F429060

General Info

Members Datasets Scaffolds Average Seq Length
381 287 255 363

Family's Representative Sequence

Representative Sequence 3300047318|Ga0495636_0080097|Ga0495636_0080097_72_1283
Length 403
Sequence VSFGVNQLKTIKLHRFSEYSAAFPPLTDFLSRMISMIPLKAEKDSQPQAATPRSMRVITEAIGSDLQDFSSDNSNVVKQIKLLAINALIEAARAGETGKGFAVVANEVHRLAQIASDIAGKFESNVLGRIGLSRAMAQSLVNEMEGMRLTDLAQTLVQLIVRNLFERTADVRWWATDTALWQALQNPGEPSAAIAAERLGVINRFYTVYLDLVVTDLSGKVIASANPNFQRKIIGTPLAGDPWFNAAVRCKSGDDYIVDEVKQSRLHDNRTALVYATGIREGGKLDGKLVGTLGVYFDWQNQGQAVVEKEANLPPQVAEKTTVMLLDGKSRVIATTNPSLLFSHFVLGNQSGQARGSYYDNSGSIVAFAKTLGYEDYDGLGWYGVVVQQTESDTAIKSALNLK

Samples

Sample ID Description Type Environment
1 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
2 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
3 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
4 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
5 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
6 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
7 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
8 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
9 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
10 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
11 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
12 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
13 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
14 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
15 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
16 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
17 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
18 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
19 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
20 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
21 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
22 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
23 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
24 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
25 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
26 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
27 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
28 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
29 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
30 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
31 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
32 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
33 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
34 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
35 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
36 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
37 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
38 2643221580 Devosia sp. Root635 Isolate Unclassified
39 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
40 2643221674 Devosia sp. Root436 Isolate Unclassified
41 2643221719 Rhizobium sp. Root274 Isolate Unclassified
42 2718217927 Rhizobium sp. N324 Isolate Nodule
43 2718218423 Rhizobium sp. N941 Isolate Nodule
44 2721755809 Rhizobium sp. N541 Isolate Nodule
45 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
46 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
47 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
48 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
49 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
50 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
51 2791355261 Rhizobium sp. J15 Isolate Nodule
52 2791355263 Rhizobium chutanense C5 Isolate Nodule
53 2791355266 Rhizobium sp. L43 Isolate Nodule
54 2791355267 Rhizobium sp. L18 Isolate Nodule
55 2802429633 Rhizobium anhuiense J3 Isolate Nodule
56 2802429634 Rhizobium anhuiense S10 Isolate Nodule
57 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
58 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
59 2802429637 Rhizobium anhuiense C15 Isolate Nodule
60 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
61 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
62 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
63 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
64 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
65 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
66 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
67 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
68 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
69 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
70 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
71 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
72 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
73 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
74 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
75 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
76 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
77 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
78 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
79 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
80 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
81 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
82 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
83 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
84 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
85 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
86 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
87 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
88 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
89 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
90 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
91 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
92 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
93 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
94 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
95 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
96 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
97 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
98 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
99 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
100 2936381700 Rhizobium chutanense C16 Isolate Unclassified
101 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
102 2996893221 Rhizobium sp. R635 Isolate Nodule
103 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
104 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
105 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
106 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
107 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
108 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
109 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
110 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
111 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
112 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
113 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
114 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
115 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
116 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
117 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
118 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
119 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
120 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
121 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
122 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
123 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
124 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
125 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
126 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
127 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
128 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
129 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
130 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
131 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
132 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
133 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
134 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
135 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
136 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
137 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
138 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
139 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
140 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
141 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
142 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
143 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
144 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
145 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
146 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
147 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
148 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
149 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
150 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
151 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
152 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
153 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
154 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
155 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
156 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
157 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
158 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
159 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
160 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
161 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
162 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
163 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
164 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
165 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
166 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
167 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
168 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
173 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
174 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
175 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
176 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
177 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
178 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
179 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
180 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
181 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
182 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
183 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
184 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
185 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
186 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
187 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
188 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
189 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
190 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
191 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
192 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
193 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
194 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
195 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
196 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
197 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
198 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
199 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
200 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
201 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
202 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
203 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
204 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
205 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
206 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
207 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
208 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
209 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
210 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
211 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
212 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
213 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
214 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
215 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
216 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
217 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
218 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
219 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
220 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
221 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
222 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
223 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
224 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
225 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
226 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
227 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
228 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
229 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
230 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
231 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
232 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
233 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
234 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
240 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
241 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
242 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
243 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
244 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
245 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
246 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
247 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
248 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
249 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
250 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
251 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
252 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
253 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
254 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
255 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
256 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
257 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
258 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
259 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
260 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
261 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
262 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
263 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
264 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
265 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
266 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
267 8005275841 Rhizobium sp. N4311 Isolate Nodule
268 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
269 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
270 8005382845 Rhizobium sp. R634 Isolate Nodule
271 8005395548 Rhizobium sp. R339 Isolate Nodule
272 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
273 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
274 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
275 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
276 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
277 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
278 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
279 8018176218 Rhizobium sp. N122 Isolate Nodule
280 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
281 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
282 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
283 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
284 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
285 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
286 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
287 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 66.93
Metatranscriptomes 0
Isolates 33.07

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 29.66
Nodule 22.83
Rhizoplane 5.25
Rhizosphere 28.08
Stem 0
Stem Tuber 0
Unclassified 14.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25158J39367_1000185 3300002739 Bacteria 14791
2 JGI25152J39213_1000649 3300002773 Bacteria 18388
3 JGI25152J39213_1000959 3300002773 Bacteria 14079
4 JGI25152J39213_1003432 3300002773 Bacteria 5415
5 JGI25152J39213_1005120 3300002773 Bacteria 3934
6 JGI25152J39213_1012177 3300002773 Bacteria 1859
7 JGI25150J39212_1001740 3300002774 Bacteria 5827
8 JGI25159J45721_1001419 3300002987 Bacteria 9950
9 JGI25159J45721_1002936 3300002987 Bacteria 6211
10 JGI25151J46595_10000741 3300003187 Bacteria 26796
11 JGI25165J46597_1004003 3300003214 Bacteria 3354
12 JGI25153J46596_10006928 3300003215 Bacteria 5651
13 JGI25153J46596_10007385 3300003215 Bacteria 5415
14 JGI25153J46596_10008782 3300003215 Bacteria 4783
15 JGI25153J46596_10011390 3300003215 Bacteria 3934
16 JGI25160J50197_1000052 3300003354 Bacteria 127795
17 JGI25160J50197_1005992 3300003354 Bacteria 4983
18 JGI25161J50226_1000073 3300003374 Bacteria 86555
19 JGI25161J50226_1000410 3300003374 Bacteria 20985
20 Ga0055526_1002168 3300003771 Bacteria 13463
21 Ga0055524_1003026 3300003775 Bacteria 8324
22 Ga0055528_1000413 3300003790 Bacteria 34511
23 Ga0055528_1010837 3300003790 Bacteria 3671
24 Ga0055528_1024573 3300003790 Bacteria 1801
25 Ga0055540_1000234 3300003792 Bacteria 50741
26 Ga0055540_1003105 3300003792 Bacteria 8243
27 Ga0055543_1000035 3300004625 Bacteria 127833
28 Ga0055543_1000580 3300004625 Bacteria 20183
29 Ga0055543_1004143 3300004625 Bacteria 4031
30 Ga0065165_1001373 3300005262 Bacteria 26778
31 Ga0065165_1006826 3300005262 Bacteria 5822
32 Ga0065165_1033284 3300005262 Bacteria 1605
33 Ga0065707_10111906 3300005295 Bacteria 2379
34 Ga0070690_100169379 3300005330 Unclassified 1502
35 Ga0070675_100091042 3300005354 Bacteria 2555
36 Ga0070671_100048749 3300005355 Bacteria 3523
37 Ga0070711_100310880 3300005439 Bacteria 1256
38 Ga0070708_100218627 3300005445 Bacteria 1786
39 Ga0070706_100029457 3300005467 Bacteria 5057
40 Ga0070707_100031780 3300005468 Bacteria 5029
41 Ga0070707_100053550 3300005468 Unclassified 3869
42 Ga0070698_100043245 3300005471 Bacteria 4619
43 Ga0070697_100272638 3300005536 Bacteria 1450
44 Ga0070686_100006348 3300005544 Bacteria 6561
45 Ga0070704_100058966 3300005549 Bacteria 2736
46 Ga0070704_100114661 3300005549 Bacteria 2057
47 Ga0068866_10047821 3300005718 Bacteria 2159
48 Ga0075365_10008589 3300006038 Bacteria 5814
49 Ga0070715_10026949 3300006163 Bacteria 2291
50 Ga0070716_100008750 3300006173 Bacteria 5030
51 Ga0075362_10040076 3300006177 Bacteria 2061
52 Ga0075367_10024846 3300006178 Bacteria 3381
53 Ga0075369_10055709 3300006186 Bacteria 1718
54 Ga0075366_10084517 3300006195 Bacteria 1897
55 Ga0097621_100009443 3300006237 Bacteria 7079
56 Ga0097621_100440817 3300006237 Bacteria 1172
57 Ga0068871_100014815 3300006358 Bacteria 5822
58 Ga0075433_10001850 3300006852 Bacteria 15897
59 Ga0068865_100210212 3300006881 Unclassified 1516
60 Ga0079104_1000044 3300006946 Bacteria 185367
61 Ga0105251_10051610 3300009011 Bacteria 1960
62 Ga0105242_10002144 3300009176 Bacteria 15581
63 Ga0105242_10175809 3300009176 Bacteria 1885
64 Ga0105248_10004763 3300009177 Bacteria 15015
65 Ga0123341_1000006 3300009765 Bacteria 149197
66 Ga0123342_1018205 3300009766 Bacteria 5650
67 Ga0105246_10074965 3300011119 Bacteria 2394
68 Ga0157373_10065597 3300013100 Bacteria 2569
69 Ga0157375_10325405 3300013308 Unclassified 1702
70 Ga0157376_10008563 3300014969 Bacteria 7389
71 Ga0209436_100047 3300025208 Bacteria 68393
72 Ga0209436_108134 3300025208 Bacteria 2121
73 Ga0207425_1001001 3300025245 Bacteria 13259
74 Ga0207425_1006780 3300025245 Bacteria 3097
75 Ga0209129_1000611 3300025258 Bacteria 24129
76 Ga0209129_1001053 3300025258 Bacteria 16286
77 Ga0209129_1001178 3300025258 Bacteria 15052
78 Ga0209129_1001568 3300025258 Bacteria 12550
79 Ga0209129_1003170 3300025258 Bacteria 7361
80 Ga0209233_1000605 3300025261 Bacteria 18530
81 Ga0209673_1000409 3300025273 Bacteria 75876
82 Ga0209673_1001508 3300025273 Bacteria 21458
83 Ga0209673_1001874 3300025273 Bacteria 16993
84 Ga0209673_1001941 3300025273 Bacteria 16313
85 Ga0209673_1002296 3300025273 Bacteria 13630
86 Ga0209673_1016721 3300025273 Bacteria 2730
87 Ga0209130_1000006 3300025284 Bacteria 596528
88 Ga0209130_1001144 3300025284 Bacteria 19387
89 Ga0209025_1001226 3300025294 Bacteria 35815
90 Ga0209025_1001688 3300025294 Bacteria 26980
91 Ga0209025_1030877 3300025294 Bacteria 2551
92 Ga0209025_1049322 3300025294 Bacteria 1695
93 Ga0209564_1000853 3300025295 Bacteria 40719
94 Ga0209564_1001099 3300025295 Bacteria 32101
95 Ga0209564_1001645 3300025295 Bacteria 21556
96 Ga0209758_1000313 3300025297 Bacteria 93883
97 Ga0209758_1000624 3300025297 Bacteria 54349
98 Ga0209758_1006988 3300025297 Bacteria 7856
99 Ga0209758_1009821 3300025297 Bacteria 5855
100 Ga0209758_1010849 3300025297 Bacteria 5381
101 Ga0209050_1001903 3300025298 Bacteria 19975
102 Ga0209256_1001199 3300025299 Bacteria 29031
103 Ga0209256_1002645 3300025299 Bacteria 14095
104 Ga0209256_1003108 3300025299 Bacteria 12147
105 Ga0209256_1003692 3300025299 Bacteria 10407
106 Ga0207426_1000044 3300025302 Bacteria 428043
107 Ga0207426_1000106 3300025302 Bacteria 244368
108 Ga0207426_1000743 3300025302 Bacteria 36635
109 Ga0207426_1001023 3300025302 Bacteria 26852
110 Ga0209051_1000339 3300025303 Bacteria 70136
111 Ga0209051_1003095 3300025303 Bacteria 11223
112 Ga0209051_1012404 3300025303 Bacteria 4125
113 Ga0209051_1012657 3300025303 Bacteria 4066
114 Ga0209257_1002795 3300025304 Bacteria 16446
115 Ga0209257_1011309 3300025304 Bacteria 4319
116 Ga0207713_1071778 3300025735 Bacteria 1276
117 Ga0207686_10007993 3300025934 Bacteria 5702
118 Ga0207665_10013312 3300025939 Bacteria 5406
119 Ga0207641_10338235 3300026088 Unclassified 1432
120 Ga0209281_1000129 3300027111 Bacteria 194490
121 Ga0307515_10060134 3300028794 Bacteria 5429
122 Ga0307513_10015610 3300031456 Bacteria 9197
123 Ga0307412_10001806 3300031911 Bacteria 11834
124 Ga0373927_0000780 3300035695 Bacteria 24278
125 Ga0373925_0005451 3300037068 Bacteria 9475
126 Ga0439466_0048906 3300041411 Bacteria 1390
127 Ga0439465_0005287 3300041413 Bacteria 4129
128 Ga0439465_0010973 3300041413 Bacteria 2842
129 Ga0451793_0715311 3300041452 Bacteria 1583
130 Ga0451795_1703054 3300041456 Bacteria 1866
131 Ga0451798_0082363 3300041458 Bacteria 2025
132 Ga0451837_0426827 3300041494 Bacteria 1817
133 Ga0451847_0617606 3300041503 Bacteria 1724
134 Ga0451847_0793149 3300041503 Bacteria 1335
135 Ga0495617_023274 3300046452 Bacteria 2093
136 Ga0495638_0000854 3300046460 Bacteria 31738
137 Ga0495605_0000331 3300046474 Bacteria 47522
138 Ga0495607_0030695 3300046501 Bacteria 3297
139 Ga0495607_0042849 3300046501 Bacteria 2680
140 Ga0495607_0079932 3300046501 Bacteria 1800
141 Ga0495583_0060434 3300046506 Bacteria 1694
142 Ga0495606_0134091 3300046507 Bacteria 1469
143 Ga0495610_0016540 3300046512 Bacteria 4240
144 Ga0495610_0090780 3300046512 Bacteria 1385
145 Ga0495616_0049537 3300046513 Bacteria 2105
146 Ga0495616_0066753 3300046513 Bacteria 1750
147 Ga0495620_0004292 3300046515 Bacteria 8060
148 Ga0495631_0001117 3300046518 Bacteria 16644
149 Ga0495631_0066051 3300046518 Bacteria 1565
150 Ga0495632_0013103 3300046519 Bacteria 4749
151 Ga0495632_0024201 3300046519 Bacteria 3230
152 Ga0495654_0000122 3300046530 Bacteria 86717
153 Ga0495654_0004891 3300046530 Bacteria 7889
154 Ga0495668_0013455 3300046616 Bacteria 4823
155 Ga0495668_0054320 3300046616 Bacteria 2214
156 Ga0495611_0010763 3300046648 Bacteria 3875
157 Ga0495625_0001965 3300046660 Bacteria 23208
158 Ga0495625_0123980 3300046660 Bacteria 1755
159 Ga0495670_0099952 3300046691 Bacteria 1493
160 Ga0495670_0170430 3300046691 Bacteria 1146
161 Ga0495649_0020153 3300046694 Bacteria 3742
162 Ga0495660_0007221 3300046810 Bacteria 6539
163 Ga0495660_0040478 3300046810 Bacteria 2582
164 Ga0495636_0080097 3300047318 Bacteria 1405
165 Ga0495672_0003833 3300047320 Bacteria 12657
166 Ga0495687_023612 3300047443 Bacteria 2935
167 Ga0495687_040853 3300047443 Bacteria 2040
168 Ga0495673_0040097 3300047469 Bacteria 2119
169 Ga0495673_0043327 3300047469 Bacteria 2015
170 Ga0495686_0000613 3300047472 Bacteria 49253
171 Ga0495686_0007999 3300047472 Bacteria 7840
172 Ga0495686_0105643 3300047472 Bacteria 1694
173 Ga0495626_0031639 3300048091 Bacteria 2545
174 Ga0495626_0061246 3300048091 Bacteria 1712
175 Ga0496101_0222365 3300048904 Bacteria 1465
176 Ga0496102_0111838 3300048905 Bacteria 2546
177 Ga0496103_0070456 3300048906 Bacteria 2187
178 Ga0496104_0176401 3300048907 Bacteria 2047
179 Ga0496105_0041007 3300048908 Bacteria 3815
180 Ga0496106_0001004 3300048909 Bacteria 20640
181 Ga0496106_0226274 3300048909 Bacteria 1492
182 Ga0496107_0095132 3300048910 Bacteria 2179
183 Ga0496108_0179835 3300048911 Bacteria 1831
184 Ga0496109_0262972 3300048912 Bacteria 1625
185 Ga0496110_0068789 3300048913 Bacteria 3134
186 Ga0496111_0000717 3300048914 Bacteria 17648
187 Ga0496111_0025242 3300048914 Bacteria 4192
188 Ga0496112_0294717 3300048915 Bacteria 1568
189 Ga0496113_0123730 3300048916 Bacteria 2024
190 Ga0496116_0023048 3300048919 Bacteria 4646
191 Ga0496116_0035119 3300048919 Bacteria 3525
192 Ga0496117_0029339 3300048920 Bacteria 4243
193 Ga0496117_0096706 3300048920 Bacteria 1883
194 Ga0496118_0129531 3300048921 Bacteria 1624
195 Ga0496119_0029979 3300048922 Bacteria 3675
196 Ga0496119_0103441 3300048922 Bacteria 1595
197 Ga0496121_0001423 3300048924 Bacteria 40492
198 Ga0496121_0009888 3300048924 Bacteria 10869
199 Ga0496121_0065591 3300048924 Bacteria 2953
200 Ga0496121_0099424 3300048924 Bacteria 2248
201 Ga0496121_0118198 3300048924 Bacteria 2007
202 Ga0496122_0000072 3300048925 Bacteria 222436
203 Ga0496122_0073233 3300048925 Bacteria 2430
204 Ga0496123_0000035 3300048926 Bacteria 267288
205 Ga0496123_0009415 3300048926 Bacteria 8800
206 Ga0496123_0065923 3300048926 Bacteria 2297
207 Ga0496123_0066559 3300048926 Bacteria 2281
208 Ga0496124_0000133 3300048927 Bacteria 154328
209 Ga0496124_0030446 3300048927 Bacteria 4790
210 Ga0496124_0076017 3300048927 Bacteria 2773
211 Ga0496124_0115795 3300048927 Bacteria 2150
212 Ga0496125_0130471 3300048928 Bacteria 1770
213 Ga0496125_0139388 3300048928 Bacteria 1689
214 Ga0496126_0057483 3300048929 Bacteria 3511
215 Ga0495678_020542 3300049459 Bacteria 2921
216 Ga0495678_026078 3300049459 Bacteria 2501
217 Ga0495682_0026251 3300049460 Bacteria 2164
218 Ga0501031_0100620 3300049568 Bacteria 1886
219 Ga0501032_0041707 3300049569 Bacteria 3116
220 Ga0501034_0001871 3300049571 Bacteria 26700
221 Ga0501037_0089532 3300049573 Bacteria 2227
222 Ga0501047_0046300 3300049581 Bacteria 4204
223 Ga0501083_0081830 3300049744 Bacteria 2140
224 nmdc:mga03n38_64091_c1 3300050490 Bacteria 1681
225 nmdc:mga0yw44_41192_c1 3300050492 Bacteria 2748
226 nmdc:mga0a205_14491_c1 3300050515 Bacteria 7355
227 nmdc:mga0sz30_43007_c1 3300050516 Bacteria 1901
228 Ga0500610_0010894 3300053079 Bacteria 4114
229 Ga0500644_0014516 3300053088 Bacteria 2225
230 Ga0500557_014026 3300053105 Bacteria 2127
231 Ga0500562_014955 3300053108 Bacteria 1989
232 Ga0500569_021971 3300053109 Bacteria 1693
233 Ga0500569_034053 3300053109 Bacteria 1451
234 Ga0500594_0000738 3300053118 Bacteria 6943
235 Ga0500595_003221 3300053119 Bacteria 7703
236 Ga0500608_014431 3300053122 Bacteria 3528
237 Ga0500618_000031 3300053125 Bacteria 129550
238 Ga0500658_0001240 3300053134 Bacteria 10358
239 Ga0500658_0020685 3300053134 Bacteria 2487
240 Ga0500559_0010209 3300053136 Bacteria 4037
241 Ga0500568_0001799 3300053139 Bacteria 13200
242 Ga0500568_0005556 3300053139 Bacteria 6492
243 Ga0500573_0003517 3300053140 Bacteria 8117
244 Ga0500573_0008721 3300053140 Bacteria 5595
245 Ga0500588_0008401 3300053146 Bacteria 2410
246 Ga0500604_0000184 3300053151 Bacteria 17796
247 Ga0500616_0000328 3300053153 Bacteria 68215
248 Ga0500616_0020494 3300053153 Bacteria 3713
249 Ga0500620_037503 3300053155 Bacteria 1573
250 Ga0500622_0000919 3300053156 Bacteria 25030
251 Ga0500622_0001161 3300053156 Bacteria 21882
252 Ga0500627_0026582 3300053158 Bacteria 2391
253 Ga0500633_0000113 3300053160 Bacteria 10869
254 Ga0500634_0023443 3300053161 Bacteria 3354
255 Ga0500636_0000004 3300053177 Bacteria 202392

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005468 Ga0070707_100053550 Ga0070707_1000535501 311
2 3300005549 Ga0070704_100058966 Ga0070704_1000589661 311
3 3300006852 Ga0075433_10001850 Ga0075433_100018504 311
4 3300050515 nmdc:mga0a205_14491_c1 nmdc:mga0a205_14491_c1_4312_5319 311
5 3300026088 Ga0207641_10338235 Ga0207641_103382352 312
6 3300005330 Ga0070690_100169379 Ga0070690_1001693791 320
7 3300005354 Ga0070675_100091042 Ga0070675_1000910422 320
8 3300005544 Ga0070686_100006348 Ga0070686_1000063483 320
9 3300006237 Ga0097621_100009443 Ga0097621_1000094434 320
10 3300006358 Ga0068871_100014815 Ga0068871_1000148154 320
11 3300009176 Ga0105242_10175809 Ga0105242_101758093 320
12 3300013308 Ga0157375_10325405 Ga0157375_103254052 320
13 3300014969 Ga0157376_10008563 Ga0157376_1000856310 320
14 3300006881 Ga0068865_100210212 Ga0068865_1002102122 321
15 3300005549 Ga0070704_100114661 Ga0070704_1001146612 325
16 3300005445 Ga0070708_100218627 Ga0070708_1002186271 336
17 3300005536 Ga0070697_100272638 Ga0070697_1002726381 336
18 3300053153 Ga0500616_0020494 Ga0500616_0020494_1771_2817 336
19 3300005718 Ga0068866_10047821 Ga0068866_100478212 338
20 3300009176 Ga0105242_10002144 Ga0105242_1000214412 338
21 3300025934 Ga0207686_10007993 Ga0207686_100079932 338
22 3300005295 Ga0065707_10111906 Ga0065707_101119062 339
23 3300005439 Ga0070711_100310880 Ga0070711_1003108801 339
24 3300005467 Ga0070706_100029457 Ga0070706_1000294574 339
25 3300005468 Ga0070707_100031780 Ga0070707_1000317803 339
26 3300005471 Ga0070698_100043245 Ga0070698_1000432452 339
27 3300006163 Ga0070715_10026949 Ga0070715_100269492 339
28 3300006173 Ga0070716_100008750 Ga0070716_1000087502 339
29 3300025939 Ga0207665_10013312 Ga0207665_100133124 339
30 3300053119 Ga0500595_003221 Ga0500595_003221_1917_2939 340
31 iso_pu_bacteria 2818991272 2819242669 345
32 iso_pu_bacteria 8056875544 8056878135 345
33 3300053088 Ga0500644_0014516 Ga0500644_0014516_1021_2064 347
34 3300053122 Ga0500608_014431 Ga0500608_014431_33_1076 347
35 3300053156 Ga0500622_0001161 Ga0500622_0001161_19821_20864 347
36 3300006177 Ga0075362_10040076 Ga0075362_100400762 348
37 3300048922 Ga0496119_0103441 Ga0496119_0103441_437_1483 348
38 3300053151 Ga0500604_0000184 Ga0500604_0000184_5567_6619 348
39 3300041411 Ga0439466_0048906 Ga0439466_0048906_293_1342 349
40 3300041413 Ga0439465_0010973 Ga0439465_0010973_1044_2093 349
41 3300041503 Ga0451847_0793149 Ga0451847_0793149_30_1079 349
42 3300046460 Ga0495638_0000854 Ga0495638_0000854_11256_12305 349
43 3300046501 Ga0495607_0030695 Ga0495607_0030695_1183_2232 349
44 3300046515 Ga0495620_0004292 Ga0495620_0004292_6961_8010 349
45 3300046691 Ga0495670_0170430 Ga0495670_0170430_19_1068 349
46 3300047320 Ga0495672_0003833 Ga0495672_0003833_266_1315 349
47 3300047472 Ga0495686_0000613 Ga0495686_0000613_6055_7104 349
48 3300048909 Ga0496106_0226274 Ga0496106_0226274_413_1465 349
49 3300048919 Ga0496116_0035119 Ga0496116_0035119_2267_3316 349
50 3300048927 Ga0496124_0000133 Ga0496124_0000133_73199_74248 349
51 3300049744 Ga0501083_0081830 Ga0501083_0081830_400_1449 349
52 3300050492 nmdc:mga0yw44_41192_c1 nmdc:mga0yw44_41192_c1_1072_2121 349
53 3300053108 Ga0500562_014955 Ga0500562_014955_272_1321 349
54 3300053139 Ga0500568_0001799 Ga0500568_0001799_11209_12258 349
55 3300053139 Ga0500568_0005556 Ga0500568_0005556_729_1778 349
56 3300053140 Ga0500573_0003517 Ga0500573_0003517_2603_3652 349
57 3300053153 Ga0500616_0000328 Ga0500616_0000328_54631_55680 349
58 3300053161 Ga0500634_0023443 Ga0500634_0023443_1308_2360 349
59 iso_pu_bacteria 2643221580 2643910552 359
60 iso_pu_bacteria 2643221674 2644411394 359
61 3300003214 JGI25165J46597_1004003 JGI25165J46597_10040033 361
62 3300025261 Ga0209233_1000605 Ga0209233_10006054 361
63 3300050490 nmdc:mga03n38_64091_c1 nmdc:mga03n38_64091_c1_314_1399 361
64 iso_pu_bacteria 2599185156 2599334907 361
65 iso_pu_bacteria 2842922631 2842926088 361
66 3300006237 Ga0097621_100440817 Ga0097621_1004408171 362
67 3300049568 Ga0501031_0100620 Ga0501031_0100620_286_1383 362
68 3300049573 Ga0501037_0089532 Ga0501037_0089532_901_1998 362
69 iso_pu_bacteria 2599185236 2599718051 362
70 iso_pu_bacteria 2818991461 2819682587 362
71 iso_pu_bacteria 2821123053 2821127192 362
72 iso_pu_bacteria 2838736955 2838740665 362
73 iso_pu_bacteria 2841840854 2841844506 362
74 iso_pu_bacteria 2842140634 2842144426 362
75 3300049571 Ga0501034_0001871 Ga0501034_0001871_3083_4180 363
76 iso_pu_bacteria 2513237146 2513925597 363
77 iso_pu_bacteria 2582581294 2585202971 363
78 iso_pu_bacteria 2599185170 2599418704 363
79 iso_pu_bacteria 2838035591 2838037605 363
80 iso_pu_bacteria 2838661181 2838662613 363
81 iso_pu_bacteria 2933016740 2933018757 363
82 iso_pu_bacteria 2509276021 2509387834 364
83 iso_pu_bacteria 2509276033 2509443452 364
84 iso_pu_bacteria 2510065019 2510132186 364
85 iso_pu_bacteria 2510461069 2510840971 364
86 iso_pu_bacteria 2510461076 2510898520 364
87 iso_pu_bacteria 2510917030 2511199586 364
88 iso_pu_bacteria 2513237084 2513569020 364
89 iso_pu_bacteria 2513237085 2513580047 364
90 iso_pu_bacteria 2513237093 2513635686 364
91 iso_pu_bacteria 2513237103 2513709321 364
92 iso_pu_bacteria 2513237162 2514023102 364
93 iso_pu_bacteria 2515075009 2515111166 364
94 iso_pu_bacteria 2515154113 2515636046 364
95 iso_pu_bacteria 2515154116 2515658785 364
96 iso_pu_bacteria 2515154134 2515743903 364
97 iso_pu_bacteria 2516653077 2517039811 364
98 iso_pu_bacteria 2516653085 2517075332 364
99 iso_pu_bacteria 2517093000 2517093937 364
100 iso_pu_bacteria 2517287029 2517405752 364
101 iso_pu_bacteria 2529292951 2530644010 364
102 iso_pu_bacteria 2582581298 2585220871 364
103 iso_pu_bacteria 2585427526 2585525524 364
104 iso_pu_bacteria 2585427528 2585543817 364
105 iso_pu_bacteria 2585427529 2585550030 364
106 iso_pu_bacteria 2585427593 2585839304 364
107 iso_pu_bacteria 2643221653 2644296954 364
108 iso_pu_bacteria 2643221719 2644655208 364
109 iso_pu_bacteria 2718217927 2719384739 364
110 iso_pu_bacteria 2718218423 2721398450 364
111 iso_pu_bacteria 2721755809 2724037263 364
112 iso_pu_bacteria 2724679232 2725951086 364
113 iso_pu_bacteria 2738541317 2738948787 364
114 iso_pu_bacteria 2738541333 2739039062 364
115 iso_pu_bacteria 2765235942 2766067720 364
116 iso_pu_bacteria 2775507049 2776912644 364
117 iso_pu_bacteria 2791355259 2793316923 364
118 iso_pu_bacteria 2791355261 2793329352 364
119 iso_pu_bacteria 2791355263 2793339915 364
120 iso_pu_bacteria 2791355266 2793358779 364
121 iso_pu_bacteria 2791355267 2793370489 364
122 iso_pu_bacteria 2802429633 2806049493 364
123 iso_pu_bacteria 2802429634 2806056576 364
124 iso_pu_bacteria 2802429635 2806063646 364
125 iso_pu_bacteria 2802429636 2806067643 364
126 iso_pu_bacteria 2802429637 2806077983 364
127 iso_pu_bacteria 2838042994 2838047049 364
128 iso_pu_bacteria 2838686498 2838688751 364
129 iso_pu_bacteria 2838729681 2838731046 364
130 iso_pu_bacteria 2838742623 2838744060 364
131 iso_pu_bacteria 2841851746 2841856974 364
132 iso_pu_bacteria 2841864319 2841870411 364
133 iso_pu_bacteria 2842110456 2842115998 364
134 iso_pu_bacteria 2842156927 2842159911 364
135 iso_pu_bacteria 2842163707 2842168154 364
136 iso_pu_bacteria 2842180545 2842183472 364
137 iso_pu_bacteria 2842217011 2842220701 364
138 iso_pu_bacteria 2842229732 2842234048 364
139 iso_pu_bacteria 2842243621 2842245524 364
140 iso_pu_bacteria 2842257432 2842259826 364
141 iso_pu_bacteria 2842271015 2842274665 364
142 iso_pu_bacteria 2842304105 2842306910 364
143 iso_pu_bacteria 2842341865 2842343719 364
144 iso_pu_bacteria 2842363717 2842365054 364
145 iso_pu_bacteria 2842395702 2842400851 364
146 iso_pu_bacteria 2844454524 2844455276 364
147 iso_pu_bacteria 2857516855 2857520409 364
148 iso_pu_bacteria 2899803654 2899806107 364
149 iso_pu_bacteria 2913308742 2913311073 364
150 iso_pu_bacteria 2919100787 2919103708 364
151 iso_pu_bacteria 2933570622 2933572975 364
152 iso_pu_bacteria 2933586486 2933592043 364
153 iso_pu_bacteria 2935901341 2935904273 364
154 iso_pu_bacteria 2936367885 2936368242 364
155 iso_pu_bacteria 2936375103 2936378897 364
156 iso_pu_bacteria 2936381700 2936386830 364
157 iso_pu_bacteria 2989776772 2989778064 364
158 iso_pu_bacteria 2996893221 2996895396 364
159 iso_pu_bacteria 3003930520 3003932561 364
160 iso_pu_bacteria 3005445848 3005446646 364
161 iso_pu_bacteria 8005275841 8005279456 364
162 iso_pu_bacteria 8005307578 8005309031 364
163 iso_pu_bacteria 8005376324 8005376731 364
164 iso_pu_bacteria 8005382845 8005386114 364
165 iso_pu_bacteria 8005395548 8005397488 364
166 iso_pu_bacteria 8005460587 8005461807 364
167 iso_pu_bacteria 8005556819 8005563022 364
168 iso_pu_bacteria 8005563573 8005570319 364
169 iso_pu_bacteria 8005570704 8005574060 364
170 iso_pu_bacteria 8005695170 8005698910 364
171 iso_pu_bacteria 8018150411 8018153445 364
172 iso_pu_bacteria 8018163183 8018168293 364
173 iso_pu_bacteria 8018176218 8018177371 364
174 iso_pu_bacteria 8023680758 8023687117 364
175 iso_pu_bacteria 8024479707 8024480986 364
176 iso_pu_bacteria 8054460903 8054461779 364
177 iso_pu_bacteria 8054558443 8054558757 364
178 iso_pu_bacteria 8056375014 8056379449 364
179 iso_pu_bacteria 8057874678 8057879626 364
180 3300035695 Ga0373927_0000780 Ga0373927_0000780_11979_13082 365
181 3300037068 Ga0373925_0005451 Ga0373925_0005451_16_1119 365
182 iso_pu_bacteria 2510917022 2511133631 365
183 iso_pu_bacteria 2513237144 2513907639 365
184 iso_pu_bacteria 2582581307 2585275757 365
185 iso_pu_bacteria 2585427531 2585559324 365
186 iso_pu_bacteria 2585427608 2585901210 365
187 iso_pu_bacteria 2585427609 2585905300 365
188 iso_pu_bacteria 2585428125 2587979585 365
189 iso_pu_bacteria 2852387548 2852388955 365
190 iso_pu_bacteria 639633055 639647323 365
191 iso_pu_bacteria 8057575449 8057579098 365
192 3300005262 Ga0065165_1006826 Ga0065165_10068265 366
193 3300006946 Ga0079104_1000044 Ga0079104_100004424 366
194 3300027111 Ga0209281_1000129 Ga0209281_1000129146 366
195 3300046530 Ga0495654_0000122 Ga0495654_0000122_17269_18369 366
196 3300047472 Ga0495686_0105643 Ga0495686_0105643_97_1197 366
197 3300048914 Ga0496111_0000717 Ga0496111_0000717_11238_12338 366
198 3300048924 Ga0496121_0001423 Ga0496121_0001423_5593_6696 366
199 3300048924 Ga0496121_0065591 Ga0496121_0065591_1543_2643 366
200 3300048925 Ga0496122_0000072 Ga0496122_0000072_74268_75371 366
201 3300048926 Ga0496123_0000035 Ga0496123_0000035_119120_120223 366
202 3300048926 Ga0496123_0009415 Ga0496123_0009415_517_1617 366
203 3300048927 Ga0496124_0030446 Ga0496124_0030446_1839_2942 366
204 3300048927 Ga0496124_0115795 Ga0496124_0115795_356_1456 366
205 3300053125 Ga0500618_000031 Ga0500618_000031_111624_112724 366
206 3300053136 Ga0500559_0010209 Ga0500559_0010209_2777_3892 366
207 3300013100 Ga0157373_10065597 Ga0157373_100655972 367
208 3300031911 Ga0307412_10001806 Ga0307412_100018068 367
209 3300046512 Ga0495610_0016540 Ga0495610_0016540_2418_3521 367
210 3300047469 Ga0495673_0043327 Ga0495673_0043327_91_1194 367
211 3300047472 Ga0495686_0007999 Ga0495686_0007999_2524_3627 367
212 3300048920 Ga0496117_0029339 Ga0496117_0029339_487_1590 367
213 3300048921 Ga0496118_0129531 Ga0496118_0129531_249_1352 367
214 3300048924 Ga0496121_0099424 Ga0496121_0099424_1003_2106 367
215 3300048925 Ga0496122_0073233 Ga0496122_0073233_1223_2332 367
216 3300048927 Ga0496124_0076017 Ga0496124_0076017_391_1494 367
217 3300049459 Ga0495678_020542 Ga0495678_020542_1655_2758 367
218 3300053177 Ga0500636_0000004 Ga0500636_0000004_104388_105497 367
219 3300002739 JGI25158J39367_1000185 JGI25158J39367_10001854 368
220 3300002773 JGI25152J39213_1000649 JGI25152J39213_100064911 368
221 3300002773 JGI25152J39213_1000959 JGI25152J39213_100095910 368
222 3300002773 JGI25152J39213_1003432 JGI25152J39213_10034325 368
223 3300002773 JGI25152J39213_1005120 JGI25152J39213_10051202 368
224 3300002773 JGI25152J39213_1012177 JGI25152J39213_10121771 368
225 3300002774 JGI25150J39212_1001740 JGI25150J39212_10017402 368
226 3300002987 JGI25159J45721_1001419 JGI25159J45721_100141912 368
227 3300002987 JGI25159J45721_1002936 JGI25159J45721_10029363 368
228 3300003187 JGI25151J46595_10000741 JGI25151J46595_1000074112 368
229 3300003215 JGI25153J46596_10006928 JGI25153J46596_100069281 368
230 3300003215 JGI25153J46596_10007385 JGI25153J46596_100073855 368
231 3300003215 JGI25153J46596_10008782 JGI25153J46596_100087822 368
232 3300003215 JGI25153J46596_10011390 JGI25153J46596_100113902 368
233 3300003354 JGI25160J50197_1000052 JGI25160J50197_10000528 368
234 3300003354 JGI25160J50197_1005992 JGI25160J50197_10059928 368
235 3300003374 JGI25161J50226_1000073 JGI25161J50226_100007372 368
236 3300003374 JGI25161J50226_1000410 JGI25161J50226_100041015 368
237 3300003771 Ga0055526_1002168 Ga0055526_10021682 368
238 3300003775 Ga0055524_1003026 Ga0055524_10030269 368
239 3300003790 Ga0055528_1000413 Ga0055528_100041310 368
240 3300003790 Ga0055528_1010837 Ga0055528_10108372 368
241 3300003790 Ga0055528_1024573 Ga0055528_10245731 368
242 3300003792 Ga0055540_1000234 Ga0055540_100023435 368
243 3300003792 Ga0055540_1003105 Ga0055540_10031052 368
244 3300004625 Ga0055543_1000035 Ga0055543_1000035114 368
245 3300004625 Ga0055543_1000580 Ga0055543_10005807 368
246 3300004625 Ga0055543_1004143 Ga0055543_10041432 368
247 3300005262 Ga0065165_1001373 Ga0065165_100137320 368
248 3300005262 Ga0065165_1033284 Ga0065165_10332841 368
249 3300005355 Ga0070671_100048749 Ga0070671_1000487493 368
250 3300006038 Ga0075365_10008589 Ga0075365_100085893 368
251 3300006178 Ga0075367_10024846 Ga0075367_100248462 368
252 3300006186 Ga0075369_10055709 Ga0075369_100557091 368
253 3300006195 Ga0075366_10084517 Ga0075366_100845171 368
254 3300009011 Ga0105251_10051610 Ga0105251_100516102 368
255 3300009177 Ga0105248_10004763 Ga0105248_100047638 368
256 3300009765 Ga0123341_1000006 Ga0123341_1000006117 368
257 3300009766 Ga0123342_1018205 Ga0123342_10182053 368
258 3300011119 Ga0105246_10074965 Ga0105246_100749652 368
259 3300025208 Ga0209436_100047 Ga0209436_10004755 368
260 3300025208 Ga0209436_108134 Ga0209436_1081342 368
261 3300025245 Ga0207425_1001001 Ga0207425_10010015 368
262 3300025245 Ga0207425_1006780 Ga0207425_10067802 368
263 3300025258 Ga0209129_1000611 Ga0209129_10006118 368
264 3300025258 Ga0209129_1001053 Ga0209129_10010532 368
265 3300025258 Ga0209129_1001178 Ga0209129_100117811 368
266 3300025258 Ga0209129_1001568 Ga0209129_10015688 368
267 3300025258 Ga0209129_1003170 Ga0209129_10031702 368
268 3300025273 Ga0209673_1000409 Ga0209673_100040926 368
269 3300025273 Ga0209673_1001508 Ga0209673_10015088 368
270 3300025273 Ga0209673_1001874 Ga0209673_100187412 368
271 3300025273 Ga0209673_1001941 Ga0209673_100194113 368
272 3300025273 Ga0209673_1002296 Ga0209673_100229610 368
273 3300025273 Ga0209673_1016721 Ga0209673_10167212 368
274 3300025284 Ga0209130_1000006 Ga0209130_1000006656 368
275 3300025284 Ga0209130_1001144 Ga0209130_10011448 368
276 3300025294 Ga0209025_1001226 Ga0209025_100122622 368
277 3300025294 Ga0209025_1001688 Ga0209025_100168812 368
278 3300025294 Ga0209025_1030877 Ga0209025_10308772 368
279 3300025294 Ga0209025_1049322 Ga0209025_10493222 368
280 3300025295 Ga0209564_1000853 Ga0209564_100085316 368
281 3300025295 Ga0209564_1001099 Ga0209564_100109914 368
282 3300025295 Ga0209564_1001645 Ga0209564_10016459 368
283 3300025297 Ga0209758_1000313 Ga0209758_100031354 368
284 3300025297 Ga0209758_1000624 Ga0209758_100062412 368
285 3300025297 Ga0209758_1006988 Ga0209758_10069883 368
286 3300025297 Ga0209758_1009821 Ga0209758_10098212 368
287 3300025297 Ga0209758_1010849 Ga0209758_10108491 368
288 3300025298 Ga0209050_1001903 Ga0209050_10019034 368
289 3300025299 Ga0209256_1001199 Ga0209256_10011996 368
290 3300025299 Ga0209256_1002645 Ga0209256_10026453 368
291 3300025299 Ga0209256_1003108 Ga0209256_10031083 368
292 3300025299 Ga0209256_1003692 Ga0209256_10036929 368
293 3300025302 Ga0207426_1000044 Ga0207426_10000448 368
294 3300025302 Ga0207426_1000106 Ga0207426_1000106233 368
295 3300025302 Ga0207426_1000743 Ga0207426_10007439 368
296 3300025302 Ga0207426_1001023 Ga0207426_10010239 368
297 3300025303 Ga0209051_1000339 Ga0209051_100033958 368
298 3300025303 Ga0209051_1003095 Ga0209051_10030956 368
299 3300025303 Ga0209051_1012404 Ga0209051_10124041 368
300 3300025303 Ga0209051_1012657 Ga0209051_10126572 368
301 3300025304 Ga0209257_1002795 Ga0209257_10027952 368
302 3300025304 Ga0209257_1011309 Ga0209257_10113091 368
303 3300025735 Ga0207713_1071778 Ga0207713_10717781 368
304 3300028794 Ga0307515_10060134 Ga0307515_100601341 368
305 3300031456 Ga0307513_10015610 Ga0307513_100156103 368
306 3300041413 Ga0439465_0005287 Ga0439465_0005287_2354_3460 368
307 3300041452 Ga0451793_0715311 Ga0451793_0715311_165_1271 368
308 3300041456 Ga0451795_1703054 Ga0451795_1703054_261_1367 368
309 3300041458 Ga0451798_0082363 Ga0451798_0082363_343_1449 368
310 3300041494 Ga0451837_0426827 Ga0451837_0426827_455_1561 368
311 3300041503 Ga0451847_0617606 Ga0451847_0617606_454_1560 368
312 3300046452 Ga0495617_023274 Ga0495617_023274_834_1940 368
313 3300046474 Ga0495605_0000331 Ga0495605_0000331_14872_15978 368
314 3300046501 Ga0495607_0042849 Ga0495607_0042849_874_1980 368
315 3300046501 Ga0495607_0079932 Ga0495607_0079932_248_1354 368
316 3300046506 Ga0495583_0060434 Ga0495583_0060434_422_1528 368
317 3300046507 Ga0495606_0134091 Ga0495606_0134091_171_1370 368
318 3300046512 Ga0495610_0090780 Ga0495610_0090780_200_1306 368
319 3300046513 Ga0495616_0049537 Ga0495616_0049537_64_1170 368
320 3300046513 Ga0495616_0066753 Ga0495616_0066753_167_1273 368
321 3300046518 Ga0495631_0001117 Ga0495631_0001117_976_2082 368
322 3300046518 Ga0495631_0066051 Ga0495631_0066051_134_1240 368
323 3300046519 Ga0495632_0013103 Ga0495632_0013103_773_1879 368
324 3300046519 Ga0495632_0024201 Ga0495632_0024201_790_1989 368
325 3300046530 Ga0495654_0004891 Ga0495654_0004891_1833_2939 368
326 3300046616 Ga0495668_0013455 Ga0495668_0013455_2962_4068 368
327 3300046616 Ga0495668_0054320 Ga0495668_0054320_306_1505 368
328 3300046648 Ga0495611_0010763 Ga0495611_0010763_2199_3305 368
329 3300046660 Ga0495625_0001965 Ga0495625_0001965_9708_10814 368
330 3300046660 Ga0495625_0123980 Ga0495625_0123980_191_1297 368
331 3300046691 Ga0495670_0099952 Ga0495670_0099952_28_1143 368
332 3300046694 Ga0495649_0020153 Ga0495649_0020153_767_1966 368
333 3300046810 Ga0495660_0007221 Ga0495660_0007221_173_1288 368
334 3300046810 Ga0495660_0040478 Ga0495660_0040478_600_1799 368
335 3300047318 Ga0495636_0080097 Ga0495636_0080097_72_1283 368
336 3300047443 Ga0495687_023612 Ga0495687_023612_1289_2461 368
337 3300047443 Ga0495687_040853 Ga0495687_040853_321_1427 368
338 3300047469 Ga0495673_0040097 Ga0495673_0040097_872_1978 368
339 3300048091 Ga0495626_0031639 Ga0495626_0031639_583_1794 368
340 3300048091 Ga0495626_0061246 Ga0495626_0061246_178_1284 368
341 3300048904 Ga0496101_0222365 Ga0496101_0222365_342_1454 368
342 3300048905 Ga0496102_0111838 Ga0496102_0111838_464_1576 368
343 3300048906 Ga0496103_0070456 Ga0496103_0070456_578_1690 368
344 3300048907 Ga0496104_0176401 Ga0496104_0176401_452_1564 368
345 3300048908 Ga0496105_0041007 Ga0496105_0041007_276_1445 368
346 3300048909 Ga0496106_0001004 Ga0496106_0001004_4443_5549 368
347 3300048910 Ga0496107_0095132 Ga0496107_0095132_785_1897 368
348 3300048911 Ga0496108_0179835 Ga0496108_0179835_203_1315 368
349 3300048912 Ga0496109_0262972 Ga0496109_0262972_497_1609 368
350 3300048913 Ga0496110_0068789 Ga0496110_0068789_1741_2853 368
351 3300048914 Ga0496111_0025242 Ga0496111_0025242_2728_3840 368
352 3300048915 Ga0496112_0294717 Ga0496112_0294717_440_1552 368
353 3300048916 Ga0496113_0123730 Ga0496113_0123730_356_1468 368
354 3300048919 Ga0496116_0023048 Ga0496116_0023048_2966_4078 368
355 3300048920 Ga0496117_0096706 Ga0496117_0096706_630_1736 368
356 3300048922 Ga0496119_0029979 Ga0496119_0029979_626_1738 368
357 3300048924 Ga0496121_0009888 Ga0496121_0009888_486_1685 368
358 3300048924 Ga0496121_0118198 Ga0496121_0118198_437_1549 368
359 3300048926 Ga0496123_0065923 Ga0496123_0065923_676_1788 368
360 3300048926 Ga0496123_0066559 Ga0496123_0066559_559_1665 368
361 3300048928 Ga0496125_0130471 Ga0496125_0130471_596_1708 368
362 3300048928 Ga0496125_0139388 Ga0496125_0139388_352_1551 368
363 3300048929 Ga0496126_0057483 Ga0496126_0057483_353_1465 368
364 3300049459 Ga0495678_026078 Ga0495678_026078_390_1601 368
365 3300049460 Ga0495682_0026251 Ga0495682_0026251_906_2012 368
366 3300049569 Ga0501032_0041707 Ga0501032_0041707_1951_3057 368
367 3300049581 Ga0501047_0046300 Ga0501047_0046300_650_1756 368
368 3300050516 nmdc:mga0sz30_43007_c1 nmdc:mga0sz30_43007_c1_627_1733 368
369 3300053079 Ga0500610_0010894 Ga0500610_0010894_2122_3228 368
370 3300053105 Ga0500557_014026 Ga0500557_014026_579_1685 368
371 3300053109 Ga0500569_021971 Ga0500569_021971_134_1240 368
372 3300053109 Ga0500569_034053 Ga0500569_034053_133_1239 368
373 3300053118 Ga0500594_0000738 Ga0500594_0000738_4900_6006 368
374 3300053134 Ga0500658_0001240 Ga0500658_0001240_3283_4389 368
375 3300053134 Ga0500658_0020685 Ga0500658_0020685_616_1722 368
376 3300053140 Ga0500573_0008721 Ga0500573_0008721_1127_2287 368
377 3300053146 Ga0500588_0008401 Ga0500588_0008401_1204_2310 368
378 3300053155 Ga0500620_037503 Ga0500620_037503_156_1262 368
379 3300053156 Ga0500622_0000919 Ga0500622_0000919_15014_16120 368
380 3300053158 Ga0500627_0026582 Ga0500627_0026582_533_1732 368
381 3300053160 Ga0500633_0000113 Ga0500633_0000113_595_1701 368

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00015

MCPsignal

Methyl-accepting chemotaxis protein (MCP) signalling domain

35

177

0.71

Structural Annotation

Top 5 Hits

ID Description Score Start End
4nkg-assembly1.cif.gz_B crystal structure of ssph1 lrr domain in complex pkn1 hr1b domain 0.8187 28 92
5ere-assembly1.cif.gz_A extracellular ligand binding receptor from desulfohalobium retbaense dsm5692 0.8166 113 355
5ltv-assembly1.cif.gz_A ligand binding domain of pseudomonas aeruginosa pao1 amino acid chemorecpetor pctc in complex with gaba 0.8115 110 352
5ltv-assembly1.cif.gz_A ligand binding domain of pseudomonas aeruginosa pao1 amino acid chemorecpetor pctc in complex with gaba 0.7979 110 352
6s1k-assembly1.cif.gz_F e. coli core signaling unit, carrying qqqq receptor mutation 0.7849 23 104
ID Description Score Start End Superfamily
3by9B02 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;PAS domain 0.9008 132 260 3.30.450.20
3by9B02 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;PAS domain 0.88 132 260 3.30.450.20
3fosB02 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;PAS domain 0.8685 157 262 3.30.450.20
3e4pA02 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;PAS domain 0.8304 174 262 3.30.450.20
3fosB02 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;PAS domain 0.8283 157 262 3.30.450.20
ID Description Score Start End GO Terms
AF-K0W7U1-F1-model_v4 Methyl-accepting chemotaxis sensory transducer 0.9769 111 368
AF-A0A7W6U7M9-F1-model_v4 deleted 0.9701 180 368
AF-K0W7U1-F1-model_v4 Methyl-accepting chemotaxis sensory transducer 0.9695 111 368
AF-A0A6J4FJI7-F1-model_v4 Putative Methyl-accepting chemotaxis protein 0.962 17 105 GO:0004888
GO:0006935
GO:0007165
GO:0016020
AF-A0A0P9MFN8-F1-model_v4 Uncharacterized protein 0.9605 108 356

Feature Viewer

pLDDT pTM Quality
84.06 0.68 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map