3300042157 Ga0439458_0002647 Ga0439458_0002647_1096_2130 341
60 3300046557 Ga0495622_0096868 Ga0495622_0096868_269_1303 341
61 3300046794 Ga0495589_0020541 Ga0495589_0020541_63_1097 341
62 3300050510 nmdc:mga06r32_211849_c1 nmdc:mga06r32_211849_c1_559_1599 341
63 3300031548 Ga0307408_100115442 Ga0307408_1001154422 343
64 3300031824 Ga0307413_10060919 Ga0307413_100609192 343
65 3300031903 Ga0307407_10050090 Ga0307407_100500902 343
66 3300044658 Ga0466972_0017652 Ga0466972_0017652_45_1094 343
67 3300044765 Ga0466970_0004080 Ga0466970_0004080_2006_3055 343
68 3300044901 Ga0466960_0080940 Ga0466960_0080940_439_1488 343
69 3300049572 Ga0501036_0037355 Ga0501036_0037355_2704_3741 343
70 3300049575 Ga0501039_0025724 Ga0501039_0025724_1129_2166 343
71 3300049578 Ga0501042_0111751 Ga0501042_0111751_747_1784 343
72 3300049580 Ga0501046_0029528 Ga0501046_0029528_2357_3394 343
73 3300049582 Ga0501048_0069355 Ga0501048_0069355_910_1947 343
74 3300049591 Ga0501075_0028011 Ga0501075_0028011_22_1059 343
75 3300049592 Ga0501076_0008331 Ga0501076_0008331_6273_7310 343
76 3300049593 Ga0501077_0026964 Ga0501077_0026964_1449_2486 343
77 3300049741 Ga0501079_0084117 Ga0501079_0084117_996_2033 343
78 3300054114 Ga0501084_0015484 Ga0501084_0015484_276_1313 343
79 iso_pu_bacteria 2643221694 2644527295 343
80 iso_pu_bacteria 2643221722 2644667639 343
81 iso_pu_bacteria 2808606375 2808915291 343
82 iso_pu_bacteria 2862281513 2862282557 343
83 3300005329 Ga0070683_100002596 Ga0070683_10000259610 344
84 3300005331 Ga0070670_100128567 Ga0070670_1001285673 344
85 3300005344 Ga0070661_100035792 Ga0070661_1000357922 344
86 3300005530 Ga0070679_100030080 Ga0070679_1000300803 344
87 3300005535 Ga0070684_100002504 Ga0070684_1000025049 344
88 3300005564 Ga0070664_100013057 Ga0070664_1000130575 344
89 3300005564 Ga0070664_100251734 Ga0070664_1002517342 344
90 3300005616 Ga0068852_100180448 Ga0068852_1001804482 344
91 3300005618 Ga0068864_100011304 Ga0068864_1000113043 344
92 3300006042 Ga0075368_10004692 Ga0075368_100046922 344
93 3300006178 Ga0075367_10003243 Ga0075367_100032435 344
94 3300009098 Ga0105245_10342317 Ga0105245_103423172 344
95 3300009174 Ga0105241_10092458 Ga0105241_100924583 344
96 3300010375 Ga0105239_10226660 Ga0105239_102266603 344
97 3300011119 Ga0105246_10223313 Ga0105246_102233132 344
98 3300013105 Ga0157369_10073400 Ga0157369_100734002 344
99 3300013105 Ga0157369_10127169 Ga0157369_101271692 344
100 3300013296 Ga0157374_10221906 Ga0157374_102219062 344
101 3300013307 Ga0157372_10341356 Ga0157372_103413562 344
102 3300013307 Ga0157372_10427338 Ga0157372_104273382 344
103 3300014497 Ga0182008_10001334 Ga0182008_100013345 344
104 3300014745 Ga0157377_10149368 Ga0157377_101493682 344
105 3300015262 Ga0182007_10000534 Ga0182007_100005344 344
106 3300025919 Ga0207657_10320931 Ga0207657_103209311 344
107 3300025925 Ga0207650_10073501 Ga0207650_100735013 344
108 3300025944 Ga0207661_10000835 Ga0207661_100008358 344
109 3300025944 Ga0207661_10003563 Ga0207661_100035636 344
110 3300025945 Ga0207679_10017198 Ga0207679_100171983 344
111 3300026067 Ga0207678_10021068 Ga0207678_100210683 344
112 3300026078 Ga0207702_10026487 Ga0207702_100264873 344
113 3300026142 Ga0207698_10268753 Ga0207698_102687532 344
114 3300027866 Ga0209813_10003652 Ga0209813_100036523 344
115 3300031616 Ga0307508_10019471 Ga0307508_100194713 344
116 3300031901 Ga0307406_10046032 Ga0307406_100460321 344
117 3300032126 Ga0307415_100031931 Ga0307415_1000319312 344
118 3300035398 Ga0316574_0168275 Ga0316574_0168275_85_1137 344
119 3300036712 Ga0316584_0220950 Ga0316584_0220950_248_1303 344
120 3300037312 Ga0395899_0001011 Ga0395899_0001011_10560_11603 344
121 3300037466 Ga0395898_0001659 Ga0395898_0001659_11402_12496 344
122 3300038443 Ga0395901_0160650 Ga0395901_0160650_798_1892 344
123 3300042016 Ga0439463_011291 Ga0439463_011291_811_1854 344
124 3300044719 Ga0466971_0064064 Ga0466971_0064064_317_1396 344
125 3300048911 Ga0496108_0035401 Ga0496108_0035401_2848_3891 344
126 3300048915 Ga0496112_0032269 Ga0496112_0032269_203_1246 344
127 3300048916 Ga0496113_0022708 Ga0496113_0022708_216_1259 344
128 3300049569 Ga0501032_0018242 Ga0501032_0018242_398_1621 344
129 3300049570 Ga0501033_0000988 Ga0501033_0000988_16802_17881 344
130 3300049571 Ga0501034_0045045 Ga0501034_0045045_1281_2369 344
131 3300049572 Ga0501036_0027117 Ga0501036_0027117_1450_2538 344
132 3300049572 Ga0501036_0069364 Ga0501036_0069364_1871_2914 344
133 3300049573 Ga0501037_0074372 Ga0501037_0074372_242_1465 344
134 3300049574 Ga0501038_0036742 Ga0501038_0036742_1696_2784 344
135 3300049574 Ga0501038_0172017 Ga0501038_0172017_490_1533 344
136 3300049575 Ga0501039_0001679 Ga0501039_0001679_10414_11457 344
137 3300049575 Ga0501039_0077937 Ga0501039_0077937_960_2003 344
138 3300049576 Ga0501040_0003209 Ga0501040_0003209_274_1317 344
139 3300049577 Ga0501041_0000953 Ga0501041_0000953_4889_5932 344
140 3300049578 Ga0501042_0004767 Ga0501042_0004767_811_1854 344
141 3300049578 Ga0501042_0283544 Ga0501042_0283544_141_1184 344
142 3300049580 Ga0501046_0059135 Ga0501046_0059135_214_1257 344
143 3300049581 Ga0501047_0056408 Ga0501047_0056408_2170_3258 344
144 3300049582 Ga0501048_0064615 Ga0501048_0064615_1128_2171 344
145 3300049584 Ga0501068_0071011 Ga0501068_0071011_598_1641 344
146 3300049586 Ga0501070_0120157 Ga0501070_0120157_238_1281 344
147 3300049586 Ga0501070_0124486 Ga0501070_0124486_435_1517 344
148 3300049587 Ga0501071_0042358 Ga0501071_0042358_1757_2800 344
149 3300049588 Ga0501072_0001582 Ga0501072_0001582_11075_12118 344
150 3300049588 Ga0501072_0134395 Ga0501072_0134395_49_1092 344
151 3300049590 Ga0501074_0030982 Ga0501074_0030982_2769_3812 344
152 3300049591 Ga0501075_0023441 Ga0501075_0023441_2285_3328 344
153 3300049593 Ga0501077_0022340 Ga0501077_0022340_1995_3038 344
154 3300049741 Ga0501079_0014860 Ga0501079_0014860_19_1062 344
155 3300049741 Ga0501079_0203580 Ga0501079_0203580_443_1486 344
156 3300049742 Ga0501080_0201741 Ga0501080_0201741_501_1589 344
157 3300049743 Ga0501081_0287635 Ga0501081_0287635_58_1101 344
158 3300049822 Ga0501035_0003509 Ga0501035_0003509_2976_4019 344
159 3300049823 Ga0501044_0054741 Ga0501044_0054741_2653_3741 344
160 3300049823 Ga0501044_0285306 Ga0501044_0285306_359_1447 344
161 3300049824 Ga0501045_0012974 Ga0501045_0012974_1652_2695 344
162 3300050494 nmdc:mga06z11_8513_c1 nmdc:mga06z11_8513_c1_35_1114 344
163 3300050495 nmdc:mga04h51_2994_c1 nmdc:mga04h51_2994_c1_1337_2416 344
164 3300054114 Ga0501084_0004613 Ga0501084_0004613_2928_3971 344
165 3300060353 Ga0501082_0019574 Ga0501082_0019574_4019_5062 344
166 3300061734 Ga0530510_0001068 Ga0530510_0001068_11077_12120 344
167 iso_pu_bacteria 2786546132 2786674689 344
168 iso_pu_bacteria 2954002825 2954008452 344
169 iso_pu_bacteria 2954673503 2954680713 344
170 iso_pu_bacteria 2954682443 2954683440 344
171 3300005327 Ga0070658_10035727 Ga0070658_100357272 345
172 3300005329 Ga0070683_100157472 Ga0070683_1001574722 345
173 3300005336 Ga0070680_100011008 Ga0070680_1000110089 345
174 3300005336 Ga0070680_100101317 Ga0070680_1001013172 345
175 3300005337 Ga0070682_100201874 Ga0070682_1002018741 345
176 3300005339 Ga0070660_100092050 Ga0070660_1000920502 345
177 3300005347 Ga0070668_100266990 Ga0070668_1002669901 345
178 3300005366 Ga0070659_100270171 Ga0070659_1002701711 345
179 3300005435 Ga0070714_100000960 Ga0070714_1000009602 345
180 3300005436 Ga0070713_100019975 Ga0070713_1000199752 345
181 3300005445 Ga0070708_100018274 Ga0070708_1000182744 345
182 3300005458 Ga0070681_10004181 Ga0070681_1000418115 345
183 3300005458 Ga0070681_10083969 Ga0070681_100839693 345
184 3300005467 Ga0070706_100006148 Ga0070706_1000061484 345
185 3300005468 Ga0070707_100069369 Ga0070707_1000693692 345
186 3300005518 Ga0070699_100000200 Ga0070699_1000002006 345
187 3300005530 Ga0070679_100000645 Ga0070679_1000006458 345
188 3300005535 Ga0070684_100061513 Ga0070684_1000615134 345
189 3300005535 Ga0070684_100064206 Ga0070684_1000642063 345
190 3300005536 Ga0070697_100002591 Ga0070697_1000025915 345
191 3300006028 Ga0070717_10005261 Ga0070717_100052616 345
192 3300006051 Ga0075364_10163615 Ga0075364_101636152 345
193 3300006844 Ga0075428_100113061 Ga0075428_1001130612 345
194 3300006847 Ga0075431_100115959 Ga0075431_1001159592 345
195 3300006880 Ga0075429_100039737 Ga0075429_1000397374 345
196 3300013105 Ga0157369_10025159 Ga0157369_100251592 345
197 3300014325 Ga0163163_10037723 Ga0163163_100377234 345
198 3300020082 Ga0206353_11076454 Ga0206353_110764542 345
199 3300020082 Ga0206353_11379736 Ga0206353_113797362 345
200 3300025910 Ga0207684_10007511 Ga0207684_100075116 345
201 3300025912 Ga0207707_10064425 Ga0207707_100644252 345
202 3300025917 Ga0207660_10054096 Ga0207660_100540962 345
203 3300025919 Ga0207657_10095437 Ga0207657_100954372 345
204 3300025922 Ga0207646_10011521 Ga0207646_100115212 345
205 3300025928 Ga0207700_10265603 Ga0207700_102656031 345
206 3300025929 Ga0207664_10020639 Ga0207664_100206393 345
207 3300025929 Ga0207664_10188409 Ga0207664_101884092 345
208 3300025929 Ga0207664_10195904 Ga0207664_101959042 345
209 3300025932 Ga0207690_10132967 Ga0207690_101329672 345
210 3300025944 Ga0207661_10002410 Ga0207661_100024104 345
211 3300025945 Ga0207679_10211613 Ga0207679_102116132 345
212 3300028786 Ga0307517_10008697 Ga0307517_100086976 345
213 3300031247 Ga0265340_10001742 Ga0265340_100017429 345
214 3300031616 Ga0307508_10012815 Ga0307508_100128157 345
215 3300031616 Ga0307508_10275591 Ga0307508_102755912 345
216 3300031727 Ga0316576_10007570 Ga0316576_100075702 345
217 3300033179 Ga0307507_10000007 Ga0307507_10000007125 345
218 3300033179 Ga0307507_10097718 Ga0307507_100977183 345
219 3300044656 Ga0466969_0007040 Ga0466969_0007040_4613_5701 345
220 3300044684 Ga0466966_0077671 Ga0466966_0077671_144_1229 345
221 3300044693 Ga0466961_0059058 Ga0466961_0059058_906_1991 345
222 3300044693 Ga0466961_0100732 Ga0466961_0100732_219_1307 345
223 3300044694 Ga0466963_0004391 Ga0466963_0004391_1510_2604 345
224 3300044842 Ga0466957_0023833 Ga0466957_0023833_1304_2398 345
225 3300044842 Ga0466957_0038842 Ga0466957_0038842_1377_2462 345
226 3300044842 Ga0466957_0159592 Ga0466957_0159592_185_1255 345
227 3300045049 Ga0466959_0014333 Ga0466959_0014333_90_1184 345
228 3300045049 Ga0466959_0021915 Ga0466959_0021915_1201_2289 345
229 3300045836 Ga0466958_0002788 Ga0466958_0002788_4103_5188 345
230 3300045836 Ga0466958_0124377 Ga0466958_0124377_301_1395 345
231 3300045836 Ga0466958_0172984 Ga0466958_0172984_194_1291 345
232 3300046459 Ga0495629_0033974 Ga0495629_0033974_2456_3556 345
233 3300046492 Ga0495585_0025692 Ga0495585_0025692_1490_2590 345
234 3300046522 Ga0495643_0003734 Ga0495643_0003734_4185_5285 345
235 3300046683 Ga0495658_0005981 Ga0495658_0005981_1111_2211 345
236 3300046691 Ga0495670_0002828 Ga0495670_0002828_4103_5203 345
237 3300047444 Ga0495675_0065917 Ga0495675_0065917_1062_2228 345
238 3300047447 Ga0495685_000351 Ga0495685_000351_9858_10958 345
239 3300047470 Ga0495681_0001621 Ga0495681_0001621_10671_11771 345
240 3300048915 Ga0496112_0047915 Ga0496112_0047915_2510_3568 345
241 3300048916 Ga0496113_0307086 Ga0496113_0307086_146_1204 345
242 3300050510 nmdc:mga06r32_92406_c1 nmdc:mga06r32_92406_c1_1295_2353 345
243 3300053131 Ga0500652_005067 Ga0500652_005067_815_1915 345
244 3300053134 Ga0500658_0034718 Ga0500658_0034718_106_1206 345
245 3300053137 Ga0500561_0000243 Ga0500561_0000243_5278_6378 345
246 3300053149 Ga0500600_0014647 Ga0500600_0014647_2077_3177 345
247 3300053153 Ga0500616_0020735 Ga0500616_0020735_1363_2463 345
248 3300053161 Ga0500634_0004375 Ga0500634_0004375_3041_4141 345
249 3300053739 Ga0500587_000876 Ga0500587_000876_2092_3192 345
250 iso_pu_bacteria 3006486233 3006490097 345
251 3300005334 Ga0068869_100002126 Ga0068869_1000021263 346
252 3300005344 Ga0070661_100079549 Ga0070661_1000795492 346
253 3300005347 Ga0070668_100058008 Ga0070668_1000580083 346
254 3300005366 Ga0070659_100032021 Ga0070659_1000320213 346
255 3300005441 Ga0070700_100039202 Ga0070700_1000392022 346
256 3300005444 Ga0070694_100169269 Ga0070694_1001692692 346
257 3300005455 Ga0070663_100005157 Ga0070663_1000051573 346
258 3300005564 Ga0070664_100002003 Ga0070664_10000200315 346
259 3300005577 Ga0068857_100007082 Ga0068857_1000070821 346
260 3300005615 Ga0070702_100032309 Ga0070702_1000323092 346
261 3300005616 Ga0068852_100017705 Ga0068852_1000177057 346
262 3300005719 Ga0068861_100255201 Ga0068861_1002552012 346
263 3300005841 Ga0068863_100217962 Ga0068863_1002179622 346
264 3300006880 Ga0075429_100163076 Ga0075429_1001630762 346
265 3300009094 Ga0111539_10007280 Ga0111539_1000728012 346
266 3300009098 Ga0105245_10005115 Ga0105245_100051158 346
267 3300009147 Ga0114129_10365672 Ga0114129_103656722 346
268 3300009174 Ga0105241_10256916 Ga0105241_102569161 346
269 3300009553 Ga0105249_10154512 Ga0105249_101545123 346
270 3300011119 Ga0105246_10086088 Ga0105246_100860882 346
271 3300013308 Ga0157375_10082418 Ga0157375_100824182 346
272 3300014745 Ga0157377_10073020 Ga0157377_100730202 346
273 3300025901 Ga0207688_10086214 Ga0207688_100862142 346
274 3300025920 Ga0207649_10064390 Ga0207649_100643903 346
275 3300025932 Ga0207690_10067532 Ga0207690_100675322 346
276 3300025933 Ga0207706_10036264 Ga0207706_100362642 346
277 3300025938 Ga0207704_10089712 Ga0207704_100897122 346
278 3300025942 Ga0207689_10022195 Ga0207689_100221953 346
279 3300025944 Ga0207661_10015365 Ga0207661_100153656 346
280 3300026075 Ga0207708_10072931 Ga0207708_100729312 346
281 3300026088 Ga0207641_10163598 Ga0207641_101635982 346
282 3300026116 Ga0207674_10009409 Ga0207674_1000940911 346
283 3300026118 Ga0207675_100315350 Ga0207675_1003153502 346
284 3300026142 Ga0207698_10036405 Ga0207698_100364052 346
285 3300027907 Ga0207428_10013705 Ga0207428_100137056 346
286 3300028381 Ga0268264_10175294 Ga0268264_101752942 346
287 3300028381 Ga0268264_10206752 Ga0268264_102067522 346
288 3300028786 Ga0307517_10079421 Ga0307517_100794213 346
289 3300031456 Ga0307513_10005478 Ga0307513_100054788 346
290 3300046460 Ga0495638_0124119 Ga0495638_0124119_170_1264 346
291 3300046514 Ga0495618_0005133 Ga0495618_0005133_1614_2684 346
292 3300046516 Ga0495628_0049832 Ga0495628_0049832_934_2004 346
293 3300050508 nmdc:mga09592_196295_c1 nmdc:mga09592_196295_c1_208_1257 346
294 3300050511 nmdc:mga08y16_4395_c1 nmdc:mga08y16_4395_c1_4442_5491 346
295 3300053077 Ga0495601_0000115 Ga0495601_0000115_21835_22905 346
296 3300053153 Ga0500616_0002017 Ga0500616_0002017_12058_13152 346
297 iso_pu_bacteria 2795385472 2795793531 346
298 3300009551 Ga0105238_10283535 Ga0105238_102835351 347
299 3300044683 Ga0466965_0003737 Ga0466965_0003737_1919_3001 347
300 3300005339 Ga0070660_100069203 Ga0070660_1000692032 348
301 3300005539 Ga0068853_100176917 Ga0068853_1001769171 348
302 3300005577 Ga0068857_100169169 Ga0068857_1001691692 348
303 3300005615 Ga0070702_100046848 Ga0070702_1000468482 348
304 3300009148 Ga0105243_10236952 Ga0105243_102369522 348
305 3300017792 Ga0163161_10048158 Ga0163161_100481583 348
306 3300025904 Ga0207647_10031238 Ga0207647_100312383 348
307 3300025919 Ga0207657_10077649 Ga0207657_100776492 348
308 3300026041 Ga0207639_10161432 Ga0207639_101614322 348
309 3300026116 Ga0207674_10219847 Ga0207674_102198472 348
310 3300026118 Ga0207675_100317602 Ga0207675_1003176022 348
311 3300038443 Ga0395901_0086659 Ga0395901_0086659_468_1550 348
312 3300049568 Ga0501031_0060821 Ga0501031_0060821_1041_2129 348
313 3300049585 Ga0501069_0002696 Ga0501069_0002696_2206_3306 350
314 3300061734 Ga0530510_0003375 Ga0530510_0003375_2646_3746 350
315 3300031731 Ga0307405_10203112 Ga0307405_102031122 352
316 3300053136 Ga0500559_0007246 Ga0500559_0007246_3577_4656 352
317 3300021388 Ga0213875_10005956 Ga0213875_100059565 355
318 3300031090 Ga0265760_10034563 Ga0265760_100345632 355
319 3300037853 Ga0436364_0667106 Ga0436364_0667106_1915_3042 355
320 3300049577 Ga0501041_0059288 Ga0501041_0059288_121_1263 355
321 3300049586 Ga0501070_0006970 Ga0501070_0006970_6862_8004 355
322 3300049587 Ga0501071_0004562 Ga0501071_0004562_5495_6637 355
323 3300049588 Ga0501072_0015317 Ga0501072_0015317_955_2097 355
324 3300049590 Ga0501074_0006682 Ga0501074_0006682_7099_8241 355
325 3300049592 Ga0501076_0031272 Ga0501076_0031272_1520_2662 355
326 3300049593 Ga0501077_0003951 Ga0501077_0003951_1297_2439 355
327 3300049741 Ga0501079_0032070 Ga0501079_0032070_1615_2757 355
328 3300049742 Ga0501080_0019885 Ga0501080_0019885_1682_2824 355
329 3300049824 Ga0501045_0019230 Ga0501045_0019230_1338_2480 355
330 3300054114 Ga0501084_0023827 Ga0501084_0023827_1717_2859 355
331 3300060353 Ga0501082_0055602 Ga0501082_0055602_998_2140 355
332 3300005468 Ga0070707_100001851 Ga0070707_10000185111 358
333 3300025922 Ga0207646_10004629 Ga0207646_100046294 358
334 3300013307 Ga0157372_10118330 Ga0157372_101183302 359
335 3300003320 rootH2_10025465 rootH2_100254655 366
336 3300003322 rootL2_10013363 rootL2_100133633 366
337 3300003323 rootH1_10122018 rootH1_101220185 366
338 3300005445 Ga0070708_100000958 Ga0070708_1000009581 366
339 3300049568 Ga0501031_0003814 Ga0501031_0003814_2177_3277 366
340 3300049568 Ga0501031_0076545 Ga0501031_0076545_49_1149 366
341 3300049570 Ga0501033_0007726 Ga0501033_0007726_941_2041 366
342 3300049572 Ga0501036_0025495 Ga0501036_0025495_2701_3801 366
343 3300049575 Ga0501039_0005216 Ga0501039_0005216_6139_7239 366
344 3300049575 Ga0501039_0028895 Ga0501039_0028895_1621_2721 366
345 3300049576 Ga0501040_0019953 Ga0501040_0019953_2440_3540 366
346 3300049577 Ga0501041_0009481 Ga0501041_0009481_2255_3355 366
347 3300049578 Ga0501042_0059478 Ga0501042_0059478_332_1432 366
348 3300049578 Ga0501042_0074080 Ga0501042_0074080_703_1803 366
349 3300049580 Ga0501046_0016069 Ga0501046_0016069_2168_3268 366
350 3300049580 Ga0501046_0070877 Ga0501046_0070877_1520_2635 366
351 3300049582 Ga0501048_0004844 Ga0501048_0004844_8263_9363 366
352 3300049582 Ga0501048_0181386 Ga0501048_0181386_326_1426 366
353 3300049583 Ga0501067_0140149 Ga0501067_0140149_148_1248 366
354 3300049584 Ga0501068_0026831 Ga0501068_0026831_2231_3331 366
355 3300049585 Ga0501069_0084630 Ga0501069_0084630_615_1715 366
356 3300049586 Ga0501070_0051821 Ga0501070_0051821_2225_3325 366
357 3300049587 Ga0501071_0022872 Ga0501071_0022872_459_1559 366
358 3300049587 Ga0501071_0029515 Ga0501071_0029515_2754_3854 366
359 3300049587 Ga0501071_0140223 Ga0501071_0140223_613_1713 366
360 3300049588 Ga0501072_0004131 Ga0501072_0004131_8658_9758 366
361 3300049589 Ga0501073_0030913 Ga0501073_0030913_1339_2439 366
362 3300049590 Ga0501074_0006901 Ga0501074_0006901_3455_4555 366
363 3300049590 Ga0501074_0015930 Ga0501074_0015930_1523_2623 366
364 3300049591 Ga0501075_0000994 Ga0501075_0000994_14836_15936 366
365 3300049591 Ga0501075_0014929 Ga0501075_0014929_1573_2673 366
366 3300049591 Ga0501075_0223608 Ga0501075_0223608_167_1267 366
367 3300049592 Ga0501076_0001042 Ga0501076_0001042_5368_6468 366
368 3300049592 Ga0501076_0003208 Ga0501076_0003208_5145_6245 366
369 3300049593 Ga0501077_0080800 Ga0501077_0080800_493_1593 366
370 3300049741 Ga0501079_0000612 Ga0501079_0000612_8281_9381 366
371 3300049741 Ga0501079_0009645 Ga0501079_0009645_2536_3636 366
372 3300049741 Ga0501079_0014878 Ga0501079_0014878_3216_4316 366
373 3300049742 Ga0501080_0064870 Ga0501080_0064870_1170_2270 366
374 3300049743 Ga0501081_0218659 Ga0501081_0218659_209_1309 366
375 3300049822 Ga0501035_0032571 Ga0501035_0032571_1508_2608 366
376 3300049824 Ga0501045_0043226 Ga0501045_0043226_203_1303 366
377 3300054114 Ga0501084_0006806 Ga0501084_0006806_1913_3013 366
378 3300054114 Ga0501084_0059516 Ga0501084_0059516_431_1531 366
379 3300060353 Ga0501082_0019475 Ga0501082_0019475_2373_3473 366
380 3300060353 Ga0501082_0062895 Ga0501082_0062895_1018_2118 366
381 3300061734 Ga0530510_0003082 Ga0530510_0003082_7576_8676 366
382 3300061734 Ga0530510_0013240 Ga0530510_0013240_2144_3244 366

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01408

GFO_IDH_MocA

Oxidoreductase family, NAD-binding Rossmann fold

25

144

0.96

PF22725

GFO_IDH_MocA_C3

GFO/IDH/MocA C-terminal domain

152

263

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
7bvk-assembly2.cif.gz_B udp-n-acetylglucosamine 3-dehydrogenase gnna from acidithiobacillus ferrooxidans (p212121) 0.927 6 337
7bvj-assembly3.cif.gz_C udp-n-acetylglucosamine 3-dehydrogenase gnna from acidithiobacillus ferrooxidans (p21) 0.9135 6 337
7bvk-assembly2.cif.gz_B udp-n-acetylglucosamine 3-dehydrogenase gnna from acidithiobacillus ferrooxidans (p212121) 0.9123 6 337
7bvj-assembly4.cif.gz_D udp-n-acetylglucosamine 3-dehydrogenase gnna from acidithiobacillus ferrooxidans (p21) 0.8997 4 332
7bvj-assembly3.cif.gz_C udp-n-acetylglucosamine 3-dehydrogenase gnna from acidithiobacillus ferrooxidans (p21) 0.8991 6 337
ID Description Score Start End Superfamily
3ezyC01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9583 5 122 3.40.50.720
af_Q2G1E6_2_122_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9565 5 120 3.40.50.720
af_P77503_5_146_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9546 2 139 3.40.50.720
af_P77503_10_129_3.30.360.10 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.9544 5 123 3.30.360.10
af_P39353_1_125_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9529 4 128 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A535DBZ8-F1-model_v4 Gfo/Idh/MocA family oxidoreductase 0.9718 4 148 GO:0000166
GO:0003824
AF-A0A7X6XPF4-F1-model_v4 Gfo/Idh/MocA family oxidoreductase 0.965 1 148 GO:0000166
AF-A0A7C2Z2A1-F1-model_v4 Gfo/Idh/MocA family oxidoreductase 0.9647 3 148 GO:0000166
AF-A0A2V8W3V3-F1-model_v4 Gfo/Idh/MocA-like oxidoreductase N-terminal domain-containing protein 0.9647 4 145 GO:0000166
AF-A0A3B8ZU63-F1-model_v4 deleted 0.9643 4 123

Feature Viewer

pLDDT pTM Quality
88.33 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map