F429201

General Info

Members Datasets Scaffolds Average Seq Length
382 262 321 139

Family's Representative Sequence

Representative Sequence 3300005444|Ga0070694_100842035|Ga0070694_1008420351
Length 155
Sequence MQSLKRPGRTAPKRQQAVLEPEPEGVESDALDGDEFXXXXTFEMYRVVCPDCAQPIALLADEEVLPEHALCASPWNPFGHTVCAGTGRSAYDALPADEAVQLQEQDTAVLLALPQQIDWRTQPFSHVGGPGSRPVRMPVLRHQAGPVRQSHRQAA

Samples

Sample ID Description Type Environment
1 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
2 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
3 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
4 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
5 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
6 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
7 2643221548 Streptomyces sp. Root55 Isolate Unclassified
8 2643221578 Streptomyces sp. Root63 Isolate Unclassified
9 2643221647 Streptomyces sp. Root369 Isolate Unclassified
10 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
11 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
12 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
13 2643221714 Streptomyces sp. Root264 Isolate Unclassified
14 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
15 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
16 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
17 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
18 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
19 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
20 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
21 2808606448 Streptomyces sp. 193411 Isolate Unclassified
22 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
23 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
24 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
25 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
26 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
27 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
28 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
29 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
30 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
31 2867428634 Streptomyces sp. RP5T Isolate Unclassified
32 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
33 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
34 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
35 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
36 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
37 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
38 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
39 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
40 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
41 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
42 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
43 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
44 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
45 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
46 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
47 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
48 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
49 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
50 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
51 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
52 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
53 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
54 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
55 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
56 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
57 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
58 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
59 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
60 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
61 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
62 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
63 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
64 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
65 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
66 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
67 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
68 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
69 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
70 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
71 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
72 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
73 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
74 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
75 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
76 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
81 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
82 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
83 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
84 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
85 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
86 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
88 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
100 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
101 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
102 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
103 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
104 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
105 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
106 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
107 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
108 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
109 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
110 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
111 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
112 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
113 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
114 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
115 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
116 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
117 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
118 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
119 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
120 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
121 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
122 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
123 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
124 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
125 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
126 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
127 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
128 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
129 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
130 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
131 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
132 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
133 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
134 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
135 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
136 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
137 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
138 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
139 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
140 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
141 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
142 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
143 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
144 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
145 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
146 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
147 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
148 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
149 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
150 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
151 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
152 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
153 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
154 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
155 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
156 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
157 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
158 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
159 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
160 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
161 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
162 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
163 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
164 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
165 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
166 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
167 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
168 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
169 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
170 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
171 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
172 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
173 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
174 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
175 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
176 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
177 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
178 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
179 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
180 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
181 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
182 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
183 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
184 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
185 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
186 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
187 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
188 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
189 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
190 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
191 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
192 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
193 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
194 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
195 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
196 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
197 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
198 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
199 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
200 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
201 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
202 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
203 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
204 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
205 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
206 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
207 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
208 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
209 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
210 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
211 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
212 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
213 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
214 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
215 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
216 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
217 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
218 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
219 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
222 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
233 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
234 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
235 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
236 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
237 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
239 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
240 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
241 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
242 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
243 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
244 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
245 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
246 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
247 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
248 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
249 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
250 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
251 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
252 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
253 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
254 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
255 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
256 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
257 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
258 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
259 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
260 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
261 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
262 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 82.98
Metatranscriptomes 0.79
Isolates 16.23

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.28
Nodule 0
Rhizoplane 2.36
Rhizosphere 74.61
Stem 0
Stem Tuber 0
Unclassified 16.75

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10029408 3300001990 Bacteria 1723
2 JGI25153J46596_10102942 3300003215 Bacteria 669
3 rootH1_10010165 3300003316 Bacteria 10979
4 rootH1_10010165 3300003323 Bacteria 3080
5 rootH1_10037835 3300003316 Bacteria 1645
6 rootH2_10001847 3300003320 Bacteria 6155
7 rootL2_10024049 3300003322 Bacteria 6516
8 rootH1_10059461 3300003323 Bacteria 2664
9 Ga0006562J51391_1048779 3300003578 Bacteria 2120
10 Ga0070668_101885317 3300005347 Bacteria 550
11 Ga0070675_101631995 3300005354 Bacteria 595
12 Ga0070694_100842035 3300005444 Bacteria 754
13 Ga0070698_101452039 3300005471 Bacteria 637
14 Ga0070699_101108447 3300005518 Bacteria 726
15 Ga0068853_100015317 3300005539 Bacteria 6301
16 Ga0068856_100294592 3300005614 Bacteria 1640
17 Ga0075368_10022176 3300006042 Bacteria 2416
18 Ga0075363_100004617 3300006048 Bacteria 6049
19 Ga0075363_100507346 3300006048 Bacteria 717
20 Ga0075367_10001282 3300006178 Bacteria 10633
21 Ga0075370_10310996 3300006353 Bacteria 938
22 Ga0075370_10429825 3300006353 Bacteria 794
23 Ga0105251_10054237 3300009011 Bacteria 1904
24 Ga0105250_10082320 3300009092 Bacteria 1305
25 Ga0105245_10157862 3300009098 Bacteria 2150
26 Ga0105237_11074613 3300009545 Bacteria 811
27 Ga0105239_10353548 3300010375 Bacteria 1659
28 Ga0105239_10450429 3300010375 Bacteria 1460
29 Ga0105246_10127023 3300011119 Bacteria 1899
30 Ga0157369_10122255 3300013105 Bacteria 2761
31 Ga0157372_10792822 3300013307 Bacteria 1101
32 Ga0182008_10005236 3300014497 Bacteria 7425
33 Ga0182007_10000166 3300015262 Bacteria 45125
34 Ga0183367_1017 3300015688 Bacteria 126691
35 Ga0206353_10038501 3300020082 Bacteria 533
36 Ga0209758_1003531 3300025297 Bacteria 14099
37 Ga0207713_1079091 3300025735 Bacteria 1188
38 Ga0207647_10002990 3300025904 Bacteria 12721
39 Ga0207685_10155011 3300025905 Bacteria 1040
40 Ga0207657_10558494 3300025919 Bacteria 895
41 Ga0207687_11657066 3300025927 Bacteria 548
42 Ga0207704_10387127 3300025938 Bacteria 1099
43 Ga0207665_10555468 3300025939 Bacteria 892
44 Ga0207689_10735365 3300025942 Bacteria 832
45 Ga0207668_10850636 3300025972 Bacteria 810
46 Ga0207639_10013752 3300026041 Bacteria 5674
47 Ga0207702_10212641 3300026078 Bacteria 1798
48 Ga0209371_1013614 3300027312 Bacteria 2272
49 Ga0209371_1037672 3300027312 Bacteria 1002
50 Ga0209813_10002835 3300027866 Bacteria 4010
51 Ga0307515_10071178 3300028794 Bacteria 4717
52 Ga0307515_10097943 3300028794 Bacteria 3577
53 Ga0268256_1014429 3300030500 Bacteria 2346
54 Ga0268256_1029277 3300030500 Bacteria 1349
55 Ga0307511_10000410 3300030521 Bacteria 45774
56 Ga0307511_10031122 3300030521 Bacteria 4773
57 Ga0307512_10002135 3300030522 Bacteria 25918
58 Ga0307512_10021907 3300030522 Bacteria 5753
59 Ga0307513_10052250 3300031456 Bacteria 4401
60 Ga0307513_10079761 3300031456 Bacteria 3380
61 Ga0307513_10226383 3300031456 Bacteria 1686
62 Ga0307509_10035707 3300031507 Bacteria 5453
63 Ga0307508_10004980 3300031616 Bacteria 12770
64 Ga0307508_10024914 3300031616 Bacteria 5427
65 Ga0307514_10015345 3300031649 Bacteria 6324
66 Ga0307514_10019522 3300031649 Bacteria 5544
67 Ga0307514_10151227 3300031649 Bacteria 1557
68 Ga0307514_10203473 3300031649 Bacteria 1240
69 Ga0307516_10015529 3300031730 Bacteria 8008
70 Ga0307516_10023689 3300031730 Bacteria 6284
71 Ga0307516_10712279 3300031730 Bacteria 661
72 Ga0307518_10068269 3300031838 Bacteria 2576
73 Ga0307507_10049007 3300033179 Bacteria 4101
74 Ga0307507_10059181 3300033179 Bacteria 3589
75 Ga0307507_10458599 3300033179 Bacteria 701
76 Ga0307510_10093106 3300033180 Bacteria 2847
77 Ga0307510_10111522 3300033180 Bacteria 2475
78 Ga0395900_0199454 3300037418 Bacteria 2026
79 Ga0395898_0027424 3300037466 Bacteria 5718
80 Ga0395898_0105803 3300037466 Bacteria 2698
81 Ga0395905_0187979 3300037471 Bacteria 1938
82 Ga0395901_0030488 3300038443 Bacteria 5556
83 Ga0395901_1013969 3300038443 Bacteria 805
84 Ga0439436_0000583 3300041404 Bacteria 9657
85 Ga0439436_0000997 3300041404 Bacteria 7881
86 Ga0439438_102361 3300041405 Bacteria 694
87 Ga0439439_0000687 3300041406 Bacteria 5985
88 Ga0451793_1896495 3300041452 Bacteria 891
89 Ga0451797_1529367 3300041453 Bacteria 1027
90 Ga0451807_1594700 3300041486 Bacteria 825
91 Ga0451835_0500453 3300041492 Bacteria 567
92 Ga0451837_0187976 3300041494 Bacteria 6350
93 Ga0451845_0792310 3300041501 Bacteria 1482
94 Ga0451851_0035687 3300041507 Bacteria 758
95 Ga0451853_0700350 3300041512 Bacteria 4229
96 Ga0451853_2703835 3300041512 Bacteria 531
97 Ga0439431_0102107 3300041997 Bacteria 789
98 Ga0439433_0007880 3300041999 Bacteria 2303
99 Ga0439433_0019501 3300041999 Bacteria 1511
100 Ga0439448_0003816 3300042005 Bacteria 4211
101 Ga0439449_0003613 3300042007 Bacteria 6003
102 Ga0439449_0023821 3300042007 Bacteria 2289
103 Ga0439449_0032425 3300042007 Bacteria 1947
104 Ga0439450_006102 3300042008 Bacteria 2154
105 Ga0439454_058648 3300042011 Bacteria 664
106 Ga0439455_0039158 3300042012 Bacteria 1208
107 Ga0439457_000025 3300042014 Bacteria 30691
108 Ga0439457_003276 3300042014 Bacteria 4433
109 Ga0439462_0003584 3300042015 Bacteria 3736
110 Ga0450903_000014 3300042138 Bacteria 34118
111 Ga0439458_0035109 3300042157 Bacteria 1204
112 Ga0466969_0051174 3300044656 Bacteria 2034
113 Ga0466969_0107440 3300044656 Bacteria 1308
114 Ga0466972_0002210 3300044658 Bacteria 9550
115 Ga0466972_0008905 3300044658 Bacteria 5034
116 Ga0466972_0228300 3300044658 Bacteria 871
117 Ga0466965_0005055 3300044683 Bacteria 5912
118 Ga0466965_0026957 3300044683 Bacteria 2787
119 Ga0466965_0262046 3300044683 Bacteria 929
120 Ga0466966_0004236 3300044684 Bacteria 9467
121 Ga0466966_0004668 3300044684 Bacteria 9023
122 Ga0466961_0017593 3300044693 Bacteria 4592
123 Ga0466961_0030943 3300044693 Bacteria 3439
124 Ga0466961_0107422 3300044693 Bacteria 1757
125 Ga0466963_0004562 3300044694 Bacteria 8067
126 Ga0466963_0005429 3300044694 Bacteria 7466
127 Ga0466964_0033162 3300044706 Bacteria 2056
128 Ga0466964_0114861 3300044706 Bacteria 1205
129 Ga0466971_0001764 3300044719 Bacteria 9177
130 Ga0466971_0067394 3300044719 Bacteria 1623
131 Ga0466968_0003972 3300044735 Bacteria 5493
132 Ga0466968_0058235 3300044735 Bacteria 1662
133 Ga0466968_0418813 3300044735 Bacteria 659
134 Ga0466970_0018170 3300044765 Bacteria 3638
135 Ga0466970_0340269 3300044765 Bacteria 850
136 Ga0466957_0004137 3300044842 Bacteria 8040
137 Ga0466957_0486323 3300044842 Bacteria 854
138 Ga0466960_0215963 3300044901 Bacteria 1053
139 Ga0466959_0000283 3300045049 Bacteria 30952
140 Ga0466959_0483858 3300045049 Bacteria 837
141 Ga0466958_0031577 3300045836 Bacteria 3148
142 Ga0466958_0122156 3300045836 Bacteria 1631
143 Ga0466958_0215653 3300045836 Bacteria 1224
144 Ga0466967_0003857 3300045976 Bacteria 9932
145 Ga0466967_0021072 3300045976 Bacteria 5282
146 Ga0466967_1417164 3300045976 Bacteria 692
147 Ga0466967_2565617 3300045976 Bacteria 504
148 Ga0495592_0009232 3300046454 Bacteria 7419
149 Ga0495592_0046405 3300046454 Bacteria 3238
150 Ga0495603_0000942 3300046455 Bacteria 16736
151 Ga0495603_0003385 3300046455 Bacteria 9496
152 Ga0495590_0055527 3300046457 Bacteria 1384
153 Ga0495629_0012169 3300046459 Bacteria 6234
154 Ga0495629_0016110 3300046459 Bacteria 5367
155 Ga0495629_0068111 3300046459 Bacteria 2484
156 Ga0495629_0220170 3300046459 Bacteria 1309
157 Ga0495651_0008570 3300046462 Bacteria 7836
158 Ga0495651_0174006 3300046462 Bacteria 1530
159 Ga0495582_0014848 3300046473 Bacteria 4280
160 Ga0495582_0132458 3300046473 Bacteria 1409
161 Ga0495662_0005014 3300046476 Bacteria 6632
162 Ga0495662_0017220 3300046476 Bacteria 3498
163 Ga0495662_0090884 3300046476 Bacteria 1488
164 Ga0495664_0000301 3300046477 Bacteria 23691
165 Ga0495594_0016258 3300046499 Bacteria 3918
166 Ga0495583_0091334 3300046506 Bacteria 1310
167 Ga0495608_0049507 3300046511 Bacteria 2790
168 Ga0495616_0205189 3300046513 Bacteria 864
169 Ga0495618_0031609 3300046514 Bacteria 3312
170 Ga0495618_0036790 3300046514 Bacteria 3072
171 Ga0495620_0152272 3300046515 Bacteria 901
172 Ga0495628_0031735 3300046516 Bacteria 4272
173 Ga0495628_0039255 3300046516 Bacteria 3787
174 Ga0495630_0079348 3300046517 Bacteria 2476
175 Ga0495630_0202255 3300046517 Bacteria 1516
176 Ga0495643_0001437 3300046522 Bacteria 21986
177 Ga0495652_0010908 3300046529 Bacteria 8232
178 Ga0495652_0033350 3300046529 Bacteria 4495
179 Ga0495665_0219570 3300046531 Bacteria 983
180 Ga0495640_0144995 3300046533 Bacteria 1528
181 Ga0495640_0306990 3300046533 Bacteria 984
182 Ga0495586_0157558 3300046535 Bacteria 1279
183 Ga0495586_0664572 3300046535 Bacteria 602
184 Ga0495587_0001666 3300046536 Bacteria 14832
185 Ga0495645_0036477 3300046543 Bacteria 3583
186 Ga0495645_0081200 3300046543 Bacteria 2326
187 Ga0495622_0046908 3300046557 Bacteria 2008
188 Ga0495622_0107863 3300046557 Bacteria 1275
189 Ga0495667_0188789 3300046559 Bacteria 1321
190 Ga0495667_0247242 3300046559 Bacteria 1135
191 Ga0495668_0018994 3300046616 Bacteria 3968
192 Ga0495634_0004945 3300046642 Bacteria 10302
193 Ga0495625_0059556 3300046660 Bacteria 2709
194 Ga0495635_0000756 3300046663 Bacteria 20996
195 Ga0495635_0013790 3300046663 Bacteria 5653
196 Ga0495635_0353301 3300046663 Bacteria 980
197 Ga0495588_0005319 3300046674 Bacteria 5725
198 Ga0495588_0024028 3300046674 Bacteria 3024
199 Ga0495657_0001171 3300046675 Bacteria 22959
200 Ga0495657_0003160 3300046675 Bacteria 13581
201 Ga0495599_0151551 3300046678 Bacteria 1436
202 Ga0495599_0380374 3300046678 Bacteria 843
203 Ga0495646_0003059 3300046680 Bacteria 10365
204 Ga0495658_0010941 3300046683 Bacteria 4549
205 Ga0495613_0004281 3300046689 Bacteria 10691
206 Ga0495613_0096552 3300046689 Bacteria 2137
207 Ga0495613_0238418 3300046689 Bacteria 1272
208 Ga0495613_0403162 3300046689 Bacteria 932
209 Ga0495624_0085503 3300046690 Bacteria 1948
210 Ga0495670_0539435 3300046691 Bacteria 634
211 Ga0495649_0030485 3300046694 Bacteria 2979
212 Ga0495589_0023694 3300046794 Bacteria 3125
213 Ga0495589_0036002 3300046794 Bacteria 2481
214 Ga0495589_0149921 3300046794 Bacteria 1114
215 Ga0495600_0010066 3300046809 Bacteria 5861
216 Ga0495660_0413153 3300046810 Bacteria 589
217 Ga0495581_0010746 3300047315 Bacteria 5292
218 Ga0495581_0181464 3300047315 Bacteria 1231
219 Ga0495581_0195733 3300047315 Bacteria 1182
220 Ga0495604_0000295 3300047317 Bacteria 44674
221 Ga0495604_0056872 3300047317 Bacteria 3008
222 Ga0495636_0010559 3300047318 Bacteria 3648
223 Ga0495636_0049555 3300047318 Bacteria 1756
224 Ga0495674_0095208 3300047319 Bacteria 2539
225 Ga0495674_0538720 3300047319 Bacteria 930
226 Ga0495672_0532393 3300047320 Bacteria 518
227 Ga0495676_0006334 3300047321 Bacteria 10899
228 Ga0495680_0048603 3300047322 Bacteria 3330
229 Ga0495683_0141937 3300047323 Bacteria 1125
230 Ga0495687_008131 3300047443 Bacteria 6052
231 Ga0495687_009032 3300047443 Bacteria 5621
232 Ga0495687_041080 3300047443 Bacteria 2032
233 Ga0495687_102016 3300047443 Bacteria 1074
234 Ga0495687_131443 3300047443 Bacteria 885
235 Ga0495675_0044406 3300047444 Bacteria 2831
236 Ga0495675_0059186 3300047444 Bacteria 2429
237 Ga0495675_0155155 3300047444 Bacteria 1412
238 Ga0495685_004326 3300047447 Bacteria 4580
239 Ga0495685_007526 3300047447 Bacteria 3598
240 Ga0495685_010152 3300047447 Bacteria 3156
241 Ga0495685_014898 3300047447 Bacteria 2646
242 Ga0495681_0112638 3300047470 Bacteria 1176
243 Ga0495684_0018676 3300047471 Bacteria 5342
244 Ga0495684_0118201 3300047471 Bacteria 1998
245 Ga0495686_0127852 3300047472 Bacteria 1509
246 Ga0495593_0033948 3300047673 Bacteria 2776
247 Ga0495602_0011902 3300048088 Bacteria 8975
248 Ga0495614_0026864 3300048089 Bacteria 2481
249 Ga0495614_0184736 3300048089 Bacteria 939
250 Ga0496100_1000876 3300048903 Bacteria 658
251 Ga0496104_1568809 3300048907 Bacteria 561
252 Ga0496108_0436028 3300048911 Bacteria 1144
253 Ga0496109_0688890 3300048912 Bacteria 959
254 Ga0496110_0565638 3300048913 Bacteria 1033
255 Ga0496115_0482704 3300048918 Bacteria 998
256 Ga0501308_021456 3300049128 Bacteria 811
257 Ga0501031_0113408 3300049568 Bacteria 1770
258 Ga0501031_0260112 3300049568 Bacteria 1128
259 Ga0501032_0002891 3300049569 Bacteria 13354
260 Ga0501033_0008834 3300049570 Bacteria 7781
261 Ga0501033_0115717 3300049570 Bacteria 1948
262 Ga0501033_0228239 3300049570 Bacteria 1323
263 Ga0501033_0786128 3300049570 Bacteria 644
264 Ga0501034_0011530 3300049571 Bacteria 9158
265 Ga0501034_0155551 3300049571 Bacteria 2260
266 Ga0501034_0258621 3300049571 Bacteria 1684
267 Ga0501036_0005689 3300049572 Bacteria 10114
268 Ga0501036_0604481 3300049572 Bacteria 909
269 Ga0501037_0128462 3300049573 Bacteria 1818
270 Ga0501037_0161947 3300049573 Bacteria 1594
271 Ga0501038_0005910 3300049574 Bacteria 11311
272 Ga0501038_0007190 3300049574 Bacteria 10291
273 Ga0501038_0119426 3300049574 Bacteria 2176
274 Ga0501039_0432152 3300049575 Bacteria 1034
275 Ga0501042_0117980 3300049578 Bacteria 1910
276 Ga0501043_0032911 3300049579 Bacteria 4078
277 Ga0501043_0277971 3300049579 Bacteria 1284
278 Ga0501046_0016608 3300049580 Bacteria 6160
279 Ga0501046_0098273 3300049580 Bacteria 2248
280 Ga0501046_0233355 3300049580 Bacteria 1358
281 Ga0501047_0024449 3300049581 Bacteria 5796
282 Ga0501047_0083419 3300049581 Bacteria 3071
283 Ga0501047_0095634 3300049581 Bacteria 2849
284 Ga0501047_0330127 3300049581 Bacteria 1364
285 Ga0501048_0007895 3300049582 Bacteria 8059
286 Ga0501048_0026985 3300049582 Bacteria 4178
287 Ga0501069_0164623 3300049585 Bacteria 1278
288 Ga0501070_0310201 3300049586 Bacteria 1284
289 Ga0501070_0439261 3300049586 Bacteria 1053
290 Ga0501070_0561722 3300049586 Bacteria 913
291 Ga0501074_1028963 3300049590 Bacteria 579
292 Ga0501080_0429255 3300049742 Bacteria 1186
293 Ga0501280_104261 3300049776 Bacteria 548
294 Ga0501035_0076768 3300049822 Bacteria 2954
295 Ga0501035_0226998 3300049822 Bacteria 1592
296 Ga0501035_0527472 3300049822 Bacteria 969
297 Ga0501044_0000851 3300049823 Bacteria 36685
298 Ga0501044_0006572 3300049823 Bacteria 12839
299 Ga0501044_0064128 3300049823 Bacteria 3751
300 Ga0501044_0076442 3300049823 Bacteria 3398
301 Ga0501044_0086149 3300049823 Bacteria 3173
302 nmdc:mga03n38_8682_c1 3300050490 Bacteria 3659
303 nmdc:mga0yw44_132597_c1 3300050492 Bacteria 1614
304 nmdc:mga0yw44_730698_c1 3300050492 Bacteria 672
305 nmdc:mga06z11_4065_c1 3300050494 Bacteria 5718
306 nmdc:mga04h51_5148_c1 3300050495 Bacteria 3315
307 nmdc:mga07m45_419671_c1 3300050496 Bacteria 776
308 Ga0495655_0003008 3300053083 Bacteria 2735
309 Ga0495619_0104307 3300053085 Bacteria 1932
310 Ga0500578_0465211 3300053086 Bacteria 717
311 Ga0500640_004220 3300053095 Bacteria 5185
312 Ga0500650_0071471 3300053098 Bacteria 1622
313 Ga0500553_060491 3300053101 Bacteria 1780
314 Ga0500572_010380 3300053111 Bacteria 2226
315 Ga0500608_176692 3300053122 Bacteria 909
316 Ga0500618_082171 3300053125 Bacteria 723
317 Ga0500603_312249 3300053150 Bacteria 510
318 Ga0500624_004956 3300053157 Bacteria 1761
319 Ga0501082_0202145 3300060353 Bacteria 1729
320 Ga0466962_0007974 3300061719 Bacteria 5080
321 Ga0466962_0008195 3300061719 Bacteria 5013

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049571 Ga0501034_0258621 Ga0501034_0258621_1132_1572 108
2 iso_pu_bacteria 2554235005 2554259616 117
3 3300050492 nmdc:mga0yw44_730698_c1 nmdc:mga0yw44_730698_c1_198_575 125
4 3300048907 Ga0496104_1568809 Ga0496104_1568809_136_519 126
5 iso_pu_bacteria 2616644941 2616906181 126
6 3300044693 Ga0466961_0107422 Ga0466961_0107422_843_1277 127
7 3300044842 Ga0466957_0486323 Ga0466957_0486323_46_480 127
8 3300045836 Ga0466958_0122156 Ga0466958_0122156_544_978 127
9 3300061719 Ga0466962_0008195 Ga0466962_0008195_4206_4640 127
10 iso_pu_bacteria 2643221548 2643760305 127
11 iso_pu_bacteria 2643221578 2643904420 127
12 iso_pu_bacteria 2643221673 2644406312 127
13 iso_pu_bacteria 2643221682 2644459999 127
14 iso_pu_bacteria 2875391855 2875392626 127
15 iso_pu_bacteria 2912757875 2912758767 127
16 iso_pu_bacteria 2946045630 2946052090 127
17 iso_pu_bacteria 8025530807 8025535393 127
18 3300041452 Ga0451793_1896495 Ga0451793_1896495_182_571 128
19 3300041486 Ga0451807_1594700 Ga0451807_1594700_329_721 128
20 3300041492 Ga0451835_0500453 Ga0451835_0500453_16_480 128
21 3300041507 Ga0451851_0035687 Ga0451851_0035687_77_514 128
22 3300041512 Ga0451853_0700350 Ga0451853_0700350_1738_2202 128
23 3300044719 Ga0466971_0067394 Ga0466971_0067394_227_661 128
24 3300046457 Ga0495590_0055527 Ga0495590_0055527_832_1269 128
25 3300046513 Ga0495616_0205189 Ga0495616_0205189_116_553 128
26 3300046522 Ga0495643_0001437 Ga0495643_0001437_9798_10235 128
27 3300046616 Ga0495668_0018994 Ga0495668_0018994_3415_3852 128
28 3300046694 Ga0495649_0030485 Ga0495649_0030485_820_1230 128
29 3300046794 Ga0495589_0023694 Ga0495589_0023694_1961_2398 128
30 3300047443 Ga0495687_041080 Ga0495687_041080_203_640 128
31 3300047443 Ga0495687_102016 Ga0495687_102016_260_670 128
32 3300050492 nmdc:mga0yw44_132597_c1 nmdc:mga0yw44_132597_c1_1183_1575 128
33 3300033179 Ga0307507_10059181 Ga0307507_100591813 129
34 3300046454 Ga0495592_0009232 Ga0495592_0009232_3540_3974 129
35 3300046459 Ga0495629_0016110 Ga0495629_0016110_48_482 129
36 3300046462 Ga0495651_0008570 Ga0495651_0008570_4896_5330 129
37 3300046473 Ga0495582_0014848 Ga0495582_0014848_1895_2329 129
38 3300046476 Ga0495662_0005014 Ga0495662_0005014_3522_3956 129
39 3300046477 Ga0495664_0000301 Ga0495664_0000301_8939_9373 129
40 3300046514 Ga0495618_0031609 Ga0495618_0031609_848_1282 129
41 3300046515 Ga0495620_0152272 Ga0495620_0152272_141_581 129
42 3300046516 Ga0495628_0031735 Ga0495628_0031735_2901_3335 129
43 3300046517 Ga0495630_0079348 Ga0495630_0079348_462_896 129
44 3300046529 Ga0495652_0010908 Ga0495652_0010908_4599_5033 129
45 3300046533 Ga0495640_0144995 Ga0495640_0144995_750_1184 129
46 3300046535 Ga0495586_0157558 Ga0495586_0157558_641_1075 129
47 3300046536 Ga0495587_0001666 Ga0495587_0001666_6612_7046 129
48 3300046543 Ga0495645_0036477 Ga0495645_0036477_1238_1672 129
49 3300046557 Ga0495622_0107863 Ga0495622_0107863_58_492 129
50 3300046559 Ga0495667_0188789 Ga0495667_0188789_441_875 129
51 3300046642 Ga0495634_0004945 Ga0495634_0004945_5402_5836 129
52 3300046663 Ga0495635_0000756 Ga0495635_0000756_16192_16626 129
53 3300046675 Ga0495657_0001171 Ga0495657_0001171_17640_18074 129
54 3300046678 Ga0495599_0380374 Ga0495599_0380374_282_716 129
55 3300046680 Ga0495646_0003059 Ga0495646_0003059_8844_9278 129
56 3300046683 Ga0495658_0010941 Ga0495658_0010941_2412_2846 129
57 3300046689 Ga0495613_0004281 Ga0495613_0004281_4890_5324 129
58 3300046809 Ga0495600_0010066 Ga0495600_0010066_1644_2078 129
59 3300046810 Ga0495660_0413153 Ga0495660_0413153_62_502 129
60 3300047315 Ga0495581_0010746 Ga0495581_0010746_3758_4192 129
61 3300047317 Ga0495604_0000295 Ga0495604_0000295_43930_44364 129
62 3300047319 Ga0495674_0095208 Ga0495674_0095208_821_1255 129
63 3300047321 Ga0495676_0006334 Ga0495676_0006334_4819_5253 129
64 3300047444 Ga0495675_0044406 Ga0495675_0044406_22_456 129
65 3300047447 Ga0495685_004326 Ga0495685_004326_3099_3539 129
66 3300047471 Ga0495684_0018676 Ga0495684_0018676_387_821 129
67 3300047673 Ga0495593_0033948 Ga0495593_0033948_1429_1863 129
68 3300048088 Ga0495602_0011902 Ga0495602_0011902_2990_3424 129
69 3300048089 Ga0495614_0026864 Ga0495614_0026864_144_578 129
70 3300049570 Ga0501033_0008834 Ga0501033_0008834_1077_1511 129
71 3300049822 Ga0501035_0527472 Ga0501035_0527472_180_614 129
72 3300053085 Ga0495619_0104307 Ga0495619_0104307_83_517 129
73 3300053095 Ga0500640_004220 Ga0500640_004220_2428_2862 129
74 3300053101 Ga0500553_060491 Ga0500553_060491_884_1318 129
75 3300053111 Ga0500572_010380 Ga0500572_010380_112_546 129
76 3300053122 Ga0500608_176692 Ga0500608_176692_64_498 129
77 3300053125 Ga0500618_082171 Ga0500618_082171_93_527 129
78 3300053150 Ga0500603_312249 Ga0500603_312249_35_469 129
79 3300053157 Ga0500624_004956 Ga0500624_004956_1269_1703 129
80 iso_pu_bacteria 2808606982 2811846892 129
81 iso_pu_bacteria 2818991463 2819699811 129
82 3300003578 Ga0006562J51391_1048779 Ga0006562J51391_10487792 130
83 3300046794 Ga0495589_0036002 Ga0495589_0036002_13_453 130
84 3300047444 Ga0495675_0155155 Ga0495675_0155155_945_1379 130
85 3300033179 Ga0307507_10458599 Ga0307507_104585991 131
86 3300037466 Ga0395898_0027424 Ga0395898_0027424_4998_5432 131
87 3300037471 Ga0395905_0187979 Ga0395905_0187979_655_1089 131
88 3300038443 Ga0395901_0030488 Ga0395901_0030488_4917_5351 131
89 3300046543 Ga0495645_0081200 Ga0495645_0081200_1047_1481 131
90 3300031730 Ga0307516_10015529 Ga0307516_100155298 132
91 3300031838 Ga0307518_10068269 Ga0307518_100682692 132
92 3300046455 Ga0495603_0003385 Ga0495603_0003385_3699_4100 132
93 3300046459 Ga0495629_0068111 Ga0495629_0068111_124_525 132
94 3300046674 Ga0495588_0024028 Ga0495588_0024028_625_1026 132
95 3300047443 Ga0495687_009032 Ga0495687_009032_306_740 132
96 3300048913 Ga0496110_0565638 Ga0496110_0565638_504_938 132
97 3300053098 Ga0500650_0071471 Ga0500650_0071471_402_836 132
98 3300003316 rootH1_10010165 rootH1_100101653 133
99 3300003320 rootH2_10001847 rootH2_100018477 133
100 3300003322 rootL2_10024049 rootL2_100240493 133
101 3300003323 rootH1_10059461 rootH1_100594613 133
102 3300005471 Ga0070698_101452039 Ga0070698_1014520392 133
103 3300005518 Ga0070699_101108447 Ga0070699_1011084472 133
104 3300030521 Ga0307511_10000410 Ga0307511_1000041013 133
105 3300031507 Ga0307509_10035707 Ga0307509_100357074 133
106 3300033180 Ga0307510_10111522 Ga0307510_101115222 133
107 3300053086 Ga0500578_0465211 Ga0500578_0465211_31_468 133
108 3300042007 Ga0439449_0023821 Ga0439449_0023821_1124_1531 134
109 3300044656 Ga0466969_0107440 Ga0466969_0107440_360_776 134
110 3300044658 Ga0466972_0008905 Ga0466972_0008905_500_916 134
111 3300044683 Ga0466965_0005055 Ga0466965_0005055_4427_4843 134
112 3300044684 Ga0466966_0004236 Ga0466966_0004236_2639_3055 134
113 3300044693 Ga0466961_0030943 Ga0466961_0030943_185_601 134
114 3300044694 Ga0466963_0004562 Ga0466963_0004562_2677_3093 134
115 3300044706 Ga0466964_0114861 Ga0466964_0114861_575_991 134
116 3300044719 Ga0466971_0001764 Ga0466971_0001764_4798_5214 134
117 3300044735 Ga0466968_0058235 Ga0466968_0058235_232_648 134
118 3300044765 Ga0466970_0018170 Ga0466970_0018170_1326_1742 134
119 3300044842 Ga0466957_0004137 Ga0466957_0004137_4989_5405 134
120 3300044901 Ga0466960_0215963 Ga0466960_0215963_442_858 134
121 3300045049 Ga0466959_0000283 Ga0466959_0000283_1663_2079 134
122 3300045836 Ga0466958_0031577 Ga0466958_0031577_185_601 134
123 3300045976 Ga0466967_0003857 Ga0466967_0003857_6906_7322 134
124 3300045976 Ga0466967_1417164 Ga0466967_1417164_243_659 134
125 3300046689 Ga0495613_0096552 Ga0495613_0096552_1660_2097 134
126 3300049568 Ga0501031_0260112 Ga0501031_0260112_429_854 134
127 3300049570 Ga0501033_0786128 Ga0501033_0786128_43_468 134
128 3300049572 Ga0501036_0005689 Ga0501036_0005689_4705_5112 134
129 3300049573 Ga0501037_0128462 Ga0501037_0128462_358_783 134
130 3300049579 Ga0501043_0277971 Ga0501043_0277971_747_1172 134
131 3300049580 Ga0501046_0016608 Ga0501046_0016608_3388_3813 134
132 3300049581 Ga0501047_0024449 Ga0501047_0024449_2187_2612 134
133 3300049586 Ga0501070_0439261 Ga0501070_0439261_335_742 134
134 3300049823 Ga0501044_0076442 Ga0501044_0076442_342_767 134
135 3300061719 Ga0466962_0007974 Ga0466962_0007974_2640_3056 134
136 iso_pu_bacteria 3006425503 3006429276 134
137 3300049570 Ga0501033_0228239 Ga0501033_0228239_776_1207 136
138 3300049574 Ga0501038_0119426 Ga0501038_0119426_1168_1599 136
139 iso_pu_bacteria 2862290372 2862292387 136
140 3300005539 Ga0068853_100015317 Ga0068853_1000153173 137
141 3300010375 Ga0105239_10450429 Ga0105239_104504293 137
142 3300026041 Ga0207639_10013752 Ga0207639_100137524 137
143 3300046454 Ga0495592_0046405 Ga0495592_0046405_1207_1644 137
144 3300046462 Ga0495651_0174006 Ga0495651_0174006_673_1110 137
145 3300046511 Ga0495608_0049507 Ga0495608_0049507_877_1314 137
146 3300046514 Ga0495618_0036790 Ga0495618_0036790_1182_1619 137
147 3300046516 Ga0495628_0039255 Ga0495628_0039255_3223_3660 137
148 3300046529 Ga0495652_0033350 Ga0495652_0033350_953_1390 137
149 3300046531 Ga0495665_0219570 Ga0495665_0219570_341_778 137
150 3300046533 Ga0495640_0306990 Ga0495640_0306990_437_874 137
151 3300046535 Ga0495586_0664572 Ga0495586_0664572_101_538 137
152 3300046559 Ga0495667_0247242 Ga0495667_0247242_433_870 137
153 3300046663 Ga0495635_0013790 Ga0495635_0013790_3056_3493 137
154 3300046678 Ga0495599_0151551 Ga0495599_0151551_582_1019 137
155 3300046690 Ga0495624_0085503 Ga0495624_0085503_285_722 137
156 3300047315 Ga0495581_0195733 Ga0495581_0195733_596_1033 137
157 3300047317 Ga0495604_0056872 Ga0495604_0056872_2027_2464 137
158 3300047319 Ga0495674_0538720 Ga0495674_0538720_55_492 137
159 3300047320 Ga0495672_0532393 Ga0495672_0532393_65_502 137
160 3300047322 Ga0495680_0048603 Ga0495680_0048603_2399_2836 137
161 3300047443 Ga0495687_131443 Ga0495687_131443_392_829 137
162 3300047444 Ga0495675_0059186 Ga0495675_0059186_1255_1692 137
163 3300047471 Ga0495684_0118201 Ga0495684_0118201_246_683 137
164 iso_pu_bacteria 2784746763 2785345813 137
165 iso_pu_bacteria 2802429296 2804843659 137
166 iso_pu_bacteria 2863404153 2863407046 137
167 iso_pu_bacteria 2990059506 2990059654 137
168 iso_pu_bacteria 8025413630 8025414882 137
169 iso_pu_bacteria 8048406513 8048408093 137
170 3300028794 Ga0307515_10097943 Ga0307515_100979433 138
171 3300048903 Ga0496100_1000876 Ga0496100_1000876_112_546 138
172 3300048918 Ga0496115_0482704 Ga0496115_0482704_545_979 138
173 3300031456 Ga0307513_10052250 Ga0307513_100522502 139
174 3300031649 Ga0307514_10151227 Ga0307514_101512272 139
175 iso_pu_bacteria 2784746768 2785367074 139
176 iso_pu_bacteria 2786546132 2786668113 139
177 iso_pu_bacteria 2877676314 2877683472 139
178 iso_pu_bacteria 2947224130 2947231909 139
179 iso_pu_bacteria 2954673503 2954674401 139
180 iso_pu_bacteria 2954682443 2954689730 139
181 3300003316 rootH1_10037835 rootH1_100378352 140
182 3300037466 Ga0395898_0105803 Ga0395898_0105803_911_1348 140
183 iso_pu_bacteria 2547132111 2547406455 140
184 iso_pu_bacteria 2582581313 2585303448 140
185 iso_pu_bacteria 2582581314 2585316921 140
186 iso_pu_bacteria 2616644814 2616695534 140
187 iso_pu_bacteria 2643221647 2644267941 140
188 iso_pu_bacteria 2643221678 2644443616 140
189 iso_pu_bacteria 2643221714 2644632455 140
190 iso_pu_bacteria 2784132148 2784586677 140
191 iso_pu_bacteria 2808606359 2808847579 140
192 iso_pu_bacteria 2808606375 2808918311 140
193 iso_pu_bacteria 2808606448 2809230207 140
194 iso_pu_bacteria 2811994879 2812360388 140
195 iso_pu_bacteria 2811994917 2812482487 140
196 iso_pu_bacteria 2852635781 2852637641 140
197 iso_pu_bacteria 2862281513 2862289740 140
198 iso_pu_bacteria 2862507626 2862510350 140
199 iso_pu_bacteria 2867428634 2867436090 140
200 iso_pu_bacteria 2912715099 2912722578 140
201 iso_pu_bacteria 2912723979 2912726264 140
202 iso_pu_bacteria 2946064051 2946065501 140
203 iso_pu_bacteria 2946072368 2946073855 140
204 iso_pu_bacteria 2954002825 2954011151 140
205 iso_pu_bacteria 2954380949 2954388725 140
206 iso_pu_bacteria 2954691527 2954699513 140
207 iso_pu_bacteria 2954701450 2954702705 140
208 iso_pu_bacteria 2954711539 2954718452 140
209 iso_pu_bacteria 2954721474 2954728422 140
210 iso_pu_bacteria 2954731030 2954733387 140
211 iso_pu_bacteria 2954740390 2954747318 140
212 iso_pu_bacteria 2954749733 2954752270 140
213 iso_pu_bacteria 2954759201 2954766433 140
214 iso_pu_bacteria 3006393351 3006399519 140
215 iso_pu_bacteria 3006493962 3006495078 140
216 iso_pu_bacteria 8008574985 8008580822 140
217 iso_pu_bacteria 8023623736 8023625323 140
218 iso_pu_bacteria 8056829672 8056835789 140
219 3300003215 JGI25153J46596_10102942 JGI25153J46596_101029421 141
220 3300025297 Ga0209758_1003531 Ga0209758_10035317 141
221 3300025939 Ga0207665_10555468 Ga0207665_105554681 141
222 3300041404 Ga0439436_0000583 Ga0439436_0000583_1078_1503 141
223 3300041999 Ga0439433_0019501 Ga0439433_0019501_566_991 141
224 3300042007 Ga0439449_0032425 Ga0439449_0032425_717_1142 141
225 3300042014 Ga0439457_000025 Ga0439457_000025_5744_6169 141
226 3300044656 Ga0466969_0051174 Ga0466969_0051174_376_804 141
227 3300044658 Ga0466972_0002210 Ga0466972_0002210_5045_5473 141
228 3300044683 Ga0466965_0026957 Ga0466965_0026957_2069_2497 141
229 3300044684 Ga0466966_0004668 Ga0466966_0004668_2462_2890 141
230 3300044693 Ga0466961_0017593 Ga0466961_0017593_2193_2621 141
231 3300044694 Ga0466963_0005429 Ga0466963_0005429_877_1302 141
232 3300044735 Ga0466968_0003972 Ga0466968_0003972_3386_3814 141
233 3300044735 Ga0466968_0418813 Ga0466968_0418813_153_578 141
234 3300044765 Ga0466970_0340269 Ga0466970_0340269_111_539 141
235 3300045049 Ga0466959_0483858 Ga0466959_0483858_277_705 141
236 3300049128 Ga0501308_021456 Ga0501308_021456_34_459 141
237 3300049569 Ga0501032_0002891 Ga0501032_0002891_8949_9374 141
238 3300049570 Ga0501033_0115717 Ga0501033_0115717_920_1345 141
239 3300049571 Ga0501034_0011530 Ga0501034_0011530_4202_4627 141
240 3300049573 Ga0501037_0161947 Ga0501037_0161947_628_1053 141
241 3300049574 Ga0501038_0007190 Ga0501038_0007190_7937_8362 141
242 3300049578 Ga0501042_0117980 Ga0501042_0117980_858_1283 141
243 3300049580 Ga0501046_0233355 Ga0501046_0233355_324_749 141
244 3300049581 Ga0501047_0083419 Ga0501047_0083419_442_867 141
245 3300049582 Ga0501048_0007895 Ga0501048_0007895_3199_3624 141
246 3300049776 Ga0501280_104261 Ga0501280_104261_34_459 141
247 3300049822 Ga0501035_0076768 Ga0501035_0076768_738_1163 141
248 3300049823 Ga0501044_0064128 Ga0501044_0064128_2661_3086 141
249 3300060353 Ga0501082_0202145 Ga0501082_0202145_314_739 141
250 3300028794 Ga0307515_10071178 Ga0307515_100711783 142
251 3300030522 Ga0307512_10021907 Ga0307512_100219072 142
252 3300031456 Ga0307513_10226383 Ga0307513_102263832 142
253 3300031649 Ga0307514_10015345 Ga0307514_100153455 142
254 3300031649 Ga0307514_10203473 Ga0307514_102034732 142
255 3300044683 Ga0466965_0262046 Ga0466965_0262046_198_626 142
256 3300046660 Ga0495625_0059556 Ga0495625_0059556_391_819 142
257 3300006042 Ga0075368_10022176 Ga0075368_100221761 143
258 3300006178 Ga0075367_10001282 Ga0075367_100012824 143
259 3300009011 Ga0105251_10054237 Ga0105251_100542372 143
260 3300009092 Ga0105250_10082320 Ga0105250_100823202 143
261 3300009098 Ga0105245_10157862 Ga0105245_101578622 143
262 3300014497 Ga0182008_10005236 Ga0182008_100052365 143
263 3300015262 Ga0182007_10000166 Ga0182007_1000016632 143
264 3300025735 Ga0207713_1079091 Ga0207713_10790911 143
265 3300025927 Ga0207687_11657066 Ga0207687_116570661 143
266 3300027312 Ga0209371_1013614 Ga0209371_10136142 143
267 3300027866 Ga0209813_10002835 Ga0209813_100028353 143
268 3300030500 Ga0268256_1014429 Ga0268256_10144292 143
269 3300041404 Ga0439436_0000997 Ga0439436_0000997_5009_5440 143
270 3300041405 Ga0439438_102361 Ga0439438_102361_133_564 143
271 3300041406 Ga0439439_0000687 Ga0439439_0000687_2918_3349 143
272 3300041512 Ga0451853_2703835 Ga0451853_2703835_44_478 143
273 3300041997 Ga0439431_0102107 Ga0439431_0102107_20_451 143
274 3300041999 Ga0439433_0007880 Ga0439433_0007880_145_576 143
275 3300042005 Ga0439448_0003816 Ga0439448_0003816_3191_3622 143
276 3300042007 Ga0439449_0003613 Ga0439449_0003613_2046_2477 143
277 3300042008 Ga0439450_006102 Ga0439450_006102_1129_1560 143
278 3300042011 Ga0439454_058648 Ga0439454_058648_85_516 143
279 3300042012 Ga0439455_0039158 Ga0439455_0039158_437_868 143
280 3300042014 Ga0439457_003276 Ga0439457_003276_198_629 143
281 3300042015 Ga0439462_0003584 Ga0439462_0003584_232_663 143
282 3300042138 Ga0450903_000014 Ga0450903_000014_17800_18231 143
283 3300042157 Ga0439458_0035109 Ga0439458_0035109_145_579 143
284 3300046455 Ga0495603_0000942 Ga0495603_0000942_11363_11797 143
285 3300046459 Ga0495629_0012169 Ga0495629_0012169_700_1134 143
286 3300046459 Ga0495629_0220170 Ga0495629_0220170_649_1083 143
287 3300046473 Ga0495582_0132458 Ga0495582_0132458_42_476 143
288 3300046476 Ga0495662_0090884 Ga0495662_0090884_986_1420 143
289 3300046499 Ga0495594_0016258 Ga0495594_0016258_29_463 143
290 3300046557 Ga0495622_0046908 Ga0495622_0046908_1235_1669 143
291 3300046674 Ga0495588_0005319 Ga0495588_0005319_4156_4590 143
292 3300046689 Ga0495613_0238418 Ga0495613_0238418_76_510 143
293 3300046691 Ga0495670_0539435 Ga0495670_0539435_100_534 143
294 3300047315 Ga0495581_0181464 Ga0495581_0181464_681_1115 143
295 3300047318 Ga0495636_0049555 Ga0495636_0049555_887_1321 143
296 3300047470 Ga0495681_0112638 Ga0495681_0112638_405_839 143
297 3300048911 Ga0496108_0436028 Ga0496108_0436028_81_515 143
298 3300048912 Ga0496109_0688890 Ga0496109_0688890_339_773 143
299 3300050494 nmdc:mga06z11_4065_c1 nmdc:mga06z11_4065_c1_3765_4196 143
300 3300050495 nmdc:mga04h51_5148_c1 nmdc:mga04h51_5148_c1_1126_1557 143
301 3300001990 JGI24737J22298_10029408 JGI24737J22298_100294082 144
302 3300005347 Ga0070668_101885317 Ga0070668_1018853171 144
303 3300005354 Ga0070675_101631995 Ga0070675_1016319951 144
304 3300005444 Ga0070694_100842035 Ga0070694_1008420351 144
305 3300005614 Ga0068856_100294592 Ga0068856_1002945922 144
306 3300006048 Ga0075363_100004617 Ga0075363_1000046173 144
307 3300006048 Ga0075363_100507346 Ga0075363_1005073461 144
308 3300006353 Ga0075370_10310996 Ga0075370_103109962 144
309 3300006353 Ga0075370_10429825 Ga0075370_104298252 144
310 3300009545 Ga0105237_11074613 Ga0105237_110746132 144
311 3300010375 Ga0105239_10353548 Ga0105239_103535482 144
312 3300011119 Ga0105246_10127023 Ga0105246_101270232 144
313 3300013105 Ga0157369_10122255 Ga0157369_101222553 144
314 3300013307 Ga0157372_10792822 Ga0157372_107928222 144
315 3300015688 Ga0183367_1017 Ga0183367_101745 144
316 3300020082 Ga0206353_10038501 Ga0206353_100385011 144
317 3300025904 Ga0207647_10002990 Ga0207647_100029903 144
318 3300025905 Ga0207685_10155011 Ga0207685_101550111 144
319 3300025919 Ga0207657_10558494 Ga0207657_105584941 144
320 3300025938 Ga0207704_10387127 Ga0207704_103871272 144
321 3300025942 Ga0207689_10735365 Ga0207689_107353652 144
322 3300025972 Ga0207668_10850636 Ga0207668_108506361 144
323 3300026078 Ga0207702_10212641 Ga0207702_102126412 144
324 3300027312 Ga0209371_1037672 Ga0209371_10376721 144
325 3300030500 Ga0268256_1029277 Ga0268256_10292773 144
326 3300030521 Ga0307511_10031122 Ga0307511_100311223 144
327 3300030522 Ga0307512_10002135 Ga0307512_100021354 144
328 3300031456 Ga0307513_10079761 Ga0307513_100797613 144
329 3300031616 Ga0307508_10004980 Ga0307508_100049803 144
330 3300031616 Ga0307508_10024914 Ga0307508_100249146 144
331 3300031649 Ga0307514_10019522 Ga0307514_100195223 144
332 3300031730 Ga0307516_10023689 Ga0307516_100236893 144
333 3300031730 Ga0307516_10712279 Ga0307516_107122792 144
334 3300033179 Ga0307507_10049007 Ga0307507_100490073 144
335 3300033180 Ga0307510_10093106 Ga0307510_100931062 144
336 3300037418 Ga0395900_0199454 Ga0395900_0199454_225_668 144
337 3300038443 Ga0395901_1013969 Ga0395901_1013969_205_648 144
338 3300041453 Ga0451797_1529367 Ga0451797_1529367_32_466 144
339 3300041494 Ga0451837_0187976 Ga0451837_0187976_1471_1908 144
340 3300041501 Ga0451845_0792310 Ga0451845_0792310_752_1186 144
341 3300044658 Ga0466972_0228300 Ga0466972_0228300_73_510 144
342 3300044706 Ga0466964_0033162 Ga0466964_0033162_591_1028 144
343 3300045836 Ga0466958_0215653 Ga0466958_0215653_473_907 144
344 3300045976 Ga0466967_0021072 Ga0466967_0021072_439_876 144
345 3300045976 Ga0466967_2565617 Ga0466967_2565617_46_480 144
346 3300046476 Ga0495662_0017220 Ga0495662_0017220_2707_3144 144
347 3300046506 Ga0495583_0091334 Ga0495583_0091334_625_1062 144
348 3300046517 Ga0495630_0202255 Ga0495630_0202255_373_810 144
349 3300046663 Ga0495635_0353301 Ga0495635_0353301_388_825 144
350 3300046675 Ga0495657_0003160 Ga0495657_0003160_5243_5680 144
351 3300046689 Ga0495613_0403162 Ga0495613_0403162_121_558 144
352 3300046794 Ga0495589_0149921 Ga0495589_0149921_519_956 144
353 3300047318 Ga0495636_0010559 Ga0495636_0010559_3188_3625 144
354 3300047323 Ga0495683_0141937 Ga0495683_0141937_103_537 144
355 3300047443 Ga0495687_008131 Ga0495687_008131_4450_4887 144
356 3300047447 Ga0495685_007526 Ga0495685_007526_332_769 144
357 3300047447 Ga0495685_010152 Ga0495685_010152_222_659 144
358 3300047447 Ga0495685_014898 Ga0495685_014898_626_1060 144
359 3300047472 Ga0495686_0127852 Ga0495686_0127852_129_566 144
360 3300048089 Ga0495614_0184736 Ga0495614_0184736_163_600 144
361 3300049568 Ga0501031_0113408 Ga0501031_0113408_608_1042 144
362 3300049571 Ga0501034_0155551 Ga0501034_0155551_1525_1959 144
363 3300049572 Ga0501036_0604481 Ga0501036_0604481_352_786 144
364 3300049574 Ga0501038_0005910 Ga0501038_0005910_4513_4947 144
365 3300049575 Ga0501039_0432152 Ga0501039_0432152_406_840 144
366 3300049579 Ga0501043_0032911 Ga0501043_0032911_2597_3031 144
367 3300049580 Ga0501046_0098273 Ga0501046_0098273_559_996 144
368 3300049581 Ga0501047_0095634 Ga0501047_0095634_880_1314 144
369 3300049581 Ga0501047_0330127 Ga0501047_0330127_358_795 144
370 3300049582 Ga0501048_0026985 Ga0501048_0026985_1038_1472 144
371 3300049585 Ga0501069_0164623 Ga0501069_0164623_740_1174 144
372 3300049586 Ga0501070_0310201 Ga0501070_0310201_208_642 144
373 3300049586 Ga0501070_0561722 Ga0501070_0561722_169_627 144
374 3300049590 Ga0501074_1028963 Ga0501074_1028963_31_465 144
375 3300049742 Ga0501080_0429255 Ga0501080_0429255_320_754 144
376 3300049822 Ga0501035_0226998 Ga0501035_0226998_839_1273 144
377 3300049823 Ga0501044_0000851 Ga0501044_0000851_858_1295 144
378 3300049823 Ga0501044_0006572 Ga0501044_0006572_4817_5251 144
379 3300049823 Ga0501044_0086149 Ga0501044_0086149_1958_2392 144
380 3300050490 nmdc:mga03n38_8682_c1 nmdc:mga03n38_8682_c1_2848_3282 144
381 3300050496 nmdc:mga07m45_419671_c1 nmdc:mga07m45_419671_c1_246_680 144
382 3300053083 Ga0495655_0003008 Ga0495655_0003008_1494_1931 144

Feature Viewer

pLDDT pTM Quality
47.34 0.29 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map