F428979

General Info

Members Datasets Scaffolds Average Seq Length
381 223 762 65

Family's Representative Sequence

Representative Sequence 3300025925|Ga0207650_10148954|Ga0207650_101489542
Length 80
Sequence LDFLGVVGVLCGKRCYVGKWLVFVGLGIAGLGLLIMLGVPLFRLPGDIAVRRGNFSFYFPLATSIVLSIXXXXLFSLFRR

Samples

Sample ID Description Type Environment
1 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
54 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
55 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
59 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
60 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
61 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
62 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
63 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
68 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
70 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
71 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
76 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
81 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
82 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
83 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
84 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
85 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
86 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
125 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
128 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
129 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
130 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
131 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
132 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
133 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
134 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
135 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
136 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
137 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
138 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
139 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
140 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
141 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
142 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
143 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
144 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
145 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
146 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
147 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
148 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
149 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
150 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
151 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
152 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
153 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
154 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
155 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
156 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
157 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
158 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
159 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
160 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
161 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
162 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
163 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
164 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
165 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
166 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
167 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
168 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
169 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
170 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
171 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
172 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
173 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
174 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
175 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
176 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
177 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
178 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
179 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
180 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
190 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
191 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
192 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
193 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
194 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
195 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
196 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
197 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
198 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
199 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
200 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
201 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
202 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
203 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
204 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
205 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
208 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
209 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
210 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
211 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
212 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
213 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
214 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
215 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
216 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
217 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
218 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
219 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
220 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
221 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
222 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
223 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.1
Rhizosphere 97.64
Stem 0
Stem Tuber 0
Unclassified 5.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207650_10148954 3300025925 Bacteria 1845
2 JGI24751J29686_10023968 3300002459 Bacteria 1265
3 JGI25406J46586_10000820 3300003203 Bacteria 14598
4 JGI25406J46586_10003345 3300003203 Bacteria 7552
5 Ga0065704_10586684 3300005289 Bacteria 615
6 Ga0065704_10721885 3300005289 Bacteria 553
7 Ga0065715_10098529 3300005293 Bacteria 3535
8 Ga0065715_10163294 3300005293 Bacteria 1609
9 Ga0065715_10307644 3300005293 Bacteria 1027
10 Ga0065715_11138656 3300005293 Unclassified 501
11 Ga0065707_10043166 3300005295 Bacteria 881
12 Ga0065707_10478714 3300005295 Bacteria 775
13 Ga0065707_10491377 3300005295 Bacteria 765
14 Ga0065707_10607459 3300005295 Bacteria 686
15 Ga0065707_10901255 3300005295 Bacteria 566
16 Ga0070676_10996286 3300005328 Bacteria 629
17 Ga0070690_100068642 3300005330 Bacteria 2300
18 Ga0070670_100018110 3300005331 Bacteria 6046
19 Ga0070670_100173094 3300005331 Bacteria 1873
20 Ga0068869_100423414 3300005334 Bacteria 1099
21 Ga0070666_10430556 3300005335 Bacteria 951
22 Ga0070689_100018766 3300005340 Bacteria 5102
23 Ga0070689_100461699 3300005340 Bacteria 1082
24 Ga0070689_100660338 3300005340 Bacteria 910
25 Ga0070687_100133942 3300005343 Bacteria 1434
26 Ga0070661_100610454 3300005344 Bacteria 883
27 Ga0070668_100166616 3300005347 Bacteria 1791
28 Ga0070669_100218600 3300005353 Bacteria 1506
29 Ga0070669_100577152 3300005353 Bacteria 940
30 Ga0070675_100017283 3300005354 Bacteria 5731
31 Ga0070675_100199488 3300005354 Bacteria 1736
32 Ga0070671_101174719 3300005355 Bacteria 675
33 Ga0070674_100094063 3300005356 Bacteria 2170
34 Ga0070673_100003191 3300005364 Bacteria 10158
35 Ga0070673_100247953 3300005364 Bacteria 1551
36 Ga0070688_100036448 3300005365 Bacteria 2991
37 Ga0070688_100628206 3300005365 Bacteria 825
38 Ga0070659_101741021 3300005366 Bacteria 558
39 Ga0070667_101569479 3300005367 Bacteria 618
40 Ga0070701_10476595 3300005438 Bacteria 806
41 Ga0070701_10766457 3300005438 Bacteria 655
42 Ga0070705_100379344 3300005440 Bacteria 1040
43 Ga0070705_100557033 3300005440 Bacteria 880
44 Ga0070700_100331415 3300005441 Bacteria 1122
45 Ga0070700_100856079 3300005441 Bacteria 737
46 Ga0070694_101386038 3300005444 Bacteria 593
47 Ga0070678_100464054 3300005456 Bacteria 1111
48 Ga0070662_100299018 3300005457 Bacteria 1307
49 Ga0070681_11128707 3300005458 Unclassified 705
50 Ga0070685_10163168 3300005466 Bacteria 1422
51 Ga0070685_10318900 3300005466 Bacteria 1053
52 Ga0070707_100688533 3300005468 Bacteria 985
53 Ga0070698_100000242 3300005471 Bacteria 54440
54 Ga0070698_100941901 3300005471 Bacteria 810
55 Ga0070698_101164528 3300005471 Viruses 720
56 Ga0070698_101456852 3300005471 Bacteria 636
57 Ga0070699_100000778 3300005518 Bacteria 29468
58 Ga0070699_100149056 3300005518 Bacteria 2068
59 Ga0070699_100337058 3300005518 Bacteria 1357
60 Ga0070699_101234748 3300005518 Bacteria 686
61 Ga0070699_101406032 3300005518 Bacteria 640
62 Ga0070697_100035422 3300005536 Bacteria 4026
63 Ga0070672_100042736 3300005543 Bacteria 3491
64 Ga0070672_100907152 3300005543 Bacteria 778
65 Ga0070672_101263027 3300005543 Bacteria 659
66 Ga0070686_100419466 3300005544 Bacteria 1022
67 Ga0070695_101091734 3300005545 Bacteria 653
68 Ga0070696_100002023 3300005546 Bacteria 13307
69 Ga0070696_100998585 3300005546 Bacteria 699
70 Ga0070696_101352694 3300005546 Bacteria 606
71 Ga0070665_100065115 3300005548 Bacteria 3656
72 Ga0070665_100517414 3300005548 Bacteria 1205
73 Ga0070704_100062373 3300005549 Bacteria 2672
74 Ga0068855_102326003 3300005563 Bacteria 536
75 Ga0070664_100016118 3300005564 Bacteria 6126
76 Ga0068857_100818495 3300005577 Bacteria 890
77 Ga0068857_101953948 3300005577 Bacteria 575
78 Ga0070702_100120520 3300005615 Bacteria 1642
79 Ga0068859_100104910 3300005617 Bacteria 2886
80 Ga0068859_100289661 3300005617 Bacteria 1730
81 Ga0068859_100400215 3300005617 Bacteria 1469
82 Ga0068864_100006051 3300005618 Bacteria 9933
83 Ga0068861_100131324 3300005719 Bacteria 2033
84 Ga0068861_100206064 3300005719 Bacteria 1654
85 Ga0068870_10182118 3300005840 Bacteria 1262
86 Ga0068863_100910893 3300005841 Bacteria 880
87 Ga0068863_102509320 3300005841 Bacteria 525
88 Ga0068858_100169126 3300005842 Bacteria 2061
89 Ga0068858_100190526 3300005842 Bacteria 1938
90 Ga0068862_100314893 3300005844 Bacteria 1443
91 Ga0081455_10083461 3300005937 Bacteria 2611
92 Ga0081539_10000090 3300005985 Bacteria 212006
93 Ga0070717_10298964 3300006028 Bacteria 1431
94 Ga0097621_100006929 3300006237 Bacteria 8068
95 Ga0097621_101413409 3300006237 Unclassified 659
96 Ga0068871_100002804 3300006358 Bacteria 11920
97 Ga0068871_100027882 3300006358 Bacteria 4422
98 Ga0068871_100125192 3300006358 Bacteria 2175
99 Ga0075428_100704994 3300006844 Bacteria 1075
100 Ga0075428_101383526 3300006844 Bacteria 739
101 Ga0075430_100042186 3300006846 Bacteria 3858
102 Ga0075431_100049463 3300006847 Bacteria 4334
103 Ga0075433_10084859 3300006852 Bacteria 2795
104 Ga0075433_10948098 3300006852 Unclassified 750
105 Ga0075434_100196368 3300006871 Bacteria 2037
106 Ga0075434_101325088 3300006871 Unclassified 731
107 Ga0075434_101379552 3300006871 Bacteria 715
108 Ga0075434_102648736 3300006871 Bacteria 502
109 Ga0075429_100105912 3300006880 Bacteria 2456
110 Ga0075429_100247541 3300006880 Bacteria 1561
111 Ga0075429_100717060 3300006880 Bacteria 876
112 Ga0068865_100010986 3300006881 Bacteria 5651
113 Ga0075436_100006766 3300006914 Bacteria 7847
114 Ga0075436_100186249 3300006914 Archaea 1468
115 Ga0097620_100104908 3300006931 Bacteria 2886
116 Ga0097620_100289673 3300006931 Bacteria 1730
117 Ga0097620_100400270 3300006931 Bacteria 1469
118 Ga0075435_100194449 3300007076 Bacteria 1717
119 Ga0111539_10053614 3300009094 Bacteria 4801
120 Ga0111539_11181628 3300009094 Bacteria 889
121 Ga0111539_11348608 3300009094 Bacteria 828
122 Ga0105245_10880460 3300009098 Bacteria 936
123 Ga0105247_10668754 3300009101 Bacteria 778
124 Ga0114129_10182079 3300009147 Bacteria 2858
125 Ga0114129_10226582 3300009147 Bacteria 2519
126 Ga0114129_11231321 3300009147 Bacteria 931
127 Ga0114129_11921569 3300009147 Bacteria 717
128 Ga0105242_10535967 3300009176 Bacteria 1120
129 Ga0105242_11415184 3300009176 Bacteria 723
130 Ga0105248_10020179 3300009177 Bacteria 7383
131 Ga0105248_10184460 3300009177 Bacteria 2351
132 Ga0105248_10533245 3300009177 Bacteria 1324
133 Ga0105248_10925607 3300009177 Bacteria 984
134 Ga0105248_12222390 3300009177 Bacteria 624
135 Ga0105249_10621895 3300009553 Bacteria 1136
136 Ga0105249_11392458 3300009553 Unclassified 773
137 Ga0105249_12940353 3300009553 Unclassified 547
138 Ga0105249_13476792 3300009553 Bacteria 507
139 Ga0105246_10370282 3300011119 Bacteria 1180
140 Ga0157374_12780073 3300013296 Bacteria 517
141 Ga0157378_10229131 3300013297 Bacteria 1770
142 Ga0163162_12800978 3300013306 Bacteria 561
143 Ga0157375_10441906 3300013308 Bacteria 1466
144 Ga0157375_11713781 3300013308 Bacteria 744
145 Ga0157375_12177666 3300013308 Bacteria 660
146 Ga0157375_13321874 3300013308 Bacteria 536
147 Ga0163163_10009443 3300014325 Bacteria 8709
148 Ga0163163_10072400 3300014325 Bacteria 3435
149 Ga0157380_10264873 3300014326 Bacteria 1563
150 Ga0157380_10565011 3300014326 Bacteria 1119
151 Ga0157380_13415435 3300014326 Unclassified 508
152 Ga0157377_10093037 3300014745 Bacteria 1783
153 Ga0157377_10488670 3300014745 Bacteria 858
154 Ga0157377_10540242 3300014745 Bacteria 821
155 Ga0157379_12118132 3300014968 Bacteria 558
156 Ga0157376_10152037 3300014969 Bacteria 2088
157 Ga0157376_11386601 3300014969 Bacteria 734
158 Ga0163161_11753266 3300017792 Bacteria 551
159 Ga0207697_10207267 3300025315 Bacteria 863
160 Ga0207682_10067640 3300025893 Bacteria 1508
161 Ga0207680_10435249 3300025903 Bacteria 930
162 Ga0207645_10829648 3300025907 Bacteria 628
163 Ga0207707_10895357 3300025912 Bacteria 734
164 Ga0207660_11319958 3300025917 Bacteria 586
165 Ga0207657_10066571 3300025919 Bacteria 3066
166 Ga0207652_10040793 3300025921 Bacteria 3943
167 Ga0207646_10443139 3300025922 Bacteria 1172
168 Ga0207681_10063318 3300025923 Bacteria 2550
169 Ga0207650_10001350 3300025925 Bacteria 17725
170 Ga0207659_10021521 3300025926 Bacteria 4281
171 Ga0207659_10188725 3300025926 Bacteria 1639
172 Ga0207659_10600675 3300025926 Bacteria 938
173 Ga0207687_11440698 3300025927 Bacteria 592
174 Ga0207644_11156824 3300025931 Bacteria 650
175 Ga0207690_10057603 3300025932 Bacteria 2625
176 Ga0207690_11749881 3300025932 Bacteria 519
177 Ga0207706_10685243 3300025933 Bacteria 876
178 Ga0207686_10163360 3300025934 Bacteria 1563
179 Ga0207670_10045391 3300025936 Bacteria 2912
180 Ga0207669_10061165 3300025937 Bacteria 2313
181 Ga0207669_10357423 3300025937 Bacteria 1131
182 Ga0207704_10004287 3300025938 Bacteria 6517
183 Ga0207704_11213256 3300025938 Bacteria 643
184 Ga0207691_10009627 3300025940 Bacteria 9271
185 Ga0207691_10831388 3300025940 Bacteria 775
186 Ga0207711_10070774 3300025941 Bacteria 3025
187 Ga0207711_10267980 3300025941 Bacteria 1571
188 Ga0207711_10592878 3300025941 Bacteria 1034
189 Ga0207711_10840980 3300025941 Bacteria 854
190 Ga0207689_10220147 3300025942 Unclassified 1568
191 Ga0207689_10380306 3300025942 Bacteria 1175
192 Ga0207661_10842231 3300025944 Bacteria 844
193 Ga0207679_10025500 3300025945 Bacteria 4068
194 Ga0207679_10920270 3300025945 Bacteria 800
195 Ga0207651_10034738 3300025960 Bacteria 3269
196 Ga0207712_10824658 3300025961 Bacteria 816
197 Ga0207712_11776482 3300025961 Unclassified 553
198 Ga0207668_10204911 3300025972 Bacteria 1573
199 Ga0207668_11102665 3300025972 Bacteria 712
200 Ga0207640_11805803 3300025981 Bacteria 553
201 Ga0207658_10416460 3300025986 Bacteria 1184
202 Ga0207703_12021595 3300026035 Bacteria 552
203 Ga0207708_10253548 3300026075 Bacteria 1419
204 Ga0207708_10367717 3300026075 Bacteria 1183
205 Ga0207708_10465440 3300026075 Bacteria 1055
206 Ga0207708_10851408 3300026075 Bacteria 787
207 Ga0207702_10762028 3300026078 Unclassified 956
208 Ga0207641_10278717 3300026088 Bacteria 1572
209 Ga0207641_11788394 3300026088 Bacteria 616
210 Ga0207648_11352204 3300026089 Bacteria 669
211 Ga0207676_10263844 3300026095 Bacteria 1556
212 Ga0207676_10355299 3300026095 Bacteria 1356
213 Ga0207674_11391827 3300026116 Bacteria 671
214 Ga0207674_11499410 3300026116 Unclassified 643
215 Ga0207675_100176418 3300026118 Bacteria 2045
216 Ga0207675_100231302 3300026118 Bacteria 1784
217 Ga0207675_101929247 3300026118 Bacteria 609
218 Ga0207675_101984356 3300026118 Bacteria 600
219 Ga0207683_10079795 3300026121 Bacteria 2902
220 Ga0207428_10485540 3300027907 Bacteria 898
221 Ga0268266_10057057 3300028379 Bacteria 3359
222 Ga0268265_10096064 3300028380 Bacteria 2381
223 Ga0268265_12338750 3300028380 Unclassified 541
224 Ga0307408_100003848 3300031548 Bacteria 10213
225 Ga0307408_100459266 3300031548 Bacteria 1106
226 Ga0307408_100989811 3300031548 Bacteria 774
227 Ga0307405_10000655 3300031731 Bacteria 13337
228 Ga0307405_10037608 3300031731 Bacteria 2910
229 Ga0307405_10420470 3300031731 Bacteria 1052
230 Ga0307405_11892900 3300031731 Bacteria 532
231 Ga0307413_10006996 3300031824 Bacteria 5202
232 Ga0307413_10096316 3300031824 Bacteria 1942
233 Ga0307413_10440517 3300031824 Bacteria 1031
234 Ga0307410_10009942 3300031852 Bacteria 5364
235 Ga0307410_10031213 3300031852 Bacteria 3416
236 Ga0307410_11526902 3300031852 Bacteria 589
237 Ga0307410_12007252 3300031852 Bacteria 516
238 Ga0307406_10042507 3300031901 Bacteria 2837
239 Ga0307406_10071788 3300031901 Bacteria 2270
240 Ga0307407_10005789 3300031903 Bacteria 5408
241 Ga0307407_10772340 3300031903 Bacteria 729
242 Ga0307412_10086408 3300031911 Bacteria 2182
243 Ga0307412_10176487 3300031911 Bacteria 1602
244 Ga0307412_10766895 3300031911 Bacteria 834
245 Ga0307409_100003910 3300031995 Bacteria 8245
246 Ga0307409_100026502 3300031995 Bacteria 4089
247 Ga0307409_100498561 3300031995 Bacteria 1185
248 Ga0307409_100539628 3300031995 Bacteria 1143
249 Ga0307416_100000683 3300032002 Bacteria 17650
250 Ga0307416_100003573 3300032002 Bacteria 9171
251 Ga0307416_100485158 3300032002 Unclassified 1297
252 Ga0307416_101213258 3300032002 Bacteria 860
253 Ga0307416_101867159 3300032002 Bacteria 704
254 Ga0307416_102567989 3300032002 Bacteria 607
255 Ga0307414_10008823 3300032004 Bacteria 5752
256 Ga0307414_10035146 3300032004 Bacteria 3332
257 Ga0307414_10113320 3300032004 Bacteria 2070
258 Ga0307414_10299394 3300032004 Bacteria 1360
259 Ga0307411_10001781 3300032005 Bacteria 9096
260 Ga0307411_10005339 3300032005 Bacteria 6296
261 Ga0307411_10025899 3300032005 Bacteria 3522
262 Ga0307411_10888651 3300032005 Bacteria 791
263 Ga0307415_100004748 3300032126 Bacteria 7112
264 Ga0307415_100011537 3300032126 Bacteria 5063
265 Ga0373934_0087683 3300035086 Bacteria 1253
266 Ga0373956_0302057 3300035119 Unclassified 762
267 Ga0373943_0426961 3300035170 Bacteria 768
268 Ga0373946_0418650 3300035171 Bacteria 678
269 Ga0373955_0295715 3300035172 Bacteria 976
270 Ga0373935_0592591 3300035692 Bacteria 810
271 Ga0373927_0386882 3300035695 Bacteria 923
272 Ga0373933_0672512 3300035724 Bacteria 681
273 Ga0373947_0117913 3300035725 Bacteria 1684
274 Ga0373947_0469774 3300035725 Bacteria 853
275 Ga0373947_1262449 3300035725 Bacteria 503
276 Ga0373937_0480442 3300036401 Bacteria 1180
277 Ga0373937_0614578 3300036401 Bacteria 1032
278 Ga0373937_1395636 3300036401 Bacteria 648
279 Ga0373925_0304106 3300037068 Bacteria 1288
280 Ga0451800_1610681 3300041459 Unclassified 529
281 Ga0451845_0588700 3300041501 Bacteria 525
282 Ga0450923_015538 3300042125 Bacteria 1425
283 Ga0466967_0889231 3300045976 Bacteria 886
284 Ga0495603_0229352 3300046455 Bacteria 1071
285 Ga0495603_0639837 3300046455 Bacteria 609
286 Ga0495629_0419739 3300046459 Bacteria 908
287 Ga0495582_0107079 3300046473 Bacteria 1569
288 Ga0495584_0356061 3300046491 Bacteria 743
289 Ga0495628_0342708 3300046516 Bacteria 1100
290 Ga0495642_0311138 3300046528 Bacteria 691
291 Ga0495598_0012952 3300046537 Bacteria 2058
292 Ga0495633_0113484 3300046558 Bacteria 1256
293 Ga0495635_0424089 3300046663 Bacteria 882
294 Ga0495659_0041240 3300046664 Bacteria 1648
295 Ga0495647_0479090 3300046681 Bacteria 578
296 Ga0495658_0293235 3300046683 Bacteria 1028
297 Ga0495658_0587017 3300046683 Bacteria 714
298 Ga0495670_0401709 3300046691 Bacteria 740
299 Ga0495670_0704155 3300046691 Bacteria 551
300 Ga0495636_0033875 3300047318 Bacteria 2100
301 Ga0495636_0117985 3300047318 Bacteria 1172
302 Ga0495674_0703701 3300047319 Bacteria 793
303 Ga0495602_0294433 3300048088 Bacteria 1190
304 Ga0495614_0389234 3300048089 Bacteria 654
305 Ga0496104_0726101 3300048907 Bacteria 901
306 Ga0496105_0552744 3300048908 Bacteria 898
307 Ga0496106_0448003 3300048909 Bacteria 1037
308 Ga0496112_0144487 3300048915 Bacteria 2348
309 Ga0496112_0210221 3300048915 Bacteria 1903
310 Ga0496112_1819259 3300048915 Bacteria 521
311 Ga0496113_0275280 3300048916 Bacteria 1346
312 Ga0501291_022479 3300049514 Bacteria 1012
313 Ga0501292_137880 3300049515 Bacteria 508
314 Ga0501297_090967 3300049520 Bacteria 507
315 Ga0501299_003607 3300049522 Bacteria 2255
316 Ga0501299_180025 3300049522 Bacteria 551
317 Ga0501033_0615007 3300049570 Bacteria 744
318 Ga0501033_0968166 3300049570 Bacteria 570
319 Ga0501034_0034928 3300049571 Bacteria 5099
320 Ga0501040_0027234 3300049576 Bacteria 3847
321 Ga0501041_0024987 3300049577 Bacteria 3589
322 Ga0501042_0003808 3300049578 Bacteria 9539
323 Ga0501043_0186432 3300049579 Bacteria 1615
324 Ga0501043_0967250 3300049579 Bacteria 607
325 Ga0501046_1043725 3300049580 Bacteria 566
326 Ga0501047_0009879 3300049581 Bacteria 9020
327 Ga0501048_0026499 3300049582 Bacteria 4221
328 Ga0501071_0047924 3300049587 Bacteria 3071
329 Ga0501071_1466307 3300049587 Unclassified 527
330 Ga0501075_0135765 3300049591 Bacteria 1874
331 Ga0501076_0088144 3300049592 Bacteria 2494
332 Ga0501077_0138651 3300049593 Bacteria 1542
333 Ga0501199_044981 3300049650 Unclassified 583
334 Ga0501249_023517 3300049679 Bacteria 1353
335 Ga0501249_087917 3300049679 Bacteria 735
336 Ga0501257_113105 3300049686 Bacteria 721
337 Ga0501258_052669 3300049687 Bacteria 572
338 Ga0501234_031106 3300049707 Bacteria 863
339 Ga0501079_1392136 3300049741 Bacteria 552
340 Ga0501080_0372035 3300049742 Bacteria 1288
341 Ga0501081_0077750 3300049743 Bacteria 2319
342 Ga0501081_0463837 3300049743 Bacteria 942
343 Ga0501081_0867370 3300049743 Unclassified 680
344 Ga0501262_067338 3300049759 Bacteria 581
345 Ga0501270_032445 3300049767 Bacteria 869
346 Ga0501273_006920 3300049770 Bacteria 1325
347 Ga0501275_066528 3300049772 Bacteria 559
348 Ga0501035_1081720 3300049822 Bacteria 627
349 Ga0501044_0006636 3300049823 Bacteria 12758
350 Ga0501045_0573015 3300049824 Bacteria 837
351 nmdc:mga05p37_1470107_c1 3300050507 Bacteria 681
352 nmdc:mga05p37_52621_c1 3300050507 Bacteria 5006
353 nmdc:mga09592_261473_c1 3300050508 Bacteria 1501
354 nmdc:mga09592_345976_c1 3300050508 Bacteria 1287
355 nmdc:mga09592_729532_c1 3300050508 Bacteria 842
356 nmdc:mga0qj67_36274_c1 3300050509 Bacteria 3857
357 nmdc:mga06r32_8513_c1 3300050510 Bacteria 6575
358 nmdc:mga08y16_1082440_c1 3300050511 Bacteria 777
359 nmdc:mga08y16_1401902_c1 3300050511 Bacteria 662
360 nmdc:mga08y16_1684035_c1 3300050511 Unclassified 590
361 nmdc:mga08y16_18526_c1 3300050511 Bacteria 7334
362 nmdc:mga08y16_49622_c1 3300050511 Bacteria 4392
363 nmdc:mga0n895_1129144_c1 3300050512 Bacteria 760
364 nmdc:mga0n895_362859_c1 3300050512 Bacteria 1467
365 nmdc:mga0n895_412133_c1 3300050512 Bacteria 1366
366 nmdc:mga0rr50_202634_c1 3300050513 Bacteria 1631
367 nmdc:mga08x19_177347_c1 3300050514 Bacteria 1454
368 nmdc:mga08x19_268987_c1 3300050514 Archaea 1179
369 nmdc:mga0a205_41773_c1 3300050515 Bacteria 4417
370 Ga0495601_0117061 3300053077 Bacteria 1729
371 Ga0495601_0700291 3300053077 Bacteria 646
372 Ga0495619_0185723 3300053085 Bacteria 1439
373 Ga0495619_0989339 3300053085 Bacteria 563
374 Ga0501084_0020343 3300054114 Bacteria 5534
375 Ga0590071_000060 3300059421 Bacteria 29173
376 Ga0590071_004088 3300059421 Bacteria 3560
377 Ga0590074_000203 3300059423 Bacteria 7654
378 Ga0590074_014141 3300059423 Bacteria 1350
379 Ga0590075_000338 3300059424 Bacteria 13058
380 Ga0590075_006284 3300059424 Bacteria 2818
381 Ga0590077_000202 3300059426 Bacteria 17335
382 Ga0207650_10148954
383 JGI24751J29686_10023968
384 JGI25406J46586_10000820
385 JGI25406J46586_10003345
386 Ga0065704_10586684
387 Ga0065704_10721885
388 Ga0065715_10098529
389 Ga0065715_10163294
390 Ga0065715_10307644
391 Ga0065715_11138656
392 Ga0065707_10043166
393 Ga0065707_10478714
394 Ga0065707_10491377
395 Ga0065707_10607459
396 Ga0065707_10901255
397 Ga0070676_10996286
398 Ga0070690_100068642
399 Ga0070670_100018110
400 Ga0070670_100173094
401 Ga0068869_100423414
402 Ga0070666_10430556
403 Ga0070689_100018766
404 Ga0070689_100461699
405 Ga0070689_100660338
406 Ga0070687_100133942
407 Ga0070661_100610454
408 Ga0070668_100166616
409 Ga0070669_100218600
410 Ga0070669_100577152
411 Ga0070675_100017283
412 Ga0070675_100199488
413 Ga0070671_101174719
414 Ga0070674_100094063
415 Ga0070673_100003191
416 Ga0070673_100247953
417 Ga0070688_100036448
418 Ga0070688_100628206
419 Ga0070659_101741021
420 Ga0070667_101569479
421 Ga0070701_10476595
422 Ga0070701_10766457
423 Ga0070705_100379344
424 Ga0070705_100557033
425 Ga0070700_100331415
426 Ga0070700_100856079
427 Ga0070694_101386038
428 Ga0070678_100464054
429 Ga0070662_100299018
430 Ga0070681_11128707
431 Ga0070685_10163168
432 Ga0070685_10318900
433 Ga0070707_100688533
434 Ga0070698_100000242
435 Ga0070698_100941901
436 Ga0070698_101164528
437 Ga0070698_101456852
438 Ga0070699_100000778
439 Ga0070699_100149056
440 Ga0070699_100337058
441 Ga0070699_101234748
442 Ga0070699_101406032
443 Ga0070697_100035422
444 Ga0070672_100042736
445 Ga0070672_100907152
446 Ga0070672_101263027
447 Ga0070686_100419466
448 Ga0070695_101091734
449 Ga0070696_100002023
450 Ga0070696_100998585
451 Ga0070696_101352694
452 Ga0070665_100065115
453 Ga0070665_100517414
454 Ga0070704_100062373
455 Ga0068855_102326003
456 Ga0070664_100016118
457 Ga0068857_100818495
458 Ga0068857_101953948
459 Ga0070702_100120520
460 Ga0068859_100104910
461 Ga0068859_100289661
462 Ga0068859_100400215
463 Ga0068864_100006051
464 Ga0068861_100131324
465 Ga0068861_100206064
466 Ga0068870_10182118
467 Ga0068863_100910893
468 Ga0068863_102509320
469 Ga0068858_100169126
470 Ga0068858_100190526
471 Ga0068862_100314893
472 Ga0081455_10083461
473 Ga0081539_10000090
474 Ga0070717_10298964
475 Ga0097621_100006929
476 Ga0097621_101413409
477 Ga0068871_100002804
478 Ga0068871_100027882
479 Ga0068871_100125192
480 Ga0075428_100704994
481 Ga0075428_101383526
482 Ga0075430_100042186
483 Ga0075431_100049463
484 Ga0075433_10084859
485 Ga0075433_10948098
486 Ga0075434_100196368
487 Ga0075434_101325088
488 Ga0075434_101379552
489 Ga0075434_102648736
490 Ga0075429_100105912
491 Ga0075429_100247541
492 Ga0075429_100717060
493 Ga0068865_100010986
494 Ga0075436_100006766
495 Ga0075436_100186249
496 Ga0097620_100104908
497 Ga0097620_100289673
498 Ga0097620_100400270
499 Ga0075435_100194449
500 Ga0111539_10053614
501 Ga0111539_11181628
502 Ga0111539_11348608
503 Ga0105245_10880460
504 Ga0105247_10668754
505 Ga0114129_10182079
506 Ga0114129_10226582
507 Ga0114129_11231321
508 Ga0114129_11921569
509 Ga0105242_10535967
510 Ga0105242_11415184
511 Ga0105248_10020179
512 Ga0105248_10184460
513 Ga0105248_10533245
514 Ga0105248_10925607
515 Ga0105248_12222390
516 Ga0105249_10621895
517 Ga0105249_11392458
518 Ga0105249_12940353
519 Ga0105249_13476792
520 Ga0105246_10370282
521 Ga0157374_12780073
522 Ga0157378_10229131
523 Ga0163162_12800978
524 Ga0157375_10441906
525 Ga0157375_11713781
526 Ga0157375_12177666
527 Ga0157375_13321874
528 Ga0163163_10009443
529 Ga0163163_10072400
530 Ga0157380_10264873
531 Ga0157380_10565011
532 Ga0157380_13415435
533 Ga0157377_10093037
534 Ga0157377_10488670
535 Ga0157377_10540242
536 Ga0157379_12118132
537 Ga0157376_10152037
538 Ga0157376_11386601
539 Ga0163161_11753266
540 Ga0207697_10207267
541 Ga0207682_10067640
542 Ga0207680_10435249
543 Ga0207645_10829648
544 Ga0207707_10895357
545 Ga0207660_11319958
546 Ga0207657_10066571
547 Ga0207652_10040793
548 Ga0207646_10443139
549 Ga0207681_10063318
550 Ga0207650_10001350
551 Ga0207659_10021521
552 Ga0207659_10188725
553 Ga0207659_10600675
554 Ga0207687_11440698
555 Ga0207644_11156824
556 Ga0207690_10057603
557 Ga0207690_11749881
558 Ga0207706_10685243
559 Ga0207686_10163360
560 Ga0207670_10045391
561 Ga0207669_10061165
562 Ga0207669_10357423
563 Ga0207704_10004287
564 Ga0207704_11213256
565 Ga0207691_10009627
566 Ga0207691_10831388
567 Ga0207711_10070774
568 Ga0207711_10267980
569 Ga0207711_10592878
570 Ga0207711_10840980
571 Ga0207689_10220147
572 Ga0207689_10380306
573 Ga0207661_10842231
574 Ga0207679_10025500
575 Ga0207679_10920270
576 Ga0207651_10034738
577 Ga0207712_10824658
578 Ga0207712_11776482
579 Ga0207668_10204911
580 Ga0207668_11102665
581 Ga0207640_11805803
582 Ga0207658_10416460
583 Ga0207703_12021595
584 Ga0207708_10253548
585 Ga0207708_10367717
586 Ga0207708_10465440
587 Ga0207708_10851408
588 Ga0207702_10762028
589 Ga0207641_10278717
590 Ga0207641_11788394
591 Ga0207648_11352204
592 Ga0207676_10263844
593 Ga0207676_10355299
594 Ga0207674_11391827
595 Ga0207674_11499410
596 Ga0207675_100176418
597 Ga0207675_100231302
598 Ga0207675_101929247
599 Ga0207675_101984356
600 Ga0207683_10079795
601 Ga0207428_10485540
602 Ga0268266_10057057
603 Ga0268265_10096064
604 Ga0268265_12338750
605 Ga0307408_100003848
606 Ga0307408_100459266
607 Ga0307408_100989811
608 Ga0307405_10000655
609 Ga0307405_10037608
610 Ga0307405_10420470
611 Ga0307405_11892900
612 Ga0307413_10006996
613 Ga0307413_10096316
614 Ga0307413_10440517
615 Ga0307410_10009942
616 Ga0307410_10031213
617 Ga0307410_11526902
618 Ga0307410_12007252
619 Ga0307406_10042507
620 Ga0307406_10071788
621 Ga0307407_10005789
622 Ga0307407_10772340
623 Ga0307412_10086408
624 Ga0307412_10176487
625 Ga0307412_10766895
626 Ga0307409_100003910
627 Ga0307409_100026502
628 Ga0307409_100498561
629 Ga0307409_100539628
630 Ga0307416_100000683
631 Ga0307416_100003573
632 Ga0307416_100485158
633 Ga0307416_101213258
634 Ga0307416_101867159
635 Ga0307416_102567989
636 Ga0307414_10008823
637 Ga0307414_10035146
638 Ga0307414_10113320
639 Ga0307414_10299394
640 Ga0307411_10001781
641 Ga0307411_10005339
642 Ga0307411_10025899
643 Ga0307411_10888651
644 Ga0307415_100004748
645 Ga0307415_100011537
646 Ga0373934_0087683
647 Ga0373956_0302057
648 Ga0373943_0426961
649 Ga0373946_0418650
650 Ga0373955_0295715
651 Ga0373935_0592591
652 Ga0373927_0386882
653 Ga0373933_0672512
654 Ga0373947_0117913
655 Ga0373947_0469774
656 Ga0373947_1262449
657 Ga0373937_0480442
658 Ga0373937_0614578
659 Ga0373937_1395636
660 Ga0373925_0304106
661 Ga0451800_1610681
662 Ga0451845_0588700
663 Ga0450923_015538
664 Ga0466967_0889231
665 Ga0495603_0229352
666 Ga0495603_0639837
667 Ga0495629_0419739
668 Ga0495582_0107079
669 Ga0495584_0356061
670 Ga0495628_0342708
671 Ga0495642_0311138
672 Ga0495598_0012952
673 Ga0495633_0113484
674 Ga0495635_0424089
675 Ga0495659_0041240
676 Ga0495647_0479090
677 Ga0495658_0293235
678 Ga0495658_0587017
679 Ga0495670_0401709
680 Ga0495670_0704155
681 Ga0495636_0033875
682 Ga0495636_0117985
683 Ga0495674_0703701
684 Ga0495602_0294433
685 Ga0495614_0389234
686 Ga0496104_0726101
687 Ga0496105_0552744
688 Ga0496106_0448003
689 Ga0496112_0144487
690 Ga0496112_0210221
691 Ga0496112_1819259
692 Ga0496113_0275280
693 Ga0501291_022479
694 Ga0501292_137880
695 Ga0501297_090967
696 Ga0501299_003607
697 Ga0501299_180025
698 Ga0501033_0615007
699 Ga0501033_0968166
700 Ga0501034_0034928
701 Ga0501040_0027234
702 Ga0501041_0024987
703 Ga0501042_0003808
704 Ga0501043_0186432
705 Ga0501043_0967250
706 Ga0501046_1043725
707 Ga0501047_0009879
708 Ga0501048_0026499
709 Ga0501071_0047924
710 Ga0501071_1466307
711 Ga0501075_0135765
712 Ga0501076_0088144
713 Ga0501077_0138651
714 Ga0501199_044981
715 Ga0501249_023517
716 Ga0501249_087917
717 Ga0501257_113105
718 Ga0501258_052669
719 Ga0501234_031106
720 Ga0501079_1392136
721 Ga0501080_0372035
722 Ga0501081_0077750
723 Ga0501081_0463837
724 Ga0501081_0867370
725 Ga0501262_067338
726 Ga0501270_032445
727 Ga0501273_006920
728 Ga0501275_066528
729 Ga0501035_1081720
730 Ga0501044_0006636
731 Ga0501045_0573015
732 nmdc:mga05p37_1470107_c1
733 nmdc:mga05p37_52621_c1
734 nmdc:mga09592_261473_c1
735 nmdc:mga09592_345976_c1
736 nmdc:mga09592_729532_c1
737 nmdc:mga0qj67_36274_c1
738 nmdc:mga06r32_8513_c1
739 nmdc:mga08y16_1082440_c1
740 nmdc:mga08y16_1401902_c1
741 nmdc:mga08y16_1684035_c1
742 nmdc:mga08y16_18526_c1
743 nmdc:mga08y16_49622_c1
744 nmdc:mga0n895_1129144_c1
745 nmdc:mga0n895_362859_c1
746 nmdc:mga0n895_412133_c1
747 nmdc:mga0rr50_202634_c1
748 nmdc:mga08x19_177347_c1
749 nmdc:mga08x19_268987_c1
750 nmdc:mga0a205_41773_c1
751 Ga0495601_0117061
752 Ga0495601_0700291
753 Ga0495619_0185723
754 Ga0495619_0989339
755 Ga0501084_0020343
756 Ga0590071_000060
757 Ga0590071_004088
758 Ga0590074_000203
759 Ga0590074_014141
760 Ga0590075_000338
761 Ga0590075_006284
762 Ga0590077_000202

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11146

DUF2905

Protein of unknown function (DUF2905)

18

78

0.96

Map