F428985

General Info

Members Datasets Scaffolds Average Seq Length
381 188 381 248

Family's Representative Sequence

Representative Sequence 3300025981|Ga0207640_10249113|Ga0207640_102491132
Length 276
Sequence MSVNPDHVLAPLARKLSLREELTPADRDAILALPFSRRKLESNQYLVWDGDRPQNTCLLLSGYAYRHKLAGNGGRQILSIHMKGDVLDLQNSLLGIADHNVQMLTAGEVALIPVDSIRELAFNHPSVGLAMWYETLVEGSIFREWVLNIGRRNARTRIAHLLCEFALRLEIVDLGQHTTYELPITQEQLADAVALTSVHVNRTLMKLEQDGLITRTRRVISAVDWKALVKVADFEPRYLHLDRPPAVRSNRRPFPRPRRPTSARASWQGRYGFPGG

Samples

Sample ID Description Type Environment
1 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
7 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
8 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
9 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
73 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
74 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
75 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
76 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
81 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
82 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
83 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
84 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
85 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
86 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
87 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
140 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
141 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
142 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
143 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
144 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
145 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
146 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
147 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
148 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
149 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
150 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
151 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
152 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
153 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
154 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
155 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
156 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
157 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
158 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
159 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
160 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
161 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
162 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
163 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
164 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
165 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
166 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
167 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
168 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
169 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
170 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
171 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
172 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
173 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
174 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
175 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
176 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
177 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
178 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
179 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
180 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
181 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
182 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
183 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
184 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
185 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
186 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
187 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
188 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.1
Nodule 0
Rhizoplane 0.26
Rhizosphere 97.11
Stem 0
Stem Tuber 0
Unclassified 0.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1000766 3300001915 Bacteria 9647
2 JGI24740J21852_10038230 3300001979 Bacteria 1474
3 JGI24739J22299_10001954 3300001989 Bacteria 7886
4 JGI24739J22299_10031330 3300001989 Bacteria 1838
5 JGI24739J22299_10055223 3300001989 Bacteria 1270
6 JGI24737J22298_10000419 3300001990 Bacteria 14540
7 JGI24735J21928_10008677 3300002067 Bacteria 3280
8 JGI24735J21928_10015648 3300002067 Bacteria 2363
9 JGI24750J21931_1020053 3300002070 Bacteria 930
10 JGI24738J21930_10000456 3300002075 Bacteria 11594
11 JGI24738J21930_10002661 3300002075 Bacteria 4607
12 JGI24738J21930_10004619 3300002075 Bacteria 3359
13 JGI24744J21845_10021417 3300002077 Bacteria 1271
14 JGI24751J29686_10010950 3300002459 Unclassified 1870
15 JGI24751J29686_10017993 3300002459 Bacteria 1461
16 Ga0065707_10125724 3300005295 Bacteria 2018
17 Ga0070658_10012575 3300005327 Bacteria 6789
18 Ga0070658_10066087 3300005327 Bacteria 2953
19 Ga0070658_10203004 3300005327 Bacteria 1673
20 Ga0070676_10000962 3300005328 Bacteria 14326
21 Ga0070690_100120038 3300005330 Bacteria 1764
22 Ga0070670_100000210 3300005331 Bacteria 54177
23 Ga0070670_100002304 3300005331 Bacteria 15728
24 Ga0068869_100000094 3300005334 Bacteria 41359
25 Ga0070666_10000089 3300005335 Bacteria 64147
26 Ga0070666_10113799 3300005335 Bacteria 1873
27 Ga0070680_100001104 3300005336 Bacteria 19360
28 Ga0070680_100129601 3300005336 Bacteria 2109
29 Ga0070682_100324802 3300005337 Bacteria 1138
30 Ga0068868_100000113 3300005338 Bacteria 50799
31 Ga0070660_100000177 3300005339 Bacteria 42137
32 Ga0070660_100009037 3300005339 Bacteria 6991
33 Ga0070689_100116171 3300005340 Bacteria 2133
34 Ga0070661_100012645 3300005344 Bacteria 5905
35 Ga0070661_100257309 3300005344 Unclassified 1349
36 Ga0070668_100000026 3300005347 Bacteria 92584
37 Ga0070668_100002775 3300005347 Bacteria 12873
38 Ga0070668_100422019 3300005347 Unclassified 1142
39 Ga0070668_100499150 3300005347 Bacteria 1053
40 Ga0070669_100000024 3300005353 Bacteria 173107
41 Ga0070669_100000155 3300005353 Bacteria 61710
42 Ga0070669_100122894 3300005353 Bacteria 1983
43 Ga0070669_100305787 3300005353 Unclassified 1280
44 Ga0070675_100017819 3300005354 Bacteria 5650
45 Ga0070675_100220791 3300005354 Unclassified 1650
46 Ga0070671_100000006 3300005355 Bacteria 250635
47 Ga0070671_100000266 3300005355 Bacteria 35281
48 Ga0070671_100003933 3300005355 Bacteria 11687
49 Ga0070673_100000177 3300005364 Bacteria 31060
50 Ga0070673_100100102 3300005364 Bacteria 2385
51 Ga0070659_100000305 3300005366 Bacteria 38108
52 Ga0070667_100000019 3300005367 Bacteria 224710
53 Ga0070667_100002102 3300005367 Bacteria 17561
54 Ga0070667_100134057 3300005367 Unclassified 2164
55 Ga0070667_100760579 3300005367 Bacteria 898
56 Ga0070714_100141248 3300005435 Unclassified 2162
57 Ga0070713_100123958 3300005436 Bacteria 2270
58 Ga0070705_100038054 3300005440 Bacteria 2718
59 Ga0070705_100152121 3300005440 Bacteria 1536
60 Ga0070663_100139051 3300005455 Bacteria 1852
61 Ga0070678_100101797 3300005456 Bacteria 2228
62 Ga0070662_100000133 3300005457 Bacteria 41884
63 Ga0070662_100020959 3300005457 Bacteria 4458
64 Ga0070662_100078288 3300005457 Bacteria 2455
65 Ga0070662_100128375 3300005457 Bacteria 1952
66 Ga0070662_100185870 3300005457 Bacteria 1641
67 Ga0070662_100413613 3300005457 Bacteria 1114
68 Ga0070681_10141090 3300005458 Bacteria 2339
69 Ga0068867_100001645 3300005459 Bacteria 15522
70 Ga0070685_10287229 3300005466 Bacteria 1103
71 Ga0070679_100245473 3300005530 Bacteria 1747
72 Ga0068853_100041895 3300005539 Bacteria 3913
73 Ga0068853_100263066 3300005539 Unclassified 1586
74 Ga0070672_100000437 3300005543 Bacteria 24334
75 Ga0070672_100182258 3300005543 Unclassified 1750
76 Ga0070693_100187640 3300005547 Bacteria 1335
77 Ga0070665_100003647 3300005548 Bacteria 16312
78 Ga0068855_100000753 3300005563 Bacteria 39796
79 Ga0070664_100006460 3300005564 Bacteria 9449
80 Ga0070664_100255673 3300005564 Bacteria 1575
81 Ga0068857_100001206 3300005577 Bacteria 20155
82 Ga0068857_100004566 3300005577 Bacteria 11718
83 Ga0068854_100000206 3300005578 Bacteria 39747
84 Ga0068854_100011929 3300005578 Bacteria 5679
85 Ga0068854_100081448 3300005578 Bacteria 2391
86 Ga0068856_100190016 3300005614 Bacteria 2067
87 Ga0068852_100004481 3300005616 Bacteria 9869
88 Ga0068852_100030980 3300005616 Unclassified 4408
89 Ga0068852_100114392 3300005616 Bacteria 2458
90 Ga0068859_100000256 3300005617 Bacteria 52870
91 Ga0068859_100001723 3300005617 Bacteria 22290
92 Ga0068864_100000428 3300005618 Bacteria 36392
93 Ga0068861_100001329 3300005719 Bacteria 15509
94 Ga0068861_100004223 3300005719 Bacteria 9640
95 Ga0068861_100038987 3300005719 Bacteria 3544
96 Ga0068861_100547849 3300005719 Unclassified 1054
97 Ga0068851_10005689 3300005834 Bacteria 5665
98 Ga0068851_10075883 3300005834 Bacteria 1747
99 Ga0068870_10019597 3300005840 Bacteria 3283
100 Ga0068863_100000634 3300005841 Bacteria 35566
101 Ga0068863_100000719 3300005841 Bacteria 33262
102 Ga0068863_100043601 3300005841 Bacteria 4258
103 Ga0068863_100048775 3300005841 Bacteria 4015
104 Ga0068858_100000447 3300005842 Bacteria 43262
105 Ga0068858_100002895 3300005842 Bacteria 17259
106 Ga0068858_100018709 3300005842 Bacteria 6483
107 Ga0068858_100086890 3300005842 Bacteria 2908
108 Ga0068860_100000042 3300005843 Bacteria 227404
109 Ga0068860_100001698 3300005843 Bacteria 23527
110 Ga0068860_100003691 3300005843 Bacteria 15765
111 Ga0068862_100000310 3300005844 Bacteria 53315
112 Ga0068862_100001429 3300005844 Bacteria 22064
113 Ga0068862_100032302 3300005844 Bacteria 4422
114 Ga0097621_100047844 3300006237 Bacteria 3467
115 Ga0097621_100096023 3300006237 Bacteria 2487
116 Ga0075370_10014277 3300006353 Bacteria 4236
117 Ga0068871_100149946 3300006358 Bacteria 1988
118 Ga0068865_100118539 3300006881 Bacteria 1964
119 Ga0097620_100000256 3300006931 Bacteria 52870
120 Ga0097620_100001723 3300006931 Bacteria 22290
121 Ga0105251_10011406 3300009011 Bacteria 5079
122 Ga0105245_10021654 3300009098 Bacteria 5642
123 Ga0105247_10000644 3300009101 Bacteria 27956
124 Ga0105243_10020936 3300009148 Bacteria 4963
125 Ga0105241_10021755 3300009174 Bacteria 4744
126 Ga0105241_10125140 3300009174 Bacteria 2075
127 Ga0105248_10001472 3300009177 Bacteria 26219
128 Ga0105248_10014792 3300009177 Bacteria 8593
129 Ga0105248_10141220 3300009177 Bacteria 2717
130 Ga0105238_10006717 3300009551 Bacteria 11481
131 Ga0105238_10177501 3300009551 Bacteria 2107
132 Ga0105238_10217201 3300009551 Unclassified 1888
133 Ga0105249_10010588 3300009553 Bacteria 8102
134 Ga0105249_10134582 3300009553 Bacteria 2364
135 Ga0105246_10002628 3300011119 Bacteria 10869
136 Ga0157373_10010790 3300013100 Bacteria 6725
137 Ga0157373_10046797 3300013100 Bacteria 3086
138 Ga0157373_10262532 3300013100 Bacteria 1222
139 Ga0157371_10012549 3300013102 Bacteria 6471
140 Ga0157371_10058629 3300013102 Bacteria 2731
141 Ga0157369_10146115 3300013105 Bacteria 2500
142 Ga0157378_10703116 3300013297 Unclassified 1030
143 Ga0163162_10003527 3300013306 Bacteria 14967
144 Ga0163162_10818715 3300013306 Bacteria 1048
145 Ga0157372_10080088 3300013307 Bacteria 3695
146 Ga0157372_10250495 3300013307 Bacteria 2056
147 Ga0157372_10261333 3300013307 Bacteria 2010
148 Ga0157372_10735218 3300013307 Bacteria 1147
149 Ga0157375_10139932 3300013308 Bacteria 2547
150 Ga0157375_10144495 3300013308 Bacteria 2509
151 Ga0163163_10094260 3300014325 Bacteria 3012
152 Ga0163163_10379045 3300014325 Unclassified 1472
153 Ga0157380_10100279 3300014326 Bacteria 2410
154 Ga0157377_10026127 3300014745 Bacteria 3121
155 Ga0157379_10028961 3300014968 Bacteria 4924
156 Ga0163161_10046326 3300017792 Bacteria 3137
157 Ga0213873_10000010 3300021358 Bacteria 223024
158 Ga0213876_10000027 3300021384 Bacteria 223024
159 Ga0207697_10000109 3300025315 Bacteria 38398
160 Ga0207697_10001163 3300025315 Bacteria 14444
161 Ga0207656_10055184 3300025321 Bacteria 1729
162 Ga0207656_10059574 3300025321 Bacteria 1671
163 Ga0207656_10170850 3300025321 Bacteria 1039
164 Ga0207710_10002631 3300025900 Bacteria 8285
165 Ga0207688_10000437 3300025901 Bacteria 19709
166 Ga0207680_10000517 3300025903 Bacteria 18430
167 Ga0207680_10013518 3300025903 Bacteria 4196
168 Ga0207647_10000446 3300025904 Bacteria 33539
169 Ga0207647_10004181 3300025904 Bacteria 10703
170 Ga0207647_10007048 3300025904 Bacteria 8149
171 Ga0207647_10058114 3300025904 Bacteria 2369
172 Ga0207645_10001179 3300025907 Bacteria 21601
173 Ga0207705_10000002 3300025909 Bacteria 2046852
174 Ga0207705_10059264 3300025909 Bacteria 2763
175 Ga0207705_10111546 3300025909 Bacteria 2021
176 Ga0207705_10176784 3300025909 Bacteria 1609
177 Ga0207705_10194405 3300025909 Bacteria 1535
178 Ga0207684_10325769 3300025910 Bacteria 1324
179 Ga0207654_10011331 3300025911 Bacteria 4550
180 Ga0207695_10478198 3300025913 Bacteria 1128
181 Ga0207671_10013629 3300025914 Bacteria 6466
182 Ga0207660_10089837 3300025917 Bacteria 2275
183 Ga0207657_10000082 3300025919 Bacteria 89667
184 Ga0207657_10002553 3300025919 Bacteria 19693
185 Ga0207657_10054847 3300025919 Bacteria 3445
186 Ga0207657_10366677 3300025919 Bacteria 1135
187 Ga0207657_10379585 3300025919 Bacteria 1113
188 Ga0207649_10061842 3300025920 Unclassified 2358
189 Ga0207649_10152086 3300025920 Bacteria 1595
190 Ga0207652_10404784 3300025921 Bacteria 1231
191 Ga0207681_10000004 3300025923 Bacteria 559005
192 Ga0207681_10001626 3300025923 Bacteria 14490
193 Ga0207681_10054146 3300025923 Bacteria 2727
194 Ga0207694_10022711 3300025924 Bacteria 4758
195 Ga0207694_10226734 3300025924 Bacteria 1525
196 Ga0207650_10003615 3300025925 Bacteria 10600
197 Ga0207650_10024887 3300025925 Bacteria 4261
198 Ga0207650_10324651 3300025925 Unclassified 1261
199 Ga0207659_10048062 3300025926 Bacteria 3021
200 Ga0207687_10018368 3300025927 Bacteria 4614
201 Ga0207644_10000009 3300025931 Bacteria 251643
202 Ga0207644_10008744 3300025931 Bacteria 6629
203 Ga0207690_10052701 3300025932 Bacteria 2726
204 Ga0207690_10088237 3300025932 Bacteria 2184
205 Ga0207690_10151594 3300025932 Bacteria 1719
206 Ga0207706_10000300 3300025933 Bacteria 53727
207 Ga0207706_10007400 3300025933 Bacteria 10151
208 Ga0207706_10026310 3300025933 Bacteria 5207
209 Ga0207706_10035866 3300025933 Bacteria 4406
210 Ga0207706_10257737 3300025933 Bacteria 1523
211 Ga0207706_10439813 3300025933 Bacteria 1129
212 Ga0207709_10043923 3300025935 Bacteria 2697
213 Ga0207670_10022346 3300025936 Bacteria 3919
214 Ga0207704_10203839 3300025938 Bacteria 1450
215 Ga0207691_10000294 3300025940 Bacteria 49457
216 Ga0207691_10035241 3300025940 Plasmid 4647
217 Ga0207691_10107730 3300025940 Bacteria 2480
218 Ga0207711_10042579 3300025941 Bacteria 3869
219 Ga0207711_10049716 3300025941 Bacteria 3589
220 Ga0207689_10000064 3300025942 Bacteria 84222
221 Ga0207661_10337282 3300025944 Bacteria 1358
222 Ga0207661_10433831 3300025944 Bacteria 1195
223 Ga0207679_10203237 3300025945 Unclassified 1656
224 Ga0207679_10211445 3300025945 Bacteria 1627
225 Ga0207679_10501393 3300025945 Bacteria 1083
226 Ga0207667_10015519 3300025949 Bacteria 8645
227 Ga0207667_10452052 3300025949 Bacteria 1305
228 Ga0207651_10000355 3300025960 Bacteria 19400
229 Ga0207651_10066472 3300025960 Bacteria 2533
230 Ga0207712_10024323 3300025961 Bacteria 4009
231 Ga0207712_10242912 3300025961 Bacteria 1451
232 Ga0207668_10000081 3300025972 Bacteria 72145
233 Ga0207668_10005224 3300025972 Bacteria 7642
234 Ga0207668_10087276 3300025972 Bacteria 2281
235 Ga0207668_10130866 3300025972 Bacteria 1916
236 Ga0207668_10288466 3300025972 Bacteria 1349
237 Ga0207668_10414601 3300025972 Unclassified 1142
238 Ga0207640_10000884 3300025981 Bacteria 16999
239 Ga0207640_10249113 3300025981 Bacteria 1377
240 Ga0207640_10321138 3300025981 Bacteria 1233
241 Ga0207640_10366808 3300025981 Unclassified 1162
242 Ga0207658_10000002 3300025986 Bacteria 1364188
243 Ga0207658_10004839 3300025986 Bacteria 9310
244 Ga0207658_10134203 3300025986 Bacteria 1993
245 Ga0207658_10775096 3300025986 Unclassified 870
246 Ga0207677_10001730 3300026023 Bacteria 11572
247 Ga0207703_10000473 3300026035 Bacteria 42016
248 Ga0207703_10019317 3300026035 Bacteria 5323
249 Ga0207703_10020869 3300026035 Bacteria 5125
250 Ga0207703_10299076 3300026035 Bacteria 1467
251 Ga0207639_10038079 3300026041 Bacteria 3575
252 Ga0207678_10015166 3300026067 Bacteria 6778
253 Ga0207678_10130997 3300026067 Bacteria 2139
254 Ga0207678_10169560 3300026067 Bacteria 1864
255 Ga0207702_10007789 3300026078 Bacteria 9091
256 Ga0207702_10090961 3300026078 Bacteria 2671
257 Ga0207702_10203842 3300026078 Bacteria 1835
258 Ga0207641_10006899 3300026088 Bacteria 9501
259 Ga0207641_10014292 3300026088 Bacteria 6505
260 Ga0207641_10100808 3300026088 Bacteria 2543
261 Ga0207648_10001537 3300026089 Bacteria 25401
262 Ga0207648_10017901 3300026089 Bacteria 6428
263 Ga0207648_10018877 3300026089 Bacteria 6229
264 Ga0207676_10003427 3300026095 Bacteria 11217
265 Ga0207674_10001709 3300026116 Bacteria 28102
266 Ga0207674_10013688 3300026116 Bacteria 8986
267 Ga0207674_10018388 3300026116 Bacteria 7598
268 Ga0207674_10067491 3300026116 Bacteria 3600
269 Ga0207675_100000740 3300026118 Bacteria 32427
270 Ga0207675_100011298 3300026118 Bacteria 8360
271 Ga0207675_100059074 3300026118 Bacteria 3579
272 Ga0207698_10002519 3300026142 Bacteria 10867
273 Ga0207698_10200938 3300026142 Bacteria 1785
274 Ga0207698_10269734 3300026142 Bacteria 1568
275 Ga0268266_10031824 3300028379 Bacteria 4481
276 Ga0268265_10002264 3300028380 Bacteria 14694
277 Ga0268265_10018263 3300028380 Bacteria 4857
278 Ga0268265_10071694 3300028380 Bacteria 2699
279 Ga0268265_10104830 3300028380 Bacteria 2293
280 Ga0268264_10000001 3300028381 Bacteria 1221000
281 Ga0268264_10000069 3300028381 Bacteria 270492
282 Ga0268264_10073518 3300028381 Bacteria 2902
283 Ga0307408_100322026 3300031548 Bacteria 1302
284 Ga0307413_10101568 3300031824 Bacteria 1902
285 Ga0307410_10073155 3300031852 Archaea 2382
286 Ga0307410_10079546 3300031852 Bacteria 2297
287 Ga0307406_10162479 3300031901 Bacteria 1607
288 Ga0307406_10320001 3300031901 Bacteria 1199
289 Ga0307407_10020079 3300031903 Bacteria 3415
290 Ga0307407_10089245 3300031903 Bacteria 1885
291 Ga0307407_10331592 3300031903 Unclassified 1071
292 Ga0307412_10011156 3300031911 Bacteria 5197
293 Ga0307412_10019921 3300031911 Bacteria 4072
294 Ga0307412_10134987 3300031911 Bacteria 1799
295 Ga0307409_100036493 3300031995 Bacteria 3614
296 Ga0307409_100149576 3300031995 Bacteria 2025
297 Ga0307409_100300440 3300031995 Bacteria 1493
298 Ga0307416_100068574 3300032002 Bacteria 2931
299 Ga0307416_100079266 3300032002 Bacteria 2767
300 Ga0307416_100617125 3300032002 Bacteria 1166
301 Ga0307414_10008639 3300032004 Bacteria 5794
302 Ga0307414_10030645 3300032004 Bacteria 3517
303 Ga0307414_10037334 3300032004 Bacteria 3252
304 Ga0307414_10058494 3300032004 Bacteria 2716
305 Ga0307414_10137682 3300032004 Bacteria 1906
306 Ga0307414_10202707 3300032004 Bacteria 1615
307 Ga0307414_10495603 3300032004 Bacteria 1080
308 Ga0307411_10202012 3300032005 Bacteria 1527
309 Ga0307415_100125058 3300032126 Bacteria 1936
310 Ga0307415_100138043 3300032126 Bacteria 1857
311 Ga0307415_100149993 3300032126 Bacteria 1793
312 Ga0307415_100208057 3300032126 Unclassified 1558
313 Ga0307415_100394971 3300032126 Bacteria 1179
314 Ga0373930_0060684 3300034816 Bacteria 843
315 Ga0373954_0192183 3300035118 Unclassified 1002
316 Ga0373943_0011126 3300035170 Bacteria 4044
317 Ga0373955_0081262 3300035172 Unclassified 1832
318 Ga0373927_0142506 3300035695 Bacteria 1568
319 Ga0373933_0073759 3300035724 Unclassified 2080
320 Ga0373937_0068648 3300036401 Bacteria 3268
321 Ga0373925_0003873 3300037068 Bacteria 11445
322 Ga0395899_0064823 3300037312 Unclassified 2685
323 Ga0395899_0304700 3300037312 Bacteria 1077
324 Ga0395900_0012828 3300037418 Bacteria 8564
325 Ga0395900_0042000 3300037418 Bacteria 4711
326 Ga0395900_0079014 3300037418 Plasmid 3380
327 Ga0395900_0086947 3300037418 Bacteria 3213
328 Ga0395900_0270881 3300037418 Bacteria 1692
329 Ga0395898_0023942 3300037466 Bacteria 6162
330 Ga0395898_0053631 3300037466 Bacteria 3938
331 Ga0395898_0133493 3300037466 Bacteria 2377
332 Ga0395898_0322521 3300037466 Bacteria 1473
333 Ga0395898_0364773 3300037466 Bacteria 1377
334 Ga0395898_0406453 3300037466 Unclassified 1298
335 Ga0395905_0024932 3300037471 Bacteria 5642
336 Ga0395905_0026232 3300037471 Bacteria 5494
337 Ga0395905_0047740 3300037471 Bacteria 4011
338 Ga0395905_0051877 3300037471 Bacteria 3842
339 Ga0395905_0084061 3300037471 Bacteria 2982
340 Ga0395905_0092107 3300037471 Bacteria 2842
341 Ga0395905_0095323 3300037471 Bacteria 2793
342 Ga0395905_0245111 3300037471 Unclassified 1674
343 Ga0395905_0302061 3300037471 Bacteria 1488
344 Ga0395905_0530899 3300037471 Bacteria 1077
345 Ga0395905_0642286 3300037471 Bacteria 963
346 Ga0395901_0023006 3300038443 Bacteria 6388
347 Ga0395901_0031513 3300038443 Bacteria 5467
348 Ga0395901_0056916 3300038443 Bacteria 4067
349 Ga0395901_0116109 3300038443 Bacteria 2811
350 Ga0395901_0198638 3300038443 Unclassified 2102
351 Ga0395901_0260151 3300038443 Bacteria 1806
352 Ga0436365_0431660 3300039437 Bacteria 34094
353 Ga0436362_0592983 3300039453 Bacteria 296966
354 Ga0439433_0034658 3300041999 Unclassified 1163
355 Ga0466967_0039842 3300045976 Bacteria 4042
356 Ga0495607_0026712 3300046501 Bacteria 3580
357 Ga0495606_0043143 3300046507 Unclassified 3011
358 Ga0495643_0013769 3300046522 Bacteria 4828
359 Ga0495598_0018564 3300046537 Bacteria 1810
360 Ga0495598_0091396 3300046537 Unclassified 993
361 Ga0495621_0002726 3300046539 Bacteria 4789
362 Ga0495621_0016633 3300046539 Bacteria 2363
363 Ga0495633_0106308 3300046558 Bacteria 1302
364 Ga0495659_0003737 3300046664 Bacteria 4842
365 Ga0495659_0091714 3300046664 Bacteria 1167
366 Ga0495669_0026319 3300046684 Bacteria 2542
367 Ga0495670_0212832 3300046691 Unclassified 1025
368 Ga0495677_0006558 3300047445 Bacteria 4396
369 Ga0495602_0270273 3300048088 Unclassified 1257
370 Ga0495615_0033623 3300048090 Unclassified 1243
371 Ga0496109_0214575 3300048912 Bacteria 1810
372 Ga0501257_020500 3300049686 Bacteria 1553
373 Ga0501225_0063432 3300049705 Unclassified 1042
374 Ga0501268_014883 3300049765 Bacteria 1272
375 nmdc:mga07m45_142511_c1 3300050496 Bacteria 1388
376 Ga0500595_038187 3300053119 Unclassified 1562
377 Ga0500568_0009050 3300053139 Unclassified 4751
378 Ga0500616_0000124 3300053153 Bacteria 135532
379 Ga0500622_0001153 3300053156 Bacteria 21998
380 Ga0500622_0020844 3300053156 Bacteria 3478
381 Ga0500634_0190284 3300053161 Unclassified 913

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005617 Ga0068859_100000256 Ga0068859_10000025655 216
2 3300005841 Ga0068863_100000719 Ga0068863_10000071924 216
3 3300005844 Ga0068862_100000310 Ga0068862_10000031050 216
4 3300006931 Ga0097620_100000256 Ga0097620_10000025655 216
5 3300017792 Ga0163161_10046326 Ga0163161_100463263 216
6 3300025315 Ga0207697_10001163 Ga0207697_100011639 216
7 3300025900 Ga0207710_10002631 Ga0207710_100026314 216
8 3300025903 Ga0207680_10000517 Ga0207680_100005174 216
9 3300025910 Ga0207684_10325769 Ga0207684_103257691 216
10 3300025923 Ga0207681_10000004 Ga0207681_10000004339 216
11 3300025925 Ga0207650_10003615 Ga0207650_100036155 216
12 3300025941 Ga0207711_10042579 Ga0207711_100425794 216
13 3300025961 Ga0207712_10024323 Ga0207712_100243235 216
14 3300025986 Ga0207658_10004839 Ga0207658_100048396 216
15 3300028380 Ga0268265_10002264 Ga0268265_100022644 216
16 3300053161 Ga0500634_0190284 Ga0500634_0190284_208_864 216
17 3300037471 Ga0395905_0530899 Ga0395905_0530899_376_1065 218
18 3300025944 Ga0207661_10433831 Ga0207661_104338312 229
19 3300037466 Ga0395898_0133493 Ga0395898_0133493_1559_2251 230
20 3300038443 Ga0395901_0023006 Ga0395901_0023006_2475_3167 230
21 3300032126 Ga0307415_100394971 Ga0307415_1003949711 232
22 3300046501 Ga0495607_0026712 Ga0495607_0026712_1458_2156 232
23 3300013100 Ga0157373_10262532 Ga0157373_102625321 235
24 3300013102 Ga0157371_10058629 Ga0157371_100586292 235
25 3300037466 Ga0395898_0322521 Ga0395898_0322521_33_740 235
26 3300025972 Ga0207668_10130866 Ga0207668_101308663 237
27 3300032005 Ga0307411_10202012 Ga0307411_102020123 237
28 3300034816 Ga0373930_0060684 Ga0373930_0060684_35_769 237
29 3300005436 Ga0070713_100123958 Ga0070713_1001239582 238
30 3300025903 Ga0207680_10013518 Ga0207680_100135185 238
31 3300031911 Ga0307412_10134987 Ga0307412_101349871 238
32 3300046507 Ga0495606_0043143 Ga0495606_0043143_495_1223 238
33 3300046522 Ga0495643_0013769 Ga0495643_0013769_1843_2571 238
34 3300046537 Ga0495598_0018564 Ga0495598_0018564_872_1597 238
35 3300049686 Ga0501257_020500 Ga0501257_020500_666_1382 238
36 3300049765 Ga0501268_014883 Ga0501268_014883_305_1021 238
37 3300013307 Ga0157372_10250495 Ga0157372_102504953 240
38 3300025321 Ga0207656_10170850 Ga0207656_101708501 240
39 3300025909 Ga0207705_10059264 Ga0207705_100592641 240
40 3300025933 Ga0207706_10035866 Ga0207706_100358666 240
41 3300053156 Ga0500622_0020844 Ga0500622_0020844_2269_2997 241
42 3300021358 Ga0213873_10000010 Ga0213873_1000001049 242
43 3300021384 Ga0213876_10000027 Ga0213876_1000002749 242
44 3300039437 Ga0436365_0431660 Ga0436365_0431660_18286_19014 242
45 3300039453 Ga0436362_0592983 Ga0436362_0592983_275330_276058 242
46 3300002459 JGI24751J29686_10017993 JGI24751J29686_100179932 243
47 3300005331 Ga0070670_100000210 Ga0070670_10000021021 243
48 3300005335 Ga0070666_10000089 Ga0070666_1000008915 243
49 3300005353 Ga0070669_100000024 Ga0070669_100000024165 243
50 3300005355 Ga0070671_100000006 Ga0070671_10000000687 243
51 3300005367 Ga0070667_100760579 Ga0070667_1007605791 243
52 3300005440 Ga0070705_100038054 Ga0070705_1000380545 243
53 3300005719 Ga0068861_100001329 Ga0068861_10000132916 243
54 3300005842 Ga0068858_100002895 Ga0068858_1000028954 243
55 3300005843 Ga0068860_100001698 Ga0068860_10000169816 243
56 3300009011 Ga0105251_10011406 Ga0105251_100114063 243
57 3300009101 Ga0105247_10000644 Ga0105247_100006441 243
58 3300009177 Ga0105248_10014792 Ga0105248_100147924 243
59 3300009553 Ga0105249_10010588 Ga0105249_100105885 243
60 3300013306 Ga0163162_10003527 Ga0163162_1000352716 243
61 3300014325 Ga0163163_10094260 Ga0163163_100942605 243
62 3300014968 Ga0157379_10028961 Ga0157379_100289617 243
63 3300025931 Ga0207644_10000009 Ga0207644_10000009163 243
64 3300025972 Ga0207668_10005224 Ga0207668_100052248 243
65 3300026035 Ga0207703_10019317 Ga0207703_100193176 243
66 3300026118 Ga0207675_100000740 Ga0207675_10000074038 243
67 3300028381 Ga0268264_10000069 Ga0268264_1000006983 243
68 3300005336 Ga0070680_100001104 Ga0070680_1000011047 244
69 3300005578 Ga0068854_100011929 Ga0068854_1000119297 244
70 3300026088 Ga0207641_10100808 Ga0207641_101008083 244
71 3300031824 Ga0307413_10101568 Ga0307413_101015683 244
72 3300053119 Ga0500595_038187 Ga0500595_038187_179_913 244
73 3300053156 Ga0500622_0001153 Ga0500622_0001153_10182_10916 244
74 3300001979 JGI24740J21852_10038230 JGI24740J21852_100382302 245
75 3300001989 JGI24739J22299_10001954 JGI24739J22299_100019542 245
76 3300001990 JGI24737J22298_10000419 JGI24737J22298_100004192 245
77 3300002067 JGI24735J21928_10015648 JGI24735J21928_100156483 245
78 3300002070 JGI24750J21931_1020053 JGI24750J21931_10200531 245
79 3300002075 JGI24738J21930_10000456 JGI24738J21930_1000045615 245
80 3300002075 JGI24738J21930_10004619 JGI24738J21930_100046191 245
81 3300002077 JGI24744J21845_10021417 JGI24744J21845_100214171 245
82 3300005327 Ga0070658_10012575 Ga0070658_100125756 245
83 3300005327 Ga0070658_10066087 Ga0070658_100660875 245
84 3300005328 Ga0070676_10000962 Ga0070676_1000096216 245
85 3300005330 Ga0070690_100120038 Ga0070690_1001200382 245
86 3300005334 Ga0068869_100000094 Ga0068869_1000000948 245
87 3300005338 Ga0068868_100000113 Ga0068868_10000011322 245
88 3300005339 Ga0070660_100009037 Ga0070660_1000090378 245
89 3300005340 Ga0070689_100116171 Ga0070689_1001161713 245
90 3300005344 Ga0070661_100012645 Ga0070661_1000126453 245
91 3300005347 Ga0070668_100002775 Ga0070668_10000277516 245
92 3300005353 Ga0070669_100000155 Ga0070669_10000015532 245
93 3300005354 Ga0070675_100017819 Ga0070675_1000178192 245
94 3300005355 Ga0070671_100003933 Ga0070671_10000393314 245
95 3300005364 Ga0070673_100000177 Ga0070673_10000017710 245
96 3300005364 Ga0070673_100100102 Ga0070673_1001001022 245
97 3300005366 Ga0070659_100000305 Ga0070659_10000030513 245
98 3300005367 Ga0070667_100002102 Ga0070667_10000210214 245
99 3300005457 Ga0070662_100000133 Ga0070662_10000013342 245
100 3300005457 Ga0070662_100413613 Ga0070662_1004136132 245
101 3300005459 Ga0068867_100001645 Ga0068867_10000164518 245
102 3300005466 Ga0070685_10287229 Ga0070685_102872292 245
103 3300005539 Ga0068853_100041895 Ga0068853_1000418956 245
104 3300005543 Ga0070672_100000437 Ga0070672_10000043729 245
105 3300005548 Ga0070665_100003647 Ga0070665_1000036473 245
106 3300005563 Ga0068855_100000753 Ga0068855_10000075343 245
107 3300005564 Ga0070664_100255673 Ga0070664_1002556731 245
108 3300005577 Ga0068857_100004566 Ga0068857_1000045662 245
109 3300005578 Ga0068854_100000206 Ga0068854_10000020622 245
110 3300005616 Ga0068852_100004481 Ga0068852_1000044812 245
111 3300005616 Ga0068852_100030980 Ga0068852_1000309809 245
112 3300005617 Ga0068859_100001723 Ga0068859_10000172326 245
113 3300005618 Ga0068864_100000428 Ga0068864_10000042829 245
114 3300005719 Ga0068861_100004223 Ga0068861_1000042236 245
115 3300005834 Ga0068851_10005689 Ga0068851_100056892 245
116 3300005840 Ga0068870_10019597 Ga0068870_100195973 245
117 3300005841 Ga0068863_100000634 Ga0068863_10000063428 245
118 3300005842 Ga0068858_100086890 Ga0068858_1000868901 245
119 3300005843 Ga0068860_100003691 Ga0068860_1000036914 245
120 3300006237 Ga0097621_100047844 Ga0097621_1000478443 245
121 3300006237 Ga0097621_100096023 Ga0097621_1000960232 245
122 3300006353 Ga0075370_10014277 Ga0075370_100142774 245
123 3300006358 Ga0068871_100149946 Ga0068871_1001499464 245
124 3300006881 Ga0068865_100118539 Ga0068865_1001185391 245
125 3300006931 Ga0097620_100001723 Ga0097620_10000172326 245
126 3300009098 Ga0105245_10021654 Ga0105245_100216546 245
127 3300009148 Ga0105243_10020936 Ga0105243_100209366 245
128 3300009174 Ga0105241_10021755 Ga0105241_100217556 245
129 3300009177 Ga0105248_10001472 Ga0105248_1000147220 245
130 3300009551 Ga0105238_10006717 Ga0105238_100067175 245
131 3300009551 Ga0105238_10177501 Ga0105238_101775013 245
132 3300011119 Ga0105246_10002628 Ga0105246_100026286 245
133 3300013100 Ga0157373_10010790 Ga0157373_100107906 245
134 3300013102 Ga0157371_10012549 Ga0157371_100125498 245
135 3300013306 Ga0163162_10818715 Ga0163162_108187152 245
136 3300013307 Ga0157372_10080088 Ga0157372_100800886 245
137 3300013308 Ga0157375_10139932 Ga0157375_101399322 245
138 3300013308 Ga0157375_10144495 Ga0157375_101444952 245
139 3300014745 Ga0157377_10026127 Ga0157377_100261271 245
140 3300025315 Ga0207697_10000109 Ga0207697_1000010922 245
141 3300025321 Ga0207656_10059574 Ga0207656_100595742 245
142 3300025901 Ga0207688_10000437 Ga0207688_1000043712 245
143 3300025904 Ga0207647_10000446 Ga0207647_100004466 245
144 3300025907 Ga0207645_10001179 Ga0207645_1000117918 245
145 3300025909 Ga0207705_10176784 Ga0207705_101767842 245
146 3300025913 Ga0207695_10478198 Ga0207695_104781981 245
147 3300025919 Ga0207657_10002553 Ga0207657_1000255311 245
148 3300025920 Ga0207649_10152086 Ga0207649_101520861 245
149 3300025923 Ga0207681_10001626 Ga0207681_100016265 245
150 3300025924 Ga0207694_10226734 Ga0207694_102267341 245
151 3300025926 Ga0207659_10048062 Ga0207659_100480623 245
152 3300025927 Ga0207687_10018368 Ga0207687_100183684 245
153 3300025931 Ga0207644_10008744 Ga0207644_100087448 245
154 3300025932 Ga0207690_10052701 Ga0207690_100527013 245
155 3300025933 Ga0207706_10000300 Ga0207706_1000030040 245
156 3300025933 Ga0207706_10439813 Ga0207706_104398132 245
157 3300025935 Ga0207709_10043923 Ga0207709_100439232 245
158 3300025936 Ga0207670_10022346 Ga0207670_100223462 245
159 3300025938 Ga0207704_10203839 Ga0207704_102038393 245
160 3300025940 Ga0207691_10000294 Ga0207691_1000029423 245
161 3300025941 Ga0207711_10049716 Ga0207711_100497161 245
162 3300025942 Ga0207689_10000064 Ga0207689_100000648 245
163 3300025945 Ga0207679_10211445 Ga0207679_102114452 245
164 3300025949 Ga0207667_10015519 Ga0207667_1001551912 245
165 3300025960 Ga0207651_10000355 Ga0207651_100003557 245
166 3300025960 Ga0207651_10066472 Ga0207651_100664724 245
167 3300025972 Ga0207668_10087276 Ga0207668_100872764 245
168 3300025981 Ga0207640_10000884 Ga0207640_100008846 245
169 3300025981 Ga0207640_10321138 Ga0207640_103211382 245
170 3300025986 Ga0207658_10134203 Ga0207658_101342032 245
171 3300026023 Ga0207677_10001730 Ga0207677_100017308 245
172 3300026035 Ga0207703_10020869 Ga0207703_100208695 245
173 3300026067 Ga0207678_10169560 Ga0207678_101695602 245
174 3300026078 Ga0207702_10090961 Ga0207702_100909614 245
175 3300026088 Ga0207641_10014292 Ga0207641_100142922 245
176 3300026089 Ga0207648_10001537 Ga0207648_1000153717 245
177 3300026095 Ga0207676_10003427 Ga0207676_100034275 245
178 3300026116 Ga0207674_10001709 Ga0207674_100017091 245
179 3300026142 Ga0207698_10002519 Ga0207698_100025199 245
180 3300026142 Ga0207698_10200938 Ga0207698_102009381 245
181 3300028379 Ga0268266_10031824 Ga0268266_100318245 245
182 3300028381 Ga0268264_10073518 Ga0268264_100735184 245
183 3300050496 nmdc:mga07m45_142511_c1 nmdc:mga07m45_142511_c1_421_1164 245
184 3300001989 JGI24739J22299_10055223 JGI24739J22299_100552231 246
185 3300002067 JGI24735J21928_10008677 JGI24735J21928_100086774 246
186 3300005327 Ga0070658_10203004 Ga0070658_102030041 246
187 3300005336 Ga0070680_100129601 Ga0070680_1001296011 246
188 3300005337 Ga0070682_100324802 Ga0070682_1003248021 246
189 3300005344 Ga0070661_100257309 Ga0070661_1002573091 246
190 3300005347 Ga0070668_100422019 Ga0070668_1004220192 246
191 3300005347 Ga0070668_100499150 Ga0070668_1004991501 246
192 3300005354 Ga0070675_100220791 Ga0070675_1002207913 246
193 3300005440 Ga0070705_100152121 Ga0070705_1001521211 246
194 3300005455 Ga0070663_100139051 Ga0070663_1001390512 246
195 3300005456 Ga0070678_100101797 Ga0070678_1001017972 246
196 3300005457 Ga0070662_100020959 Ga0070662_1000209592 246
197 3300005457 Ga0070662_100128375 Ga0070662_1001283753 246
198 3300005458 Ga0070681_10141090 Ga0070681_101410901 246
199 3300005530 Ga0070679_100245473 Ga0070679_1002454733 246
200 3300005539 Ga0068853_100263066 Ga0068853_1002630662 246
201 3300005543 Ga0070672_100182258 Ga0070672_1001822582 246
202 3300005547 Ga0070693_100187640 Ga0070693_1001876401 246
203 3300005564 Ga0070664_100006460 Ga0070664_10000646010 246
204 3300005578 Ga0068854_100081448 Ga0068854_1000814481 246
205 3300005614 Ga0068856_100190016 Ga0068856_1001900161 246
206 3300005616 Ga0068852_100114392 Ga0068852_1001143924 246
207 3300005719 Ga0068861_100547849 Ga0068861_1005478491 246
208 3300005834 Ga0068851_10075883 Ga0068851_100758833 246
209 3300005842 Ga0068858_100018709 Ga0068858_1000187093 246
210 3300005844 Ga0068862_100032302 Ga0068862_1000323026 246
211 3300009174 Ga0105241_10125140 Ga0105241_101251402 246
212 3300009551 Ga0105238_10217201 Ga0105238_102172013 246
213 3300013100 Ga0157373_10046797 Ga0157373_100467973 246
214 3300013105 Ga0157369_10146115 Ga0157369_101461152 246
215 3300013307 Ga0157372_10735218 Ga0157372_107352181 246
216 3300014326 Ga0157380_10100279 Ga0157380_101002793 246
217 3300025321 Ga0207656_10055184 Ga0207656_100551841 246
218 3300025904 Ga0207647_10058114 Ga0207647_100581144 246
219 3300025909 Ga0207705_10111546 Ga0207705_101115462 246
220 3300025909 Ga0207705_10194405 Ga0207705_101944052 246
221 3300025917 Ga0207660_10089837 Ga0207660_100898371 246
222 3300025919 Ga0207657_10366677 Ga0207657_103666771 246
223 3300025919 Ga0207657_10379585 Ga0207657_103795851 246
224 3300025920 Ga0207649_10061842 Ga0207649_100618422 246
225 3300025921 Ga0207652_10404784 Ga0207652_104047841 246
226 3300025925 Ga0207650_10324651 Ga0207650_103246512 246
227 3300025932 Ga0207690_10088237 Ga0207690_100882372 246
228 3300025933 Ga0207706_10007400 Ga0207706_1000740010 246
229 3300025933 Ga0207706_10257737 Ga0207706_102577371 246
230 3300025940 Ga0207691_10035241 Ga0207691_100352413 246
231 3300025940 Ga0207691_10107730 Ga0207691_101077301 246
232 3300025944 Ga0207661_10337282 Ga0207661_103372822 246
233 3300025945 Ga0207679_10203237 Ga0207679_102032371 246
234 3300025945 Ga0207679_10501393 Ga0207679_105013932 246
235 3300025949 Ga0207667_10452052 Ga0207667_104520521 246
236 3300025972 Ga0207668_10288466 Ga0207668_102884662 246
237 3300025972 Ga0207668_10414601 Ga0207668_104146012 246
238 3300025981 Ga0207640_10366808 Ga0207640_103668082 246
239 3300025986 Ga0207658_10775096 Ga0207658_107750961 246
240 3300026035 Ga0207703_10299076 Ga0207703_102990763 246
241 3300026067 Ga0207678_10015166 Ga0207678_100151668 246
242 3300026067 Ga0207678_10130997 Ga0207678_101309971 246
243 3300026078 Ga0207702_10203842 Ga0207702_102038421 246
244 3300026089 Ga0207648_10017901 Ga0207648_100179017 246
245 3300026089 Ga0207648_10018877 Ga0207648_100188772 246
246 3300026116 Ga0207674_10013688 Ga0207674_1001368811 246
247 3300026118 Ga0207675_100011298 Ga0207675_1000112982 246
248 3300028380 Ga0268265_10071694 Ga0268265_100716943 246
249 3300028380 Ga0268265_10104830 Ga0268265_101048304 246
250 3300032004 Ga0307414_10495603 Ga0307414_104956032 246
251 3300037418 Ga0395900_0270881 Ga0395900_0270881_750_1490 246
252 3300037466 Ga0395898_0023942 Ga0395898_0023942_1088_1855 246
253 3300037466 Ga0395898_0053631 Ga0395898_0053631_2940_3707 246
254 3300037471 Ga0395905_0047740 Ga0395905_0047740_2152_2919 246
255 3300037471 Ga0395905_0051877 Ga0395905_0051877_916_1683 246
256 3300038443 Ga0395901_0031513 Ga0395901_0031513_3939_4706 246
257 3300038443 Ga0395901_0116109 Ga0395901_0116109_1322_2062 246
258 3300041999 Ga0439433_0034658 Ga0439433_0034658_304_1056 246
259 3300048912 Ga0496109_0214575 Ga0496109_0214575_274_1041 246
260 3300002459 JGI24751J29686_10010950 JGI24751J29686_100109502 247
261 3300005331 Ga0070670_100002304 Ga0070670_10000230412 247
262 3300005347 Ga0070668_100000026 Ga0070668_10000002675 247
263 3300005353 Ga0070669_100122894 Ga0070669_1001228944 247
264 3300005355 Ga0070671_100000266 Ga0070671_10000026610 247
265 3300005367 Ga0070667_100000019 Ga0070667_100000019160 247
266 3300005719 Ga0068861_100038987 Ga0068861_1000389872 247
267 3300005841 Ga0068863_100048775 Ga0068863_1000487752 247
268 3300005842 Ga0068858_100000447 Ga0068858_10000044713 247
269 3300005843 Ga0068860_100000042 Ga0068860_10000004221 247
270 3300005844 Ga0068862_100001429 Ga0068862_10000142917 247
271 3300009177 Ga0105248_10141220 Ga0105248_101412201 247
272 3300009553 Ga0105249_10134582 Ga0105249_101345823 247
273 3300014325 Ga0163163_10379045 Ga0163163_103790452 247
274 3300025923 Ga0207681_10054146 Ga0207681_100541464 247
275 3300025925 Ga0207650_10024887 Ga0207650_100248874 247
276 3300025961 Ga0207712_10242912 Ga0207712_102429122 247
277 3300025972 Ga0207668_10000081 Ga0207668_1000008111 247
278 3300025986 Ga0207658_10000002 Ga0207658_10000002188 247
279 3300026035 Ga0207703_10000473 Ga0207703_1000047313 247
280 3300026088 Ga0207641_10006899 Ga0207641_1000689910 247
281 3300026118 Ga0207675_100059074 Ga0207675_1000590745 247
282 3300028380 Ga0268265_10018263 Ga0268265_100182637 247
283 3300028381 Ga0268264_10000001 Ga0268264_10000001513 247
284 3300032004 Ga0307414_10030645 Ga0307414_100306453 247
285 3300035170 Ga0373943_0011126 Ga0373943_0011126_2309_3106 247
286 3300035695 Ga0373927_0142506 Ga0373927_0142506_633_1430 247
287 3300037068 Ga0373925_0003873 Ga0373925_0003873_319_1116 247
288 3300037418 Ga0395900_0086947 Ga0395900_0086947_697_1443 247
289 3300037471 Ga0395905_0302061 Ga0395905_0302061_49_795 247
290 3300046537 Ga0495598_0091396 Ga0495598_0091396_197_967 247
291 3300046539 Ga0495621_0002726 Ga0495621_0002726_1327_2097 247
292 3300047445 Ga0495677_0006558 Ga0495677_0006558_3488_4258 247
293 3300048090 Ga0495615_0033623 Ga0495615_0033623_299_1069 247
294 3300005353 Ga0070669_100305787 Ga0070669_1003057871 248
295 3300005457 Ga0070662_100078288 Ga0070662_1000782882 248
296 3300013307 Ga0157372_10261333 Ga0157372_102613332 248
297 3300025904 Ga0207647_10004181 Ga0207647_100041812 248
298 3300025932 Ga0207690_10151594 Ga0207690_101515942 248
299 3300025933 Ga0207706_10026310 Ga0207706_100263105 248
300 3300031903 Ga0307407_10331592 Ga0307407_103315922 248
301 3300031995 Ga0307409_100036493 Ga0307409_1000364931 248
302 3300032002 Ga0307416_100617125 Ga0307416_1006171251 248
303 3300032004 Ga0307414_10008639 Ga0307414_100086397 248
304 3300032126 Ga0307415_100208057 Ga0307415_1002080571 248
305 3300037471 Ga0395905_0092107 Ga0395905_0092107_2012_2779 248
306 3300045976 Ga0466967_0039842 Ga0466967_0039842_1224_1991 248
307 3300053139 Ga0500568_0009050 Ga0500568_0009050_446_1204 248
308 3300053153 Ga0500616_0000124 Ga0500616_0000124_120468_121226 248
309 3300005295 Ga0065707_10125724 Ga0065707_101257241 249
310 3300005339 Ga0070660_100000177 Ga0070660_10000017739 249
311 3300005841 Ga0068863_100043601 Ga0068863_1000436012 249
312 3300025909 Ga0207705_10000002 Ga0207705_100000021561 249
313 3300025919 Ga0207657_10000082 Ga0207657_100000824 249
314 3300025981 Ga0207640_10249113 Ga0207640_102491132 249
315 3300031548 Ga0307408_100322026 Ga0307408_1003220262 249
316 3300031852 Ga0307410_10073155 Ga0307410_100731553 249
317 3300031852 Ga0307410_10079546 Ga0307410_100795464 249
318 3300031901 Ga0307406_10162479 Ga0307406_101624792 249
319 3300031901 Ga0307406_10320001 Ga0307406_103200012 249
320 3300031903 Ga0307407_10020079 Ga0307407_100200795 249
321 3300031903 Ga0307407_10089245 Ga0307407_100892452 249
322 3300031911 Ga0307412_10011156 Ga0307412_100111568 249
323 3300031911 Ga0307412_10019921 Ga0307412_100199212 249
324 3300031995 Ga0307409_100149576 Ga0307409_1001495762 249
325 3300031995 Ga0307409_100300440 Ga0307409_1003004402 249
326 3300032002 Ga0307416_100068574 Ga0307416_1000685746 249
327 3300032002 Ga0307416_100079266 Ga0307416_1000792662 249
328 3300032004 Ga0307414_10058494 Ga0307414_100584945 249
329 3300032004 Ga0307414_10137682 Ga0307414_101376822 249
330 3300032004 Ga0307414_10202707 Ga0307414_102027072 249
331 3300032126 Ga0307415_100125058 Ga0307415_1001250582 249
332 3300032126 Ga0307415_100138043 Ga0307415_1001380432 249
333 3300032126 Ga0307415_100149993 Ga0307415_1001499932 249
334 3300046539 Ga0495621_0016633 Ga0495621_0016633_713_1492 249
335 3300046558 Ga0495633_0106308 Ga0495633_0106308_256_1035 249
336 3300046664 Ga0495659_0003737 Ga0495659_0003737_635_1414 249
337 3300046664 Ga0495659_0091714 Ga0495659_0091714_352_1113 249
338 3300046684 Ga0495669_0026319 Ga0495669_0026319_1284_2045 249
339 3300046691 Ga0495670_0212832 Ga0495670_0212832_207_986 249
340 3300005335 Ga0070666_10113799 Ga0070666_101137991 250
341 3300005367 Ga0070667_100134057 Ga0070667_1001340573 250
342 3300025904 Ga0207647_10007048 Ga0207647_100070484 250
343 3300025911 Ga0207654_10011331 Ga0207654_100113314 250
344 3300025914 Ga0207671_10013629 Ga0207671_100136293 250
345 3300025919 Ga0207657_10054847 Ga0207657_100548474 250
346 3300025924 Ga0207694_10022711 Ga0207694_100227113 250
347 3300026041 Ga0207639_10038079 Ga0207639_100380792 250
348 3300026078 Ga0207702_10007789 Ga0207702_100077898 250
349 3300026116 Ga0207674_10067491 Ga0207674_100674914 250
350 3300026142 Ga0207698_10269734 Ga0207698_102697341 250
351 3300049705 Ga0501225_0063432 Ga0501225_0063432_34_798 250
352 3300001989 JGI24739J22299_10031330 JGI24739J22299_100313301 251
353 3300002075 JGI24738J21930_10002661 JGI24738J21930_100026615 251
354 3300005435 Ga0070714_100141248 Ga0070714_1001412483 251
355 3300005457 Ga0070662_100185870 Ga0070662_1001858702 251
356 3300013297 Ga0157378_10703116 Ga0157378_107031161 251
357 3300035118 Ga0373954_0192183 Ga0373954_0192183_182_937 251
358 3300035172 Ga0373955_0081262 Ga0373955_0081262_375_1130 251
359 3300035724 Ga0373933_0073759 Ga0373933_0073759_397_1152 251
360 3300036401 Ga0373937_0068648 Ga0373937_0068648_1768_2523 251
361 3300037312 Ga0395899_0064823 Ga0395899_0064823_51_848 251
362 3300037418 Ga0395900_0042000 Ga0395900_0042000_327_1124 251
363 3300037418 Ga0395900_0079014 Ga0395900_0079014_2021_2776 251
364 3300037466 Ga0395898_0364773 Ga0395898_0364773_21_818 251
365 3300037466 Ga0395898_0406453 Ga0395898_0406453_455_1210 251
366 3300037471 Ga0395905_0024932 Ga0395905_0024932_500_1297 251
367 3300037471 Ga0395905_0026232 Ga0395905_0026232_1874_2629 251
368 3300037471 Ga0395905_0084061 Ga0395905_0084061_460_1215 251
369 3300037471 Ga0395905_0245111 Ga0395905_0245111_637_1392 251
370 3300038443 Ga0395901_0056916 Ga0395901_0056916_239_1036 251
371 3300038443 Ga0395901_0198638 Ga0395901_0198638_637_1392 251
372 3300038443 Ga0395901_0260151 Ga0395901_0260151_606_1361 251
373 3300048088 Ga0495602_0270273 Ga0495602_0270273_136_891 251
374 3300001915 JGI24741J21665_1000766 JGI24741J21665_10007663 252
375 3300005577 Ga0068857_100001206 Ga0068857_10000120629 252
376 3300026116 Ga0207674_10018388 Ga0207674_100183889 252
377 3300032004 Ga0307414_10037334 Ga0307414_100373347 252
378 3300037312 Ga0395899_0304700 Ga0395899_0304700_172_930 252
379 3300037418 Ga0395900_0012828 Ga0395900_0012828_1173_1931 252
380 3300037471 Ga0395905_0095323 Ga0395905_0095323_926_1687 252
381 3300037471 Ga0395905_0642286 Ga0395905_0642286_43_801 252

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00325

Crp

Bacterial regulatory proteins, crp family

182

213

0.96

PF00027

cNMP_binding

Cyclic nucleotide-binding domain

37

124

0.94

PF13545

HTH_Crp_2

Crp-like helix-turn-helix domain

156

231

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
4i2o-assembly1.cif.gz_B the structure of fixk2 from bradyrhizobium japonicum 0.9418 35 234
4i2o-assembly1.cif.gz_B the structure of fixk2 from bradyrhizobium japonicum 0.9142 35 234
5cvr-assembly1.cif.gz_A-2 crystal structure of fnr of a. fischeri in a partially degraded form 0.9114 38 234
3i54-assembly2.cif.gz_C crystal structure of mtbcrp in complex with camp 0.9103 37 234
5e44-assembly1.cif.gz_A-2 crystal structure of holo-fnr of a. fischeri 0.9099 15 236
ID Description Score Start End Superfamily
5e44A02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9626 155 236 1.10.10.10
4i2oB02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9565 155 234 1.10.10.10
3i54C01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9167 37 141 2.60.120.10
5e44A02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9078 155 236 1.10.10.10
4i2oB01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9069 35 154 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A4Q3LTC8-F1-model_v4 deleted 0.949 6 248
AF-A0A2W5RD86-F1-model_v4 deleted 0.9449 13 246
AF-A0A2T4YTW6-F1-model_v4 CRP-like cAMP-binding protein 0.94 11 244 GO:0003677
GO:0006355
AF-A0A7Y8MQH3-F1-model_v4 Helix-turn-helix domain-containing protein 0.939 35 235 GO:0003677
GO:0003700
GO:0005829
AF-A0A4R6FJW9-F1-model_v4 CRP-like cAMP-binding protein 0.9368 17 236 GO:0003677
GO:0003700
GO:0005829

Feature Viewer

pLDDT pTM Quality
92.49 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map