F429013

General Info

Members Datasets Scaffolds Average Seq Length
381 243 762 105

Family's Representative Sequence

Representative Sequence 3300037312|Ga0395899_0341867|Ga0395899_0341867_464_844
Length 126
Sequence LNRKPPKNAGGDRPDGPKRGGFGANRKPPDPKAAAKRAALNALKRAKRQADRAGVKLSDWEGEFLGSVADRLKTYGRAFGDPEKGAPGQALSAMQTVKLKEIAAKAKGEKKDLKRRPFRRRPKDSA

Samples

Sample ID Description Type Environment
1 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
14 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
17 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
18 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
19 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
20 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
21 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
24 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
25 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
26 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
27 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
28 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
29 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
30 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
31 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
32 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
33 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
34 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
35 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
36 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
37 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
38 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
40 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
41 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
42 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
43 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
44 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
45 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
46 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
47 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
48 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
49 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
50 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
51 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
52 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
53 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
54 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
55 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
56 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
57 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
58 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
59 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
60 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
61 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
96 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
97 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
102 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
103 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
104 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
105 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
106 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
107 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
108 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
109 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
110 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
111 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
112 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
113 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
114 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
115 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
116 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
117 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
118 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
119 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
120 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
121 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
122 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
123 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
124 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
125 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
126 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
127 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
128 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
129 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
130 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
131 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
132 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
133 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
134 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
135 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
136 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
137 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
138 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
139 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
140 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
141 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
142 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
143 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
144 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
145 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
146 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
147 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
148 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
149 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
150 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
151 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
152 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
153 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
154 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
155 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
156 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
157 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
158 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
159 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
160 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
161 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
162 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
163 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
164 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
165 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
166 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
167 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
168 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
169 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
170 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
171 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
172 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
173 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
174 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
175 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
176 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
177 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
178 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
179 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
180 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
181 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
182 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
183 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
184 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
185 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
186 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
187 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
188 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
189 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
190 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
191 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
192 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
193 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
200 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
201 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
203 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
204 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
205 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
206 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
207 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
208 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
209 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
210 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
211 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
212 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
213 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
214 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
215 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
216 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
217 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
218 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
219 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
220 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
221 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
222 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
223 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
224 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
225 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
226 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
227 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
228 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
229 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
230 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
231 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
232 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
233 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
234 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
235 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
236 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
237 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
238 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
239 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
240 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
241 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
242 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
243 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.65
Nodule 0
Rhizoplane 6.56
Rhizosphere 75.59
Stem 0
Stem Tuber 0
Unclassified 2.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395899_0341867 3300037312 Bacteria 1003
2 rootH2_10173225 3300003320 Bacteria 1736
3 Ga0065715_10804737 3300005293 Bacteria 608
4 Ga0070683_100497127 3300005329 Bacteria 1165
5 Ga0070670_100030354 3300005331 Bacteria 4655
6 Ga0070670_100266702 3300005331 Bacteria 1493
7 Ga0070691_10361450 3300005341 Bacteria 809
8 Ga0070668_100001146 3300005347 Bacteria 18666
9 Ga0070668_100001381 3300005347 Bacteria 17424
10 Ga0070668_100012142 3300005347 Bacteria 6415
11 Ga0070675_101961249 3300005354 Bacteria 540
12 Ga0070671_100041969 3300005355 Bacteria 3802
13 Ga0070671_100310213 3300005355 Bacteria 1344
14 Ga0070671_100415751 3300005355 Bacteria 1151
15 Ga0070673_101161415 3300005364 Bacteria 722
16 Ga0070667_100001821 3300005367 Bacteria 19005
17 Ga0070667_100005766 3300005367 Bacteria 10338
18 Ga0070711_100053142 3300005439 Bacteria 2790
19 Ga0070678_100038365 3300005456 Bacteria 3372
20 Ga0070698_101036366 3300005471 Unclassified 768
21 Ga0070679_100291059 3300005530 Bacteria 1585
22 Ga0068853_100981297 3300005539 Bacteria 813
23 Ga0070665_100004010 3300005548 Bacteria 15526
24 Ga0070665_100042532 3300005548 Bacteria 4567
25 Ga0068855_100672983 3300005563 Bacteria 1110
26 Ga0070664_100386253 3300005564 Bacteria 1279
27 Ga0068857_100463712 3300005577 Bacteria 1186
28 Ga0068857_100568867 3300005577 Bacteria 1069
29 Ga0068854_101882579 3300005578 Bacteria 550
30 Ga0068856_100544572 3300005614 Bacteria 1182
31 Ga0068852_100583703 3300005616 Bacteria 1121
32 Ga0068852_101511170 3300005616 Bacteria 694
33 Ga0068859_100020220 3300005617 Bacteria 6683
34 Ga0068859_101009080 3300005617 Bacteria 914
35 Ga0068859_101459051 3300005617 Bacteria 755
36 Ga0068864_100000093 3300005618 Bacteria 93540
37 Ga0068864_100028239 3300005618 Bacteria 4740
38 Ga0068864_100321453 3300005618 Bacteria 1453
39 Ga0068864_100803148 3300005618 Bacteria 925
40 Ga0068861_100713781 3300005719 Bacteria 933
41 Ga0068863_100000045 3300005841 Bacteria 147269
42 Ga0068863_100017299 3300005841 Bacteria 6915
43 Ga0068863_100142719 3300005841 Bacteria 2289
44 Ga0068863_100479435 3300005841 Bacteria 1223
45 Ga0068863_100849591 3300005841 Bacteria 912
46 Ga0068858_100000144 3300005842 Bacteria 75375
47 Ga0068858_100045160 3300005842 Bacteria 4083
48 Ga0068858_102006866 3300005842 Bacteria 572
49 Ga0068860_100000037 3300005843 Bacteria 234524
50 Ga0068860_100067245 3300005843 Bacteria 3406
51 Ga0068860_100312591 3300005843 Bacteria 1541
52 Ga0068862_100056805 3300005844 Bacteria 3354
53 Ga0068862_100070058 3300005844 Bacteria 3027
54 Ga0070717_11665462 3300006028 Bacteria 578
55 Ga0075365_10130541 3300006038 Bacteria 1738
56 Ga0075363_100057869 3300006048 Bacteria 2081
57 Ga0075362_10605523 3300006177 Bacteria 566
58 Ga0075369_10260565 3300006186 Bacteria 806
59 Ga0075366_10138881 3300006195 Bacteria 1468
60 Ga0068871_101356662 3300006358 Bacteria 670
61 Ga0097620_100020219 3300006931 Bacteria 6683
62 Ga0097620_101009097 3300006931 Bacteria 914
63 Ga0097620_101458551 3300006931 Bacteria 755
64 Ga0105251_10420288 3300009011 Bacteria 616
65 Ga0105250_10009730 3300009092 Bacteria 4037
66 Ga0105240_10026066 3300009093 Bacteria 7675
67 Ga0105240_10319148 3300009093 Bacteria 1771
68 Ga0105240_10371973 3300009093 Bacteria 1616
69 Ga0105240_10567960 3300009093 Bacteria 1253
70 Ga0105240_11628425 3300009093 Bacteria 675
71 Ga0105240_12165211 3300009093 Bacteria 577
72 Ga0105245_10746248 3300009098 Bacteria 1014
73 Ga0105247_10114892 3300009101 Bacteria 1736
74 Ga0105241_10194660 3300009174 Bacteria 1689
75 Ga0105241_10340354 3300009174 Bacteria 1299
76 Ga0105241_10668067 3300009174 Bacteria 945
77 Ga0105241_12369981 3300009174 Bacteria 529
78 Ga0105248_10000001 3300009177 Bacteria 1881304
79 Ga0105248_10004878 3300009177 Bacteria 14832
80 Ga0105248_10016234 3300009177 Bacteria 8196
81 Ga0105248_10158492 3300009177 Bacteria 2554
82 Ga0105248_10202064 3300009177 Bacteria 2239
83 Ga0105248_13154421 3300009177 Unclassified 525
84 Ga0105237_10752520 3300009545 Bacteria 981
85 Ga0105237_10911736 3300009545 Bacteria 886
86 Ga0105238_10012001 3300009551 Bacteria 8727
87 Ga0105238_10137657 3300009551 Bacteria 2419
88 Ga0105238_10424193 3300009551 Bacteria 1325
89 Ga0105249_10313794 3300009553 Bacteria 1577
90 Ga0105239_10438294 3300010375 Bacteria 1481
91 Ga0105239_11238470 3300010375 Bacteria 860
92 Ga0157373_10001886 3300013100 Bacteria 15903
93 Ga0157370_10177730 3300013104 Bacteria 1978
94 Ga0157369_11236481 3300013105 Bacteria 762
95 Ga0157378_11809300 3300013297 Bacteria 659
96 Ga0163162_10104620 3300013306 Bacteria 2925
97 Ga0163162_10516655 3300013306 Bacteria 1324
98 Ga0157372_10787167 3300013307 Bacteria 1105
99 Ga0157375_10235384 3300013308 Bacteria 1990
100 Ga0163163_10055521 3300014325 Bacteria 3915
101 Ga0163163_11376007 3300014325 Bacteria 767
102 Ga0182008_10225844 3300014497 Bacteria 959
103 Ga0182008_10660472 3300014497 Bacteria 593
104 Ga0157379_10010991 3300014968 Bacteria 7894
105 Ga0157379_10034604 3300014968 Bacteria 4504
106 Ga0209026_1002595 3300025250 Bacteria 6633
107 Ga0207710_10090582 3300025900 Bacteria 1430
108 Ga0207699_10586105 3300025906 Unclassified 811
109 Ga0207643_10076272 3300025908 Bacteria 1936
110 Ga0207705_10630415 3300025909 Bacteria 834
111 Ga0207684_11000659 3300025910 Bacteria 699
112 Ga0207684_11540096 3300025910 Unclassified 540
113 Ga0207654_10110438 3300025911 Bacteria 1710
114 Ga0207695_10002171 3300025913 Bacteria 29661
115 Ga0207695_10467881 3300025913 Bacteria 1143
116 Ga0207671_10160947 3300025914 Bacteria 1738
117 Ga0207671_10297842 3300025914 Bacteria 1274
118 Ga0207663_10041345 3300025916 Bacteria 2809
119 Ga0207652_10633512 3300025921 Bacteria 957
120 Ga0207694_10007455 3300025924 Bacteria 8292
121 Ga0207694_10063315 3300025924 Bacteria 2881
122 Ga0207650_10230791 3300025925 Bacteria 1493
123 Ga0207650_10631306 3300025925 Bacteria 902
124 Ga0207687_10581257 3300025927 Bacteria 942
125 Ga0207644_10352552 3300025931 Bacteria 1195
126 Ga0207706_11289630 3300025933 Bacteria 604
127 Ga0207711_10000001 3300025941 Bacteria 1325674
128 Ga0207711_10002325 3300025941 Bacteria 17032
129 Ga0207711_10004391 3300025941 Bacteria 12027
130 Ga0207711_10019610 3300025941 Bacteria 5629
131 Ga0207711_10425258 3300025941 Bacteria 1236
132 Ga0207711_10630029 3300025941 Bacteria 1001
133 Ga0207689_10725480 3300025942 Bacteria 838
134 Ga0207689_11260509 3300025942 Bacteria 622
135 Ga0207661_11651661 3300025944 Bacteria 586
136 Ga0207661_11862363 3300025944 Bacteria 547
137 Ga0207679_10041319 3300025945 Bacteria 3306
138 Ga0207679_10497634 3300025945 Bacteria 1087
139 Ga0207667_10264280 3300025949 Bacteria 1760
140 Ga0207667_10435651 3300025949 Bacteria 1333
141 Ga0207667_10654549 3300025949 Bacteria 1056
142 Ga0207667_11862601 3300025949 Bacteria 564
143 Ga0207651_10181749 3300025960 Bacteria 1669
144 Ga0207712_10212574 3300025961 Bacteria 1541
145 Ga0207712_10966345 3300025961 Bacteria 755
146 Ga0207668_10000010 3300025972 Bacteria 185249
147 Ga0207668_10003238 3300025972 Bacteria 9541
148 Ga0207668_10013095 3300025972 Bacteria 5098
149 Ga0207640_11633536 3300025981 Bacteria 581
150 Ga0207658_10000935 3300025986 Bacteria 24111
151 Ga0207658_10001721 3300025986 Bacteria 16535
152 Ga0207658_10903247 3300025986 Bacteria 804
153 Ga0207658_11684921 3300025986 Bacteria 579
154 Ga0207703_10000557 3300026035 Bacteria 38274
155 Ga0207703_10023419 3300026035 Bacteria 4850
156 Ga0207703_10899819 3300026035 Bacteria 847
157 Ga0207639_10360012 3300026041 Bacteria 1302
158 Ga0207639_10679554 3300026041 Bacteria 954
159 Ga0207678_11441471 3300026067 Bacteria 608
160 Ga0207702_10538632 3300026078 Bacteria 1141
161 Ga0207702_11057086 3300026078 Bacteria 806
162 Ga0207702_11190335 3300026078 Bacteria 756
163 Ga0207641_10000011 3300026088 Bacteria 384362
164 Ga0207641_10030208 3300026088 Bacteria 4487
165 Ga0207641_10032081 3300026088 Bacteria 4361
166 Ga0207676_10000114 3300026095 Bacteria 71881
167 Ga0207676_10037391 3300026095 Bacteria 3699
168 Ga0207674_10441947 3300026116 Bacteria 1257
169 Ga0207675_100009581 3300026118 Bacteria 9060
170 Ga0207683_10057853 3300026121 Bacteria 3403
171 Ga0209981_1007625 3300027378 Bacteria 1462
172 Ga0209999_1000345 3300027543 Bacteria 7012
173 Ga0209983_1011659 3300027665 Bacteria 1799
174 Ga0268266_10001030 3300028379 Bacteria 35113
175 Ga0268266_10069460 3300028379 Bacteria 3052
176 Ga0268265_10014440 3300028380 Bacteria 5381
177 Ga0268265_10109984 3300028380 Bacteria 2247
178 Ga0268265_10431309 3300028380 Bacteria 1226
179 Ga0268264_10000002 3300028381 Bacteria 1153045
180 Ga0268264_10063434 3300028381 Bacteria 3105
181 Ga0268264_10629522 3300028381 Bacteria 1060
182 Ga0265318_10388023 3300028577 Unclassified 510
183 Ga0307517_10097350 3300028786 Bacteria 2350
184 Ga0307517_10500911 3300028786 Bacteria 618
185 Ga0265340_10000401 3300031247 Bacteria 23235
186 Ga0265340_10059684 3300031247 Bacteria 1829
187 Ga0265339_10332542 3300031249 Bacteria 719
188 Ga0265339_10371121 3300031249 Unclassified 672
189 Ga0307513_10000203 3300031456 Bacteria 85712
190 Ga0307513_10089307 3300031456 Bacteria 3146
191 Ga0307408_100443823 3300031548 Bacteria 1124
192 Ga0307408_101161076 3300031548 Bacteria 719
193 Ga0265342_10027694 3300031712 Bacteria 3536
194 Ga0265342_10583048 3300031712 Bacteria 565
195 Ga0307516_10000001 3300031730 Bacteria 510338
196 Ga0307413_11267792 3300031824 Bacteria 643
197 Ga0307406_10369664 3300031901 Bacteria 1127
198 Ga0307416_101472155 3300032002 Bacteria 787
199 Ga0307416_101982002 3300032002 Bacteria 685
200 Ga0307510_10001043 3300033180 Bacteria 29378
201 Ga0373936_0020704 3300035113 Bacteria 2556
202 Ga0373945_0161509 3300035116 Bacteria 913
203 Ga0373943_0014062 3300035170 Bacteria 3619
204 Ga0373943_0192222 3300035170 Bacteria 1126
205 Ga0373935_0020861 3300035692 Bacteria 4009
206 Ga0373927_0002828 3300035695 Bacteria 12661
207 Ga0373927_0332556 3300035695 Bacteria 1001
208 Ga0373927_0388301 3300035695 Bacteria 921
209 Ga0373947_0295943 3300035725 Bacteria 1078
210 Ga0373937_0341322 3300036401 Bacteria 1418
211 Ga0373925_0000089 3300037068 Bacteria 98449
212 Ga0395899_0943692 3300037312 Bacteria 523
213 Ga0395899_0984225 3300037312 Bacteria 509
214 Ga0395900_0178880 3300037418 Bacteria 2156
215 Ga0395898_0119461 3300037466 Bacteria 2525
216 Ga0395898_1061157 3300037466 Bacteria 744
217 Ga0395898_1260161 3300037466 Bacteria 669
218 Ga0395905_0013756 3300037471 Bacteria 7747
219 Ga0395905_0098753 3300037471 Bacteria 2742
220 Ga0395905_0337749 3300037471 Bacteria 1397
221 Ga0436364_0068534 3300037853 Bacteria 2428
222 Ga0395901_0331805 3300038443 Bacteria 1572
223 Ga0395901_0479690 3300038443 Bacteria 1268
224 Ga0395901_0746002 3300038443 Bacteria 972
225 Ga0395901_0870924 3300038443 Bacteria 884
226 Ga0237816_04725 3300039145 Bacteria 935
227 Ga0451807_0042040 3300041486 Bacteria 815
228 Ga0451807_1179133 3300041486 Bacteria 534
229 Ga0466961_0055299 3300044693 Bacteria 2531
230 Ga0466964_0109054 3300044706 Bacteria 1232
231 Ga0466970_0498152 3300044765 Bacteria 701
232 Ga0451576_0760077 3300045051 Unclassified 1018
233 Ga0466958_0954093 3300045836 Bacteria 560
234 Ga0495592_0175909 3300046454 Bacteria 1462
235 Ga0495603_0388640 3300046455 Bacteria 800
236 Ga0495629_0014376 3300046459 Bacteria 5694
237 Ga0495651_0301888 3300046462 Bacteria 1074
238 Ga0495664_0028035 3300046477 Bacteria 3287
239 Ga0495585_0104801 3300046492 Bacteria 1509
240 Ga0495594_0815421 3300046499 Bacteria 526
241 Ga0495583_0049685 3300046506 Bacteria 1919
242 Ga0495606_0049944 3300046507 Bacteria 2740
243 Ga0495608_0609124 3300046511 Bacteria 655
244 Ga0495610_0130581 3300046512 Bacteria 1091
245 Ga0495618_0520862 3300046514 Bacteria 715
246 Ga0495620_0036871 3300046515 Bacteria 2183
247 Ga0495628_0477524 3300046516 Bacteria 902
248 Ga0495643_0030988 3300046522 Bacteria 2980
249 Ga0495648_0486394 3300046524 Bacteria 532
250 Ga0495642_0004863 3300046528 Bacteria 5192
251 Ga0495642_0093544 3300046528 Bacteria 1274
252 Ga0495642_0464874 3300046528 Bacteria 559
253 Ga0495665_0489233 3300046531 Bacteria 620
254 Ga0495598_0106823 3300046537 Bacteria 933
255 Ga0495609_0008712 3300046538 Bacteria 4947
256 Ga0495621_0041225 3300046539 Bacteria 1620
257 Ga0495597_0001663 3300046542 Bacteria 15479
258 Ga0495597_0265400 3300046542 Bacteria 672
259 Ga0495645_0046417 3300046543 Bacteria 3166
260 Ga0495667_0549082 3300046559 Unclassified 722
261 Ga0495668_0036794 3300046616 Bacteria 2741
262 Ga0495668_0045226 3300046616 Bacteria 2447
263 Ga0495668_0052894 3300046616 Bacteria 2246
264 Ga0495611_0041424 3300046648 Bacteria 2054
265 Ga0495625_0049755 3300046660 Bacteria 3011
266 Ga0495625_0097284 3300046660 Bacteria 2026
267 Ga0495625_0236119 3300046660 Bacteria 1192
268 Ga0495661_0442186 3300046665 Bacteria 627
269 Ga0495588_0265505 3300046674 Bacteria 904
270 Ga0495669_0014038 3300046684 Bacteria 3423
271 Ga0495669_0021672 3300046684 Bacteria 2791
272 Ga0495624_0072042 3300046690 Bacteria 2150
273 Ga0495660_0175186 3300046810 Bacteria 1042
274 Ga0495581_0466576 3300047315 Bacteria 735
275 Ga0495581_0631260 3300047315 Bacteria 620
276 Ga0495604_0735044 3300047317 Bacteria 625
277 Ga0495636_0031897 3300047318 Bacteria 2161
278 Ga0495680_0711699 3300047322 Bacteria 662
279 Ga0495687_095436 3300047443 Bacteria 1128
280 Ga0495687_098475 3300047443 Bacteria 1103
281 Ga0495675_0152677 3300047444 Bacteria 1426
282 Ga0495677_0100965 3300047445 Bacteria 1092
283 Ga0495686_0178012 3300047472 Bacteria 1234
284 Ga0495593_0019419 3300047673 Bacteria 3811
285 Ga0495615_0156080 3300048090 Bacteria 682
286 Ga0496100_0319797 3300048903 Bacteria 1165
287 Ga0496100_0337554 3300048903 Bacteria 1136
288 Ga0496101_0102881 3300048904 Bacteria 2140
289 Ga0496101_0560684 3300048904 Bacteria 903
290 Ga0496101_1458233 3300048904 Bacteria 533
291 Ga0496101_1595797 3300048904 Bacteria 507
292 Ga0496102_0067731 3300048905 Bacteria 3275
293 Ga0496106_0120547 3300048909 Bacteria 2050
294 Ga0496106_0420399 3300048909 Bacteria 1074
295 Ga0496106_0838919 3300048909 Bacteria 728
296 Ga0496106_1254456 3300048909 Bacteria 577
297 Ga0496107_0398331 3300048910 Bacteria 1024
298 Ga0496108_0577089 3300048911 Bacteria 980
299 Ga0496109_0405265 3300048912 Bacteria 1288
300 Ga0496110_0040915 3300048913 Bacteria 4042
301 Ga0496111_0261960 3300048914 Bacteria 1283
302 Ga0496111_1101254 3300048914 Bacteria 566
303 Ga0496112_0031571 3300048915 Bacteria 5140
304 Ga0496112_0152230 3300048915 Bacteria 2280
305 Ga0496112_0594731 3300048915 Bacteria 1038
306 Ga0496115_0000050 3300048918 Bacteria 109402
307 Ga0496115_0042883 3300048918 Bacteria 3606
308 Ga0496115_0730690 3300048918 Bacteria 776
309 Ga0496116_0199788 3300048919 Bacteria 1048
310 Ga0496117_0181024 3300048920 Bacteria 1211
311 Ga0496118_0009384 3300048921 Bacteria 9899
312 Ga0496119_0038927 3300048922 Bacteria 3063
313 Ga0496120_0132143 3300048923 Bacteria 1277
314 Ga0496121_0000442 3300048924 Bacteria 81890
315 Ga0501298_088084 3300049521 Bacteria 692
316 Ga0501033_0016730 3300049570 Bacteria 5547
317 Ga0501036_0919216 3300049572 Bacteria 718
318 Ga0501037_0756336 3300049573 Bacteria 644
319 Ga0501043_0468078 3300049579 Bacteria 945
320 Ga0501043_0928466 3300049579 Bacteria 623
321 Ga0501047_0030043 3300049581 Bacteria 5239
322 Ga0501047_0145091 3300049581 Bacteria 2251
323 Ga0501047_0765281 3300049581 Bacteria 781
324 Ga0501047_0837419 3300049581 Bacteria 734
325 Ga0501048_0309468 3300049582 Bacteria 1124
326 Ga0501067_0490790 3300049583 Bacteria 687
327 Ga0501225_0186563 3300049705 Bacteria 651
328 Ga0501035_0050795 3300049822 Bacteria 3715
329 Ga0501035_1188981 3300049822 Bacteria 592
330 Ga0501044_0012686 3300049823 Bacteria 9127
331 Ga0501044_0247772 3300049823 Bacteria 1724
332 Ga0501044_0693841 3300049823 Bacteria 904
333 nmdc:mga03683_409346_c1 3300050489 Bacteria 648
334 nmdc:mga0yw44_117220_c1 3300050492 Bacteria 1712
335 nmdc:mga0k408_621694_c1 3300050493 Bacteria 636
336 nmdc:mga07m45_260722_c1 3300050496 Bacteria 1008
337 nmdc:mga0rr50_75640_c1 3300050513 Unclassified 2582
338 nmdc:mga08x19_182013_c1 3300050514 Bacteria 1435
339 nmdc:mga0sz30_400160_c1 3300050516 Bacteria 615
340 Ga0500635_0000125 3300053080 Bacteria 45357
341 Ga0500643_011473 3300053087 Bacteria 3231
342 Ga0500647_0085877 3300053091 Bacteria 1508
343 Ga0500583_0065054 3300053092 Bacteria 1731
344 Ga0500651_0084128 3300053093 Bacteria 1967
345 Ga0500566_0213573 3300053094 Bacteria 964
346 Ga0500641_0001188 3300053096 Bacteria 9281
347 Ga0500556_0004358 3300053104 Bacteria 4032
348 Ga0500556_0362276 3300053104 Bacteria 560
349 Ga0500557_006327 3300053105 Bacteria 2672
350 Ga0500562_000295 3300053108 Bacteria 12157
351 Ga0500562_002219 3300053108 Bacteria 4858
352 Ga0500562_036250 3300053108 Bacteria 1307
353 Ga0500569_001965 3300053109 Bacteria 3986
354 Ga0500595_005928 3300053119 Bacteria 5260
355 Ga0500607_029845 3300053121 Bacteria 3010
356 Ga0500608_006300 3300053122 Bacteria 4817
357 Ga0500614_002367 3300053123 Bacteria 4215
358 Ga0500642_0068139 3300053130 Bacteria 1614
359 Ga0500655_053000 3300053133 Bacteria 810
360 Ga0500658_0086450 3300053134 Bacteria 1349
361 Ga0500559_0015176 3300053136 Bacteria 3255
362 Ga0500590_037614 3300053148 Bacteria 2499
363 Ga0500603_013977 3300053150 Bacteria 1869
364 Ga0500616_0067922 3300053153 Bacteria 1826
365 Ga0500616_0085399 3300053153 Bacteria 1576
366 Ga0500616_0346034 3300053153 Bacteria 606
367 Ga0500619_048741 3300053154 Bacteria 1365
368 Ga0500620_152638 3300053155 Bacteria 804
369 Ga0500622_0016892 3300053156 Bacteria 3892
370 Ga0500622_0019327 3300053156 Bacteria 3619
371 Ga0500622_0172038 3300053156 Bacteria 1007
372 Ga0500638_157073 3300053162 Bacteria 1005
373 Ga0500638_356088 3300053162 Bacteria 541
374 Ga0500636_0001698 3300053177 Bacteria 12056
375 Ga0500637_0007555 3300053178 Bacteria 5441
376 Ga0500576_148707 3300053725 Bacteria 878
377 Ga0500625_047170 3300053729 Bacteria 2005
378 Ga0500645_000604 3300053730 Bacteria 23015
379 Ga0500552_010274 3300053733 Bacteria 1150
380 Ga0500596_003407 3300053735 Bacteria 3027
381 Ga0500601_001278 3300053737 Bacteria 2791
382 Ga0395899_0341867
383 rootH2_10173225
384 Ga0065715_10804737
385 Ga0070683_100497127
386 Ga0070670_100030354
387 Ga0070670_100266702
388 Ga0070691_10361450
389 Ga0070668_100001146
390 Ga0070668_100001381
391 Ga0070668_100012142
392 Ga0070675_101961249
393 Ga0070671_100041969
394 Ga0070671_100310213
395 Ga0070671_100415751
396 Ga0070673_101161415
397 Ga0070667_100001821
398 Ga0070667_100005766
399 Ga0070711_100053142
400 Ga0070678_100038365
401 Ga0070698_101036366
402 Ga0070679_100291059
403 Ga0068853_100981297
404 Ga0070665_100004010
405 Ga0070665_100042532
406 Ga0068855_100672983
407 Ga0070664_100386253
408 Ga0068857_100463712
409 Ga0068857_100568867
410 Ga0068854_101882579
411 Ga0068856_100544572
412 Ga0068852_100583703
413 Ga0068852_101511170
414 Ga0068859_100020220
415 Ga0068859_101009080
416 Ga0068859_101459051
417 Ga0068864_100000093
418 Ga0068864_100028239
419 Ga0068864_100321453
420 Ga0068864_100803148
421 Ga0068861_100713781
422 Ga0068863_100000045
423 Ga0068863_100017299
424 Ga0068863_100142719
425 Ga0068863_100479435
426 Ga0068863_100849591
427 Ga0068858_100000144
428 Ga0068858_100045160
429 Ga0068858_102006866
430 Ga0068860_100000037
431 Ga0068860_100067245
432 Ga0068860_100312591
433 Ga0068862_100056805
434 Ga0068862_100070058
435 Ga0070717_11665462
436 Ga0075365_10130541
437 Ga0075363_100057869
438 Ga0075362_10605523
439 Ga0075369_10260565
440 Ga0075366_10138881
441 Ga0068871_101356662
442 Ga0097620_100020219
443 Ga0097620_101009097
444 Ga0097620_101458551
445 Ga0105251_10420288
446 Ga0105250_10009730
447 Ga0105240_10026066
448 Ga0105240_10319148
449 Ga0105240_10371973
450 Ga0105240_10567960
451 Ga0105240_11628425
452 Ga0105240_12165211
453 Ga0105245_10746248
454 Ga0105247_10114892
455 Ga0105241_10194660
456 Ga0105241_10340354
457 Ga0105241_10668067
458 Ga0105241_12369981
459 Ga0105248_10000001
460 Ga0105248_10004878
461 Ga0105248_10016234
462 Ga0105248_10158492
463 Ga0105248_10202064
464 Ga0105248_13154421
465 Ga0105237_10752520
466 Ga0105237_10911736
467 Ga0105238_10012001
468 Ga0105238_10137657
469 Ga0105238_10424193
470 Ga0105249_10313794
471 Ga0105239_10438294
472 Ga0105239_11238470
473 Ga0157373_10001886
474 Ga0157370_10177730
475 Ga0157369_11236481
476 Ga0157378_11809300
477 Ga0163162_10104620
478 Ga0163162_10516655
479 Ga0157372_10787167
480 Ga0157375_10235384
481 Ga0163163_10055521
482 Ga0163163_11376007
483 Ga0182008_10225844
484 Ga0182008_10660472
485 Ga0157379_10010991
486 Ga0157379_10034604
487 Ga0209026_1002595
488 Ga0207710_10090582
489 Ga0207699_10586105
490 Ga0207643_10076272
491 Ga0207705_10630415
492 Ga0207684_11000659
493 Ga0207684_11540096
494 Ga0207654_10110438
495 Ga0207695_10002171
496 Ga0207695_10467881
497 Ga0207671_10160947
498 Ga0207671_10297842
499 Ga0207663_10041345
500 Ga0207652_10633512
501 Ga0207694_10007455
502 Ga0207694_10063315
503 Ga0207650_10230791
504 Ga0207650_10631306
505 Ga0207687_10581257
506 Ga0207644_10352552
507 Ga0207706_11289630
508 Ga0207711_10000001
509 Ga0207711_10002325
510 Ga0207711_10004391
511 Ga0207711_10019610
512 Ga0207711_10425258
513 Ga0207711_10630029
514 Ga0207689_10725480
515 Ga0207689_11260509
516 Ga0207661_11651661
517 Ga0207661_11862363
518 Ga0207679_10041319
519 Ga0207679_10497634
520 Ga0207667_10264280
521 Ga0207667_10435651
522 Ga0207667_10654549
523 Ga0207667_11862601
524 Ga0207651_10181749
525 Ga0207712_10212574
526 Ga0207712_10966345
527 Ga0207668_10000010
528 Ga0207668_10003238
529 Ga0207668_10013095
530 Ga0207640_11633536
531 Ga0207658_10000935
532 Ga0207658_10001721
533 Ga0207658_10903247
534 Ga0207658_11684921
535 Ga0207703_10000557
536 Ga0207703_10023419
537 Ga0207703_10899819
538 Ga0207639_10360012
539 Ga0207639_10679554
540 Ga0207678_11441471
541 Ga0207702_10538632
542 Ga0207702_11057086
543 Ga0207702_11190335
544 Ga0207641_10000011
545 Ga0207641_10030208
546 Ga0207641_10032081
547 Ga0207676_10000114
548 Ga0207676_10037391
549 Ga0207674_10441947
550 Ga0207675_100009581
551 Ga0207683_10057853
552 Ga0209981_1007625
553 Ga0209999_1000345
554 Ga0209983_1011659
555 Ga0268266_10001030
556 Ga0268266_10069460
557 Ga0268265_10014440
558 Ga0268265_10109984
559 Ga0268265_10431309
560 Ga0268264_10000002
561 Ga0268264_10063434
562 Ga0268264_10629522
563 Ga0265318_10388023
564 Ga0307517_10097350
565 Ga0307517_10500911
566 Ga0265340_10000401
567 Ga0265340_10059684
568 Ga0265339_10332542
569 Ga0265339_10371121
570 Ga0307513_10000203
571 Ga0307513_10089307
572 Ga0307408_100443823
573 Ga0307408_101161076
574 Ga0265342_10027694
575 Ga0265342_10583048
576 Ga0307516_10000001
577 Ga0307413_11267792
578 Ga0307406_10369664
579 Ga0307416_101472155
580 Ga0307416_101982002
581 Ga0307510_10001043
582 Ga0373936_0020704
583 Ga0373945_0161509
584 Ga0373943_0014062
585 Ga0373943_0192222
586 Ga0373935_0020861
587 Ga0373927_0002828
588 Ga0373927_0332556
589 Ga0373927_0388301
590 Ga0373947_0295943
591 Ga0373937_0341322
592 Ga0373925_0000089
593 Ga0395899_0943692
594 Ga0395899_0984225
595 Ga0395900_0178880
596 Ga0395898_0119461
597 Ga0395898_1061157
598 Ga0395898_1260161
599 Ga0395905_0013756
600 Ga0395905_0098753
601 Ga0395905_0337749
602 Ga0436364_0068534
603 Ga0395901_0331805
604 Ga0395901_0479690
605 Ga0395901_0746002
606 Ga0395901_0870924
607 Ga0237816_04725
608 Ga0451807_0042040
609 Ga0451807_1179133
610 Ga0466961_0055299
611 Ga0466964_0109054
612 Ga0466970_0498152
613 Ga0451576_0760077
614 Ga0466958_0954093
615 Ga0495592_0175909
616 Ga0495603_0388640
617 Ga0495629_0014376
618 Ga0495651_0301888
619 Ga0495664_0028035
620 Ga0495585_0104801
621 Ga0495594_0815421
622 Ga0495583_0049685
623 Ga0495606_0049944
624 Ga0495608_0609124
625 Ga0495610_0130581
626 Ga0495618_0520862
627 Ga0495620_0036871
628 Ga0495628_0477524
629 Ga0495643_0030988
630 Ga0495648_0486394
631 Ga0495642_0004863
632 Ga0495642_0093544
633 Ga0495642_0464874
634 Ga0495665_0489233
635 Ga0495598_0106823
636 Ga0495609_0008712
637 Ga0495621_0041225
638 Ga0495597_0001663
639 Ga0495597_0265400
640 Ga0495645_0046417
641 Ga0495667_0549082
642 Ga0495668_0036794
643 Ga0495668_0045226
644 Ga0495668_0052894
645 Ga0495611_0041424
646 Ga0495625_0049755
647 Ga0495625_0097284
648 Ga0495625_0236119
649 Ga0495661_0442186
650 Ga0495588_0265505
651 Ga0495669_0014038
652 Ga0495669_0021672
653 Ga0495624_0072042
654 Ga0495660_0175186
655 Ga0495581_0466576
656 Ga0495581_0631260
657 Ga0495604_0735044
658 Ga0495636_0031897
659 Ga0495680_0711699
660 Ga0495687_095436
661 Ga0495687_098475
662 Ga0495675_0152677
663 Ga0495677_0100965
664 Ga0495686_0178012
665 Ga0495593_0019419
666 Ga0495615_0156080
667 Ga0496100_0319797
668 Ga0496100_0337554
669 Ga0496101_0102881
670 Ga0496101_0560684
671 Ga0496101_1458233
672 Ga0496101_1595797
673 Ga0496102_0067731
674 Ga0496106_0120547
675 Ga0496106_0420399
676 Ga0496106_0838919
677 Ga0496106_1254456
678 Ga0496107_0398331
679 Ga0496108_0577089
680 Ga0496109_0405265
681 Ga0496110_0040915
682 Ga0496111_0261960
683 Ga0496111_1101254
684 Ga0496112_0031571
685 Ga0496112_0152230
686 Ga0496112_0594731
687 Ga0496115_0000050
688 Ga0496115_0042883
689 Ga0496115_0730690
690 Ga0496116_0199788
691 Ga0496117_0181024
692 Ga0496118_0009384
693 Ga0496119_0038927
694 Ga0496120_0132143
695 Ga0496121_0000442
696 Ga0501298_088084
697 Ga0501033_0016730
698 Ga0501036_0919216
699 Ga0501037_0756336
700 Ga0501043_0468078
701 Ga0501043_0928466
702 Ga0501047_0030043
703 Ga0501047_0145091
704 Ga0501047_0765281
705 Ga0501047_0837419
706 Ga0501048_0309468
707 Ga0501067_0490790
708 Ga0501225_0186563
709 Ga0501035_0050795
710 Ga0501035_1188981
711 Ga0501044_0012686
712 Ga0501044_0247772
713 Ga0501044_0693841
714 nmdc:mga03683_409346_c1
715 nmdc:mga0yw44_117220_c1
716 nmdc:mga0k408_621694_c1
717 nmdc:mga07m45_260722_c1
718 nmdc:mga0rr50_75640_c1
719 nmdc:mga08x19_182013_c1
720 nmdc:mga0sz30_400160_c1
721 Ga0500635_0000125
722 Ga0500643_011473
723 Ga0500647_0085877
724 Ga0500583_0065054
725 Ga0500651_0084128
726 Ga0500566_0213573
727 Ga0500641_0001188
728 Ga0500556_0004358
729 Ga0500556_0362276
730 Ga0500557_006327
731 Ga0500562_000295
732 Ga0500562_002219
733 Ga0500562_036250
734 Ga0500569_001965
735 Ga0500595_005928
736 Ga0500607_029845
737 Ga0500608_006300
738 Ga0500614_002367
739 Ga0500642_0068139
740 Ga0500655_053000
741 Ga0500658_0086450
742 Ga0500559_0015176
743 Ga0500590_037614
744 Ga0500603_013977
745 Ga0500616_0067922
746 Ga0500616_0085399
747 Ga0500616_0346034
748 Ga0500619_048741
749 Ga0500620_152638
750 Ga0500622_0016892
751 Ga0500622_0019327
752 Ga0500622_0172038
753 Ga0500638_157073
754 Ga0500638_356088
755 Ga0500636_0001698
756 Ga0500637_0007555
757 Ga0500576_148707
758 Ga0500625_047170
759 Ga0500645_000604
760 Ga0500552_010274
761 Ga0500596_003407
762 Ga0500601_001278

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Map