F428962

General Info

Members Datasets Scaffolds Average Seq Length
381 192 381 154

Family's Representative Sequence

Representative Sequence 3300013297|Ga0157378_10012780|Ga0157378_100127806
Length 166
Sequence VVAEMRVRIAPDPFDPQAEIAAFTAGRDDAGALASFVGYCRASTDGVAVNELRIDHYPGFSEKEIARLAEETARRFDCPELLVIHRVGVIRPGEAIVLVAALSIHRASAFDAVRILMDYLKTDAPLWKKETGPGGARWIEPRAEDHARRQKAEEQXXXGXMEKGRT

Samples

Sample ID Description Type Environment
1 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
47 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
48 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
49 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
50 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
51 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
52 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
53 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
54 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
57 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
58 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
59 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
60 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
61 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
66 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
67 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
68 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
69 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
71 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
72 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
73 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
121 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
122 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
123 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
124 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
125 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
126 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
127 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
128 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
129 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
130 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
131 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
132 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
133 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
134 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
135 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
136 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
137 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
138 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
139 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
140 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
141 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
142 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
143 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
144 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
145 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
146 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
147 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
148 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
149 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
150 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
151 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
152 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
153 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
154 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
155 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
156 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
157 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
171 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
172 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
173 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
174 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
175 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
176 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
177 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
178 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
179 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
180 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
182 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
183 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
184 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
185 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
186 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
187 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
188 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
189 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
190 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
191 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
192 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.2
Nodule 0
Rhizoplane 0.26
Rhizosphere 93.96
Stem 0
Stem Tuber 0
Unclassified 1.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25165J46597_1000013 3300003214 Bacteria 402100
2 JGI25153J46596_10000293 3300003215 Bacteria 37385
3 rootH2_10092111 3300003320 Bacteria 1247
4 Ga0070658_10179289 3300005327 Unclassified 1782
5 Ga0070658_10894577 3300005327 Bacteria 772
6 Ga0070658_11130164 3300005327 Bacteria 681
7 Ga0070676_11158225 3300005328 Bacteria 586
8 Ga0070676_11159464 3300005328 Bacteria 586
9 Ga0070683_100116591 3300005329 Bacteria 2522
10 Ga0070683_100384783 3300005329 Bacteria 1337
11 Ga0070670_100899681 3300005331 Bacteria 802
12 Ga0070677_10175570 3300005333 Bacteria 1016
13 Ga0068869_100035947 3300005334 Bacteria 3515
14 Ga0068869_100724723 3300005334 Bacteria 850
15 Ga0068869_101925465 3300005334 Unclassified 530
16 Ga0070666_10003719 3300005335 Bacteria 9242
17 Ga0070666_10078412 3300005335 Bacteria 2255
18 Ga0070680_100040150 3300005336 Bacteria 3788
19 Ga0068868_100092212 3300005338 Bacteria 2441
20 Ga0068868_100146527 3300005338 Bacteria 1942
21 Ga0068868_100390424 3300005338 Bacteria 1199
22 Ga0068868_101027662 3300005338 Bacteria 755
23 Ga0068868_101209678 3300005338 Bacteria 699
24 Ga0070660_100022435 3300005339 Bacteria 4668
25 Ga0070660_100029869 3300005339 Bacteria 4086
26 Ga0070687_100220474 3300005343 Unclassified 1161
27 Ga0070661_100051567 3300005344 Unclassified 3011
28 Ga0070668_100385173 3300005347 Unclassified 1194
29 Ga0070675_100098537 3300005354 Unclassified 2459
30 Ga0070674_100381154 3300005356 Bacteria 1147
31 Ga0070674_100526628 3300005356 Bacteria 988
32 Ga0070673_100245923 3300005364 Bacteria 1557
33 Ga0070673_100376976 3300005364 Unclassified 1264
34 Ga0070688_100162049 3300005365 Bacteria 1537
35 Ga0070659_100359628 3300005366 Bacteria 1223
36 Ga0070659_101397323 3300005366 Bacteria 622
37 Ga0070667_100013558 3300005367 Bacteria 6734
38 Ga0070667_100086160 3300005367 Bacteria 2695
39 Ga0070663_100309093 3300005455 Bacteria 1268
40 Ga0070663_100532793 3300005455 Unclassified 979
41 Ga0070678_100013834 3300005456 Bacteria 5072
42 Ga0070678_100427516 3300005456 Unclassified 1156
43 Ga0070678_100676678 3300005456 Bacteria 928
44 Ga0070681_10124626 3300005458 Bacteria 2509
45 Ga0070681_10154433 3300005458 Bacteria 2221
46 Ga0070681_10235668 3300005458 Bacteria 1744
47 Ga0068867_100001750 3300005459 Bacteria 15119
48 Ga0068867_100014240 3300005459 Bacteria 5634
49 Ga0068867_101001968 3300005459 Unclassified 757
50 Ga0068867_101065962 3300005459 Bacteria 736
51 Ga0070685_11184500 3300005466 Unclassified 580
52 Ga0070679_100015301 3300005530 Bacteria 7371
53 Ga0070679_100097620 3300005530 Bacteria 2926
54 Ga0070679_100559583 3300005530 Bacteria 1087
55 Ga0070679_100581734 3300005530 Bacteria 1063
56 Ga0070679_101484104 3300005530 Bacteria 625
57 Ga0070684_100295366 3300005535 Unclassified 1486
58 Ga0068853_100137953 3300005539 Unclassified 2188
59 Ga0068853_100241138 3300005539 Bacteria 1657
60 Ga0068853_100775844 3300005539 Bacteria 917
61 Ga0068853_101455183 3300005539 Unclassified 663
62 Ga0070686_100244079 3300005544 Bacteria 1309
63 Ga0070693_100253487 3300005547 Bacteria 1167
64 Ga0070665_100000328 3300005548 Bacteria 73231
65 Ga0070665_100027734 3300005548 Bacteria 5701
66 Ga0070665_100044535 3300005548 Bacteria 4456
67 Ga0070665_100095824 3300005548 Bacteria 2972
68 Ga0070665_100144804 3300005548 Bacteria 2380
69 Ga0070665_100687065 3300005548 Bacteria 1036
70 Ga0070665_100713514 3300005548 Bacteria 1016
71 Ga0068855_100051412 3300005563 Bacteria 4854
72 Ga0068855_100196276 3300005563 Bacteria 2274
73 Ga0068855_100460894 3300005563 Unclassified 1386
74 Ga0068855_100971749 3300005563 Bacteria 894
75 Ga0068857_100785929 3300005577 Unclassified 908
76 Ga0068857_101187929 3300005577 Bacteria 738
77 Ga0068856_100025196 3300005614 Bacteria 5796
78 Ga0068856_100260128 3300005614 Bacteria 1751
79 Ga0068856_100630319 3300005614 Bacteria 1093
80 Ga0068864_100199175 3300005618 Bacteria 1839
81 Ga0068866_10032692 3300005718 Bacteria 2517
82 Ga0068861_100713487 3300005719 Bacteria 933
83 Ga0068861_101956404 3300005719 Bacteria 584
84 Ga0068851_10610313 3300005834 Bacteria 665
85 Ga0068863_100199218 3300005841 Bacteria 1926
86 Ga0068863_100854227 3300005841 Bacteria 909
87 Ga0068858_100119044 3300005842 Bacteria 2469
88 Ga0068858_100184195 3300005842 Bacteria 1972
89 Ga0068860_100148694 3300005843 Bacteria 2255
90 Ga0068860_100160498 3300005843 Bacteria 2167
91 Ga0068862_100228084 3300005844 Bacteria 1689
92 Ga0097621_100000046 3300006237 Bacteria 64086
93 Ga0097621_100100251 3300006237 Bacteria 2436
94 Ga0097621_100137680 3300006237 Bacteria 2084
95 Ga0068871_100000004 3300006358 Bacteria 123358
96 Ga0068871_100055578 3300006358 Bacteria 3214
97 Ga0068871_100107860 3300006358 Bacteria 2340
98 Ga0068871_100206565 3300006358 Bacteria 1697
99 Ga0068865_100144897 3300006881 Bacteria 1795
100 Ga0105240_10048584 3300009093 Bacteria 5362
101 Ga0105240_10072822 3300009093 Bacteria 4245
102 Ga0105240_10149248 3300009093 Bacteria 2786
103 Ga0105240_10150964 3300009093 Bacteria 2767
104 Ga0105240_10630047 3300009093 Bacteria 1177
105 Ga0105240_10681296 3300009093 Bacteria 1124
106 Ga0105240_11216543 3300009093 Bacteria 797
107 Ga0105245_12220341 3300009098 Bacteria 603
108 Ga0105243_10020514 3300009148 Bacteria 5010
109 Ga0105243_10214093 3300009148 Bacteria 1698
110 Ga0105241_10026371 3300009174 Bacteria 4323
111 Ga0105241_10142715 3300009174 Bacteria 1952
112 Ga0105241_10208244 3300009174 Bacteria 1637
113 Ga0105241_10212141 3300009174 Bacteria 1623
114 Ga0105242_10058031 3300009176 Bacteria 3171
115 Ga0105242_10170116 3300009176 Bacteria 1914
116 Ga0105242_10210308 3300009176 Bacteria 1733
117 Ga0105242_12268101 3300009176 Bacteria 589
118 Ga0105248_10015941 3300009177 Bacteria 8277
119 Ga0105248_10817835 3300009177 Bacteria 1052
120 Ga0105248_11246824 3300009177 Unclassified 841
121 Ga0105237_10054465 3300009545 Bacteria 4008
122 Ga0105237_10098430 3300009545 Bacteria 2916
123 Ga0105237_10108919 3300009545 Unclassified 2761
124 Ga0105237_10259852 3300009545 Bacteria 1739
125 Ga0105237_10290074 3300009545 Bacteria 1639
126 Ga0105238_10034382 3300009551 Bacteria 5157
127 Ga0105238_10035871 3300009551 Bacteria 5041
128 Ga0105238_10096473 3300009551 Bacteria 2943
129 Ga0105238_10167382 3300009551 Bacteria 2174
130 Ga0105238_11446830 3300009551 Bacteria 715
131 Ga0105249_10053552 3300009553 Bacteria 3688
132 Ga0105239_10031290 3300010375 Bacteria 5852
133 Ga0105239_10102347 3300010375 Bacteria 3170
134 Ga0105239_10208061 3300010375 Bacteria 2192
135 Ga0105239_10570856 3300010375 Bacteria 1289
136 Ga0105239_10609911 3300010375 Bacteria 1245
137 Ga0105239_11305688 3300010375 Bacteria 837
138 Ga0105239_11665584 3300010375 Unclassified 738
139 Ga0105246_10037750 3300011119 Bacteria 3243
140 Ga0105246_10044218 3300011119 Bacteria 3026
141 Ga0105246_10259724 3300011119 Unclassified 1383
142 Ga0157370_10009349 3300013104 Bacteria 10487
143 Ga0157370_10044085 3300013104 Bacteria 4290
144 Ga0157370_10932095 3300013104 Bacteria 787
145 Ga0157369_10220457 3300013105 Bacteria 1985
146 Ga0157369_11626296 3300013105 Bacteria 657
147 Ga0157378_10012780 3300013297 Bacteria 7349
148 Ga0157378_10066447 3300013297 Bacteria 3230
149 Ga0157378_10090146 3300013297 Bacteria 2786
150 Ga0163162_10003970 3300013306 Bacteria 14184
151 Ga0163162_10345994 3300013306 Bacteria 1619
152 Ga0163162_10481034 3300013306 Bacteria 1373
153 Ga0163162_10537192 3300013306 Unclassified 1298
154 Ga0157372_10024209 3300013307 Bacteria 6591
155 Ga0157375_10011357 3300013308 Bacteria 7862
156 Ga0157375_10229850 3300013308 Bacteria 2014
157 Ga0157375_11530822 3300013308 Unclassified 788
158 Ga0163163_10000006 3300014325 Bacteria 320401
159 Ga0163163_10014059 3300014325 Bacteria 7348
160 Ga0163163_10158809 3300014325 Bacteria 2306
161 Ga0163163_11980615 3300014325 Unclassified 642
162 Ga0157380_10307803 3300014326 Bacteria 1463
163 Ga0157380_10635882 3300014326 Unclassified 1062
164 Ga0157379_10000605 3300014968 Bacteria 28967
165 Ga0157379_10095234 3300014968 Bacteria 2671
166 Ga0157379_10263791 3300014968 Bacteria 1566
167 Ga0157379_11971209 3300014968 Unclassified 577
168 Ga0157376_10145202 3300014969 Unclassified 2133
169 Ga0157376_10343402 3300014969 Bacteria 1426
170 Ga0209563_118387 3300025230 Unclassified 821
171 Ga0207427_116952 3300025231 Unclassified 677
172 Ga0209233_1000013 3300025261 Bacteria 1013785
173 Ga0209233_1007476 3300025261 Bacteria 3458
174 Ga0209758_1000013 3300025297 Bacteria 873003
175 Ga0207688_10016755 3300025901 Bacteria 3978
176 Ga0207680_10015411 3300025903 Bacteria 3988
177 Ga0207680_10042591 3300025903 Bacteria 2657
178 Ga0207647_10305724 3300025904 Bacteria 905
179 Ga0207645_10027200 3300025907 Bacteria 3695
180 Ga0207645_10571400 3300025907 Unclassified 767
181 Ga0207643_10092806 3300025908 Bacteria 1762
182 Ga0207705_10002737 3300025909 Bacteria 13516
183 Ga0207705_10180448 3300025909 Unclassified 1593
184 Ga0207654_10009595 3300025911 Bacteria 4920
185 Ga0207654_10135877 3300025911 Bacteria 1562
186 Ga0207654_11125890 3300025911 Unclassified 572
187 Ga0207707_10115820 3300025912 Bacteria 2342
188 Ga0207707_10154383 3300025912 Bacteria 2007
189 Ga0207695_10024152 3300025913 Bacteria 6847
190 Ga0207695_10068651 3300025913 Bacteria 3631
191 Ga0207695_10108011 3300025913 Bacteria 2767
192 Ga0207695_10157075 3300025913 Bacteria 2208
193 Ga0207695_10246639 3300025913 Bacteria 1686
194 Ga0207695_11716862 3300025913 Unclassified 509
195 Ga0207671_10111432 3300025914 Bacteria 2082
196 Ga0207671_10401681 3300025914 Bacteria 1090
197 Ga0207671_10471044 3300025914 Bacteria 1001
198 Ga0207660_10068902 3300025917 Bacteria 2567
199 Ga0207662_10111557 3300025918 Bacteria 1706
200 Ga0207657_10008929 3300025919 Bacteria 10128
201 Ga0207657_10019317 3300025919 Bacteria 6475
202 Ga0207657_10345476 3300025919 Bacteria 1174
203 Ga0207649_10065522 3300025920 Bacteria 2300
204 Ga0207652_10012053 3300025921 Bacteria 6978
205 Ga0207652_10305800 3300025921 Unclassified 1435
206 Ga0207652_10514143 3300025921 Bacteria 1078
207 Ga0207694_10064253 3300025924 Unclassified 2861
208 Ga0207694_10082000 3300025924 Unclassified 2534
209 Ga0207694_10212792 3300025924 Bacteria 1575
210 Ga0207650_10194592 3300025925 Bacteria 1622
211 Ga0207650_11786606 3300025925 Unclassified 520
212 Ga0207659_10027797 3300025926 Bacteria 3834
213 Ga0207659_10109267 3300025926 Bacteria 2099
214 Ga0207659_10656032 3300025926 Unclassified 897
215 Ga0207700_11121421 3300025928 Unclassified 703
216 Ga0207706_11207530 3300025933 Bacteria 628
217 Ga0207686_10135484 3300025934 Bacteria 1695
218 Ga0207686_10171414 3300025934 Bacteria 1531
219 Ga0207709_11564659 3300025935 Unclassified 547
220 Ga0207669_10611463 3300025937 Unclassified 887
221 Ga0207704_10163412 3300025938 Bacteria 1587
222 Ga0207691_10627997 3300025940 Bacteria 908
223 Ga0207711_10014304 3300025941 Bacteria 6590
224 Ga0207689_10022424 3300025942 Bacteria 5310
225 Ga0207689_10097246 3300025942 Bacteria 2418
226 Ga0207689_10110017 3300025942 Bacteria 2264
227 Ga0207661_10055010 3300025944 Bacteria 3190
228 Ga0207679_11412532 3300025945 Unclassified 638
229 Ga0207667_10066953 3300025949 Bacteria 3742
230 Ga0207667_10252112 3300025949 Bacteria 1805
231 Ga0207667_10316025 3300025949 Bacteria 1595
232 Ga0207667_10486235 3300025949 Unclassified 1253
233 Ga0207667_10488473 3300025949 Bacteria 1250
234 Ga0207651_10175355 3300025960 Bacteria 1695
235 Ga0207651_10482684 3300025960 Bacteria 1068
236 Ga0207712_11414782 3300025961 Unclassified 622
237 Ga0207668_10356271 3300025972 Bacteria 1225
238 Ga0207658_10024071 3300025986 Bacteria 4255
239 Ga0207658_10066504 3300025986 Bacteria 2711
240 Ga0207677_10293830 3300026023 Bacteria 1340
241 Ga0207677_10986092 3300026023 Bacteria 763
242 Ga0207703_10046062 3300026035 Bacteria 3511
243 Ga0207703_10125427 3300026035 Bacteria 2210
244 Ga0207639_10262667 3300026041 Bacteria 1511
245 Ga0207639_10596892 3300026041 Bacteria 1018
246 Ga0207639_10771992 3300026041 Unclassified 895
247 Ga0207678_10278224 3300026067 Bacteria 1436
248 Ga0207641_10063110 3300026088 Bacteria 3164
249 Ga0207648_10019524 3300026089 Bacteria 6117
250 Ga0207648_10022437 3300026089 Bacteria 5666
251 Ga0207648_11326896 3300026089 Bacteria 676
252 Ga0207676_10055023 3300026095 Bacteria 3121
253 Ga0207676_10451851 3300026095 Unclassified 1211
254 Ga0207674_10079742 3300026116 Bacteria 3277
255 Ga0207674_11166031 3300026116 Bacteria 740
256 Ga0207675_100112676 3300026118 Bacteria 2568
257 Ga0207675_100269014 3300026118 Unclassified 1654
258 Ga0207683_10008775 3300026121 Bacteria 8632
259 Ga0207683_10074021 3300026121 Bacteria 3013
260 Ga0207698_11413321 3300026142 Bacteria 711
261 Ga0268266_10000975 3300028379 Bacteria 36323
262 Ga0268266_10010732 3300028379 Bacteria 7983
263 Ga0268266_10014103 3300028379 Bacteria 6880
264 Ga0268266_10026894 3300028379 Bacteria 4895
265 Ga0268266_10051777 3300028379 Bacteria 3525
266 Ga0268266_10142830 3300028379 Unclassified 2149
267 Ga0268266_10454964 3300028379 Bacteria 1217
268 Ga0268264_10054695 3300028381 Bacteria 3333
269 Ga0268264_10102962 3300028381 Bacteria 2485
270 Ga0265318_10000568 3300028577 Bacteria 26046
271 Ga0265338_10004077 3300028800 Bacteria 20009
272 Ga0265338_10018601 3300028800 Bacteria 7424
273 Ga0265330_10020629 3300031235 Bacteria 3011
274 Ga0265332_10025546 3300031238 Bacteria 2593
275 Ga0265332_10054006 3300031238 Bacteria 1724
276 Ga0265328_10058343 3300031239 Bacteria 1417
277 Ga0265340_10004659 3300031247 Bacteria 7632
278 Ga0265340_10178172 3300031247 Bacteria 961
279 Ga0265339_10065507 3300031249 Bacteria 1948
280 Ga0265331_10018706 3300031250 Bacteria 3586
281 Ga0265316_10037926 3300031344 Bacteria 3886
282 Ga0307513_10714424 3300031456 Unclassified 708
283 Ga0265313_10002805 3300031595 Bacteria 14705
284 Ga0265313_10033893 3300031595 Bacteria 2589
285 Ga0265314_10005911 3300031711 Bacteria 10941
286 Ga0265314_10013083 3300031711 Bacteria 6728
287 Ga0265342_10040044 3300031712 Bacteria 2843
288 Ga0265342_10177334 3300031712 Bacteria 1169
289 Ga0307516_10055871 3300031730 Bacteria 3852
290 Ga0307416_103323401 3300032002 Bacteria 538
291 Ga0307510_10308020 3300033180 Bacteria 1044
292 Ga0373931_0048042 3300035691 Bacteria 2261
293 Ga0395899_0392944 3300037312 Bacteria 919
294 Ga0395900_0201363 3300037418 Bacteria 2014
295 Ga0395898_0013029 3300037466 Bacteria 8569
296 Ga0395898_0204778 3300037466 Bacteria 1883
297 Ga0395905_0040846 3300037471 Bacteria 4352
298 Ga0395901_0024715 3300038443 Bacteria 6168
299 Ga0451787_241163 3300041441 Bacteria 845
300 Ga0466963_1243346 3300044694 Bacteria 523
301 Ga0495629_0848251 3300046459 Unclassified 601
302 Ga0495638_0500588 3300046460 Unclassified 612
303 Ga0495620_0384268 3300046515 Bacteria 532
304 Ga0495609_0029878 3300046538 Bacteria 2480
305 Ga0495622_0047541 3300046557 Bacteria 1993
306 Ga0495611_0153476 3300046648 Bacteria 1075
307 Ga0495611_0256775 3300046648 Bacteria 810
308 Ga0495625_0064346 3300046660 Bacteria 2587
309 Ga0495657_0069724 3300046675 Bacteria 2300
310 Ga0495599_0713730 3300046678 Bacteria 577
311 Ga0495636_0031726 3300047318 Bacteria 2167
312 Ga0495672_0182577 3300047320 Bacteria 1061
313 Ga0495672_0203741 3300047320 Bacteria 988
314 Ga0496121_0003884 3300048924 Bacteria 20773
315 Ga0496126_0113794 3300048929 Bacteria 2355
316 Ga0501031_0002923 3300049568 Bacteria 10931
317 Ga0501031_0733241 3300049568 Unclassified 634
318 Ga0501032_0014943 3300049569 Bacteria 5491
319 Ga0501032_0074448 3300049569 Bacteria 2263
320 Ga0501033_0003655 3300049570 Bacteria 12540
321 Ga0501033_0006469 3300049570 Bacteria 9168
322 Ga0501033_0382250 3300049570 Bacteria 984
323 Ga0501033_0682149 3300049570 Unclassified 700
324 Ga0501034_0134076 3300049571 Bacteria 2458
325 Ga0501034_0199987 3300049571 Bacteria 1957
326 Ga0501034_0274900 3300049571 Bacteria 1625
327 Ga0501034_0377079 3300049571 Bacteria 1344
328 Ga0501036_0004570 3300049572 Bacteria 11178
329 Ga0501036_0327220 3300049572 Bacteria 1280
330 Ga0501037_0011755 3300049573 Bacteria 6446
331 Ga0501038_0045179 3300049574 Bacteria 3824
332 Ga0501038_0223731 3300049574 Bacteria 1500
333 Ga0501039_0012070 3300049575 Bacteria 6587
334 Ga0501042_0005927 3300049578 Bacteria 7905
335 Ga0501043_0049084 3300049579 Bacteria 3317
336 Ga0501046_0001636 3300049580 Bacteria 21447
337 Ga0501046_0984062 3300049580 Bacteria 586
338 Ga0501047_0004000 3300049581 Bacteria 13852
339 Ga0501047_0019746 3300049581 Bacteria 6468
340 Ga0501047_0065983 3300049581 Bacteria 3488
341 Ga0501047_0481125 3300049581 Bacteria 1069
342 Ga0501048_0004393 3300049582 Bacteria 10738
343 Ga0501067_0001919 3300049583 Bacteria 11420
344 Ga0501068_0333030 3300049584 Bacteria 974
345 Ga0501069_0008224 3300049585 Bacteria 5477
346 Ga0501069_0672514 3300049585 Bacteria 624
347 Ga0501070_0004446 3300049586 Bacteria 12038
348 Ga0501071_0083107 3300049587 Bacteria 2346
349 Ga0501073_0004055 3300049589 Bacteria 11006
350 Ga0501073_0127358 3300049589 Bacteria 1765
351 Ga0501074_0001155 3300049590 Bacteria 17276
352 Ga0501079_0003788 3300049741 Bacteria 11169
353 Ga0501080_0001040 3300049742 Bacteria 22818
354 Ga0501080_1428746 3300049742 Unclassified 590
355 Ga0501083_0004091 3300049744 Bacteria 10268
356 Ga0501083_0031695 3300049744 Bacteria 3628
357 Ga0501083_0123219 3300049744 Bacteria 1700
358 Ga0501035_0008173 3300049822 Bacteria 9749
359 Ga0501035_0009408 3300049822 Bacteria 9085
360 Ga0501035_0026973 3300049822 Bacteria 5253
361 Ga0501035_0487499 3300049822 Unclassified 1016
362 Ga0501044_0006311 3300049823 Bacteria 13108
363 Ga0501044_0043283 3300049823 Bacteria 4679
364 Ga0501044_0047113 3300049823 Bacteria 4460
365 Ga0501044_0988330 3300049823 Bacteria 714
366 Ga0500635_0055027 3300053080 Bacteria 1373
367 Ga0500643_000021 3300053087 Bacteria 284326
368 Ga0500592_054004 3300053116 Bacteria 654
369 Ga0500594_0073466 3300053118 Bacteria 1010
370 Ga0500595_001931 3300053119 Bacteria 10667
371 Ga0500595_020812 3300053119 Bacteria 2352
372 Ga0500559_0136919 3300053136 Bacteria 1145
373 Ga0500568_0028081 3300053139 Bacteria 2348
374 Ga0500573_0000012 3300053140 Bacteria 208486
375 Ga0501084_0009877 3300054114 Bacteria 7887
376 Ga0501084_1032804 3300054114 Unclassified 690
377 Ga0501084_1323809 3300054114 Unclassified 604
378 Ga0501082_0007125 3300060353 Bacteria 9641
379 Ga0501082_0013584 3300060353 Bacteria 6997
380 Ga0501082_0277596 3300060353 Bacteria 1459
381 Ga0530510_0304520 3300061734 Bacteria 1193

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037466 Ga0395898_0204778 Ga0395898_0204778_940_1374 141
2 3300037471 Ga0395905_0040846 Ga0395905_0040846_2174_2608 141
3 3300009551 Ga0105238_10167382 Ga0105238_101673824 144
4 3300048929 Ga0496126_0113794 Ga0496126_0113794_91_531 146
5 3300014969 Ga0157376_10343402 Ga0157376_103434023 150
6 3300025926 Ga0207659_10656032 Ga0207659_106560322 150
7 3300005328 Ga0070676_11158225 Ga0070676_111582251 151
8 3300005333 Ga0070677_10175570 Ga0070677_101755701 151
9 3300005338 Ga0068868_100390424 Ga0068868_1003904243 151
10 3300005338 Ga0068868_101027662 Ga0068868_1010276621 151
11 3300005364 Ga0070673_100376976 Ga0070673_1003769762 151
12 3300005366 Ga0070659_101397323 Ga0070659_1013973231 151
13 3300005456 Ga0070678_100676678 Ga0070678_1006766782 151
14 3300005459 Ga0068867_101065962 Ga0068867_1010659622 151
15 3300005466 Ga0070685_11184500 Ga0070685_111845001 151
16 3300005535 Ga0070684_100295366 Ga0070684_1002953662 151
17 3300005548 Ga0070665_100027734 Ga0070665_1000277345 151
18 3300005563 Ga0068855_100460894 Ga0068855_1004608942 151
19 3300005719 Ga0068861_101956404 Ga0068861_1019564042 151
20 3300005841 Ga0068863_100199218 Ga0068863_1001992182 151
21 3300006358 Ga0068871_100055578 Ga0068871_1000555784 151
22 3300009093 Ga0105240_10072822 Ga0105240_100728226 151
23 3300009174 Ga0105241_10026371 Ga0105241_100263712 151
24 3300009174 Ga0105241_10212141 Ga0105241_102121412 151
25 3300009176 Ga0105242_10170116 Ga0105242_101701163 151
26 3300009176 Ga0105242_12268101 Ga0105242_122681012 151
27 3300009177 Ga0105248_10015941 Ga0105248_100159418 151
28 3300009177 Ga0105248_11246824 Ga0105248_112468242 151
29 3300009545 Ga0105237_10054465 Ga0105237_100544655 151
30 3300009545 Ga0105237_10098430 Ga0105237_100984304 151
31 3300009545 Ga0105237_10108919 Ga0105237_101089194 151
32 3300009551 Ga0105238_10034382 Ga0105238_100343826 151
33 3300009553 Ga0105249_10053552 Ga0105249_100535524 151
34 3300010375 Ga0105239_10031290 Ga0105239_100312905 151
35 3300010375 Ga0105239_10208061 Ga0105239_102080613 151
36 3300010375 Ga0105239_11305688 Ga0105239_113056882 151
37 3300010375 Ga0105239_11665584 Ga0105239_116655841 151
38 3300011119 Ga0105246_10044218 Ga0105246_100442184 151
39 3300013297 Ga0157378_10090146 Ga0157378_100901462 151
40 3300025904 Ga0207647_10305724 Ga0207647_103057242 151
41 3300025911 Ga0207654_11125890 Ga0207654_111258901 151
42 3300025913 Ga0207695_10157075 Ga0207695_101570754 151
43 3300025914 Ga0207671_10471044 Ga0207671_104710442 151
44 3300025924 Ga0207694_10064253 Ga0207694_100642532 151
45 3300025925 Ga0207650_11786606 Ga0207650_117866061 151
46 3300025934 Ga0207686_10135484 Ga0207686_101354842 151
47 3300025940 Ga0207691_10627997 Ga0207691_106279972 151
48 3300025941 Ga0207711_10014304 Ga0207711_100143048 151
49 3300025949 Ga0207667_10486235 Ga0207667_104862352 151
50 3300025960 Ga0207651_10175355 Ga0207651_101753552 151
51 3300026023 Ga0207677_10293830 Ga0207677_102938302 151
52 3300026023 Ga0207677_10986092 Ga0207677_109860922 151
53 3300026088 Ga0207641_10063110 Ga0207641_100631104 151
54 3300026118 Ga0207675_100269014 Ga0207675_1002690142 151
55 3300026142 Ga0207698_11413321 Ga0207698_114133212 151
56 3300028379 Ga0268266_10010732 Ga0268266_100107327 151
57 3300031456 Ga0307513_10714424 Ga0307513_107144241 151
58 3300031730 Ga0307516_10055871 Ga0307516_100558713 151
59 3300035691 Ga0373931_0048042 Ga0373931_0048042_1060_1515 151
60 3300046538 Ga0495609_0029878 Ga0495609_0029878_979_1434 151
61 3300046648 Ga0495611_0153476 Ga0495611_0153476_467_922 151
62 3300047318 Ga0495636_0031726 Ga0495636_0031726_1190_1645 151
63 3300049568 Ga0501031_0733241 Ga0501031_0733241_98_553 151
64 3300049570 Ga0501033_0682149 Ga0501033_0682149_233_688 151
65 3300049571 Ga0501034_0274900 Ga0501034_0274900_927_1382 151
66 3300049574 Ga0501038_0223731 Ga0501038_0223731_15_470 151
67 3300049744 Ga0501083_0123219 Ga0501083_0123219_75_530 151
68 3300049822 Ga0501035_0487499 Ga0501035_0487499_123_578 151
69 3300054114 Ga0501084_1323809 Ga0501084_1323809_49_504 151
70 3300060353 Ga0501082_0277596 Ga0501082_0277596_839_1294 151
71 3300005327 Ga0070658_11130164 Ga0070658_111301642 152
72 3300005366 Ga0070659_100359628 Ga0070659_1003596281 152
73 3300005456 Ga0070678_100427516 Ga0070678_1004275163 152
74 3300005458 Ga0070681_10235668 Ga0070681_102356683 152
75 3300005530 Ga0070679_100581734 Ga0070679_1005817343 152
76 3300005539 Ga0068853_101455183 Ga0068853_1014551831 152
77 3300005548 Ga0070665_100144804 Ga0070665_1001448042 152
78 3300005563 Ga0068855_100196276 Ga0068855_1001962762 152
79 3300009093 Ga0105240_10681296 Ga0105240_106812962 152
80 3300014326 Ga0157380_10307803 Ga0157380_103078033 152
81 3300025919 Ga0207657_10345476 Ga0207657_103454762 152
82 3300025921 Ga0207652_10514143 Ga0207652_105141433 152
83 3300025949 Ga0207667_10066953 Ga0207667_100669534 152
84 3300028379 Ga0268266_10026894 Ga0268266_100268943 152
85 3300032002 Ga0307416_103323401 Ga0307416_1033234011 152
86 3300033180 Ga0307510_10308020 Ga0307510_103080202 152
87 3300047320 Ga0495672_0203741 Ga0495672_0203741_332_790 152
88 3300049568 Ga0501031_0002923 Ga0501031_0002923_3329_3787 152
89 3300049569 Ga0501032_0014943 Ga0501032_0014943_350_808 152
90 3300049570 Ga0501033_0003655 Ga0501033_0003655_4543_5001 152
91 3300049570 Ga0501033_0006469 Ga0501033_0006469_6446_6904 152
92 3300049570 Ga0501033_0382250 Ga0501033_0382250_363_821 152
93 3300049571 Ga0501034_0134076 Ga0501034_0134076_1765_2223 152
94 3300049572 Ga0501036_0004570 Ga0501036_0004570_6788_7246 152
95 3300049572 Ga0501036_0327220 Ga0501036_0327220_21_479 152
96 3300049573 Ga0501037_0011755 Ga0501037_0011755_5621_6079 152
97 3300049574 Ga0501038_0045179 Ga0501038_0045179_2999_3457 152
98 3300049575 Ga0501039_0012070 Ga0501039_0012070_2843_3301 152
99 3300049578 Ga0501042_0005927 Ga0501042_0005927_3952_4410 152
100 3300049579 Ga0501043_0049084 Ga0501043_0049084_1570_2028 152
101 3300049580 Ga0501046_0001636 Ga0501046_0001636_14213_14671 152
102 3300049581 Ga0501047_0004000 Ga0501047_0004000_12753_13211 152
103 3300049581 Ga0501047_0065983 Ga0501047_0065983_1290_1748 152
104 3300049582 Ga0501048_0004393 Ga0501048_0004393_7042_7500 152
105 3300049583 Ga0501067_0001919 Ga0501067_0001919_6142_6600 152
106 3300049584 Ga0501068_0333030 Ga0501068_0333030_196_654 152
107 3300049585 Ga0501069_0008224 Ga0501069_0008224_4671_5129 152
108 3300049586 Ga0501070_0004446 Ga0501070_0004446_10069_10527 152
109 3300049587 Ga0501071_0083107 Ga0501071_0083107_349_807 152
110 3300049589 Ga0501073_0004055 Ga0501073_0004055_160_618 152
111 3300049590 Ga0501074_0001155 Ga0501074_0001155_3210_3668 152
112 3300049741 Ga0501079_0003788 Ga0501079_0003788_10121_10579 152
113 3300049742 Ga0501080_0001040 Ga0501080_0001040_22011_22469 152
114 3300049744 Ga0501083_0004091 Ga0501083_0004091_2869_3327 152
115 3300049822 Ga0501035_0008173 Ga0501035_0008173_8942_9400 152
116 3300049822 Ga0501035_0009408 Ga0501035_0009408_3525_3983 152
117 3300049823 Ga0501044_0006311 Ga0501044_0006311_9893_10351 152
118 3300049823 Ga0501044_0043283 Ga0501044_0043283_879_1337 152
119 3300049823 Ga0501044_0047113 Ga0501044_0047113_1410_1868 152
120 3300054114 Ga0501084_0009877 Ga0501084_0009877_4056_4514 152
121 3300060353 Ga0501082_0007125 Ga0501082_0007125_1737_2195 152
122 3300061734 Ga0530510_0304520 Ga0530510_0304520_409_867 152
123 3300003214 JGI25165J46597_1000013 JGI25165J46597_1000013262 153
124 3300003215 JGI25153J46596_10000293 JGI25153J46596_1000029324 153
125 3300003320 rootH2_10092111 rootH2_100921112 153
126 3300005327 Ga0070658_10179289 Ga0070658_101792892 153
127 3300005327 Ga0070658_10894577 Ga0070658_108945772 153
128 3300005328 Ga0070676_11159464 Ga0070676_111594641 153
129 3300005329 Ga0070683_100116591 Ga0070683_1001165913 153
130 3300005329 Ga0070683_100384783 Ga0070683_1003847833 153
131 3300005331 Ga0070670_100899681 Ga0070670_1008996811 153
132 3300005334 Ga0068869_100035947 Ga0068869_1000359475 153
133 3300005334 Ga0068869_100724723 Ga0068869_1007247232 153
134 3300005334 Ga0068869_101925465 Ga0068869_1019254651 153
135 3300005335 Ga0070666_10003719 Ga0070666_100037194 153
136 3300005335 Ga0070666_10078412 Ga0070666_100784124 153
137 3300005336 Ga0070680_100040150 Ga0070680_1000401503 153
138 3300005338 Ga0068868_100092212 Ga0068868_1000922124 153
139 3300005338 Ga0068868_100146527 Ga0068868_1001465274 153
140 3300005338 Ga0068868_101209678 Ga0068868_1012096782 153
141 3300005339 Ga0070660_100022435 Ga0070660_1000224353 153
142 3300005339 Ga0070660_100029869 Ga0070660_1000298693 153
143 3300005343 Ga0070687_100220474 Ga0070687_1002204742 153
144 3300005344 Ga0070661_100051567 Ga0070661_1000515674 153
145 3300005347 Ga0070668_100385173 Ga0070668_1003851733 153
146 3300005354 Ga0070675_100098537 Ga0070675_1000985374 153
147 3300005356 Ga0070674_100381154 Ga0070674_1003811542 153
148 3300005356 Ga0070674_100526628 Ga0070674_1005266282 153
149 3300005364 Ga0070673_100245923 Ga0070673_1002459233 153
150 3300005365 Ga0070688_100162049 Ga0070688_1001620491 153
151 3300005367 Ga0070667_100013558 Ga0070667_1000135585 153
152 3300005367 Ga0070667_100086160 Ga0070667_1000861603 153
153 3300005455 Ga0070663_100309093 Ga0070663_1003090932 153
154 3300005455 Ga0070663_100532793 Ga0070663_1005327932 153
155 3300005456 Ga0070678_100013834 Ga0070678_1000138345 153
156 3300005458 Ga0070681_10124626 Ga0070681_101246264 153
157 3300005458 Ga0070681_10154433 Ga0070681_101544332 153
158 3300005459 Ga0068867_100001750 Ga0068867_10000175011 153
159 3300005459 Ga0068867_100014240 Ga0068867_1000142402 153
160 3300005459 Ga0068867_101001968 Ga0068867_1010019681 153
161 3300005530 Ga0070679_100015301 Ga0070679_10001530110 153
162 3300005530 Ga0070679_100097620 Ga0070679_1000976204 153
163 3300005530 Ga0070679_100559583 Ga0070679_1005595832 153
164 3300005530 Ga0070679_101484104 Ga0070679_1014841042 153
165 3300005539 Ga0068853_100137953 Ga0068853_1001379534 153
166 3300005539 Ga0068853_100241138 Ga0068853_1002411383 153
167 3300005539 Ga0068853_100775844 Ga0068853_1007758442 153
168 3300005544 Ga0070686_100244079 Ga0070686_1002440791 153
169 3300005547 Ga0070693_100253487 Ga0070693_1002534872 153
170 3300005548 Ga0070665_100000328 Ga0070665_10000032827 153
171 3300005548 Ga0070665_100044535 Ga0070665_1000445352 153
172 3300005548 Ga0070665_100095824 Ga0070665_1000958242 153
173 3300005548 Ga0070665_100687065 Ga0070665_1006870652 153
174 3300005548 Ga0070665_100713514 Ga0070665_1007135142 153
175 3300005563 Ga0068855_100051412 Ga0068855_1000514125 153
176 3300005563 Ga0068855_100971749 Ga0068855_1009717492 153
177 3300005577 Ga0068857_100785929 Ga0068857_1007859293 153
178 3300005577 Ga0068857_101187929 Ga0068857_1011879292 153
179 3300005614 Ga0068856_100025196 Ga0068856_1000251964 153
180 3300005614 Ga0068856_100260128 Ga0068856_1002601283 153
181 3300005614 Ga0068856_100630319 Ga0068856_1006303193 153
182 3300005618 Ga0068864_100199175 Ga0068864_1001991753 153
183 3300005718 Ga0068866_10032692 Ga0068866_100326922 153
184 3300005719 Ga0068861_100713487 Ga0068861_1007134872 153
185 3300005834 Ga0068851_10610313 Ga0068851_106103131 153
186 3300005841 Ga0068863_100854227 Ga0068863_1008542272 153
187 3300005842 Ga0068858_100119044 Ga0068858_1001190443 153
188 3300005842 Ga0068858_100184195 Ga0068858_1001841952 153
189 3300005843 Ga0068860_100148694 Ga0068860_1001486943 153
190 3300005843 Ga0068860_100160498 Ga0068860_1001604983 153
191 3300005844 Ga0068862_100228084 Ga0068862_1002280842 153
192 3300006237 Ga0097621_100000046 Ga0097621_10000004639 153
193 3300006237 Ga0097621_100100251 Ga0097621_1001002514 153
194 3300006237 Ga0097621_100137680 Ga0097621_1001376802 153
195 3300006358 Ga0068871_100000004 Ga0068871_10000000451 153
196 3300006358 Ga0068871_100107860 Ga0068871_1001078603 153
197 3300006358 Ga0068871_100206565 Ga0068871_1002065653 153
198 3300006881 Ga0068865_100144897 Ga0068865_1001448972 153
199 3300009093 Ga0105240_10048584 Ga0105240_100485842 153
200 3300009093 Ga0105240_10149248 Ga0105240_101492483 153
201 3300009093 Ga0105240_10150964 Ga0105240_101509644 153
202 3300009093 Ga0105240_10630047 Ga0105240_106300472 153
203 3300009093 Ga0105240_11216543 Ga0105240_112165431 153
204 3300009098 Ga0105245_12220341 Ga0105245_122203412 153
205 3300009148 Ga0105243_10020514 Ga0105243_100205145 153
206 3300009148 Ga0105243_10214093 Ga0105243_102140932 153
207 3300009174 Ga0105241_10142715 Ga0105241_101427152 153
208 3300009174 Ga0105241_10208244 Ga0105241_102082442 153
209 3300009176 Ga0105242_10058031 Ga0105242_100580315 153
210 3300009176 Ga0105242_10210308 Ga0105242_102103082 153
211 3300009177 Ga0105248_10817835 Ga0105248_108178353 153
212 3300009545 Ga0105237_10259852 Ga0105237_102598524 153
213 3300009545 Ga0105237_10290074 Ga0105237_102900743 153
214 3300009551 Ga0105238_10035871 Ga0105238_100358713 153
215 3300009551 Ga0105238_10096473 Ga0105238_100964734 153
216 3300009551 Ga0105238_11446830 Ga0105238_114468302 153
217 3300010375 Ga0105239_10102347 Ga0105239_101023474 153
218 3300010375 Ga0105239_10570856 Ga0105239_105708563 153
219 3300010375 Ga0105239_10609911 Ga0105239_106099113 153
220 3300011119 Ga0105246_10037750 Ga0105246_100377506 153
221 3300011119 Ga0105246_10259724 Ga0105246_102597242 153
222 3300013104 Ga0157370_10009349 Ga0157370_1000934913 153
223 3300013104 Ga0157370_10044085 Ga0157370_100440856 153
224 3300013104 Ga0157370_10932095 Ga0157370_109320952 153
225 3300013105 Ga0157369_10220457 Ga0157369_102204573 153
226 3300013105 Ga0157369_11626296 Ga0157369_116262961 153
227 3300013297 Ga0157378_10012780 Ga0157378_100127806 153
228 3300013297 Ga0157378_10066447 Ga0157378_100664474 153
229 3300013306 Ga0163162_10003970 Ga0163162_100039705 153
230 3300013306 Ga0163162_10345994 Ga0163162_103459943 153
231 3300013306 Ga0163162_10481034 Ga0163162_104810341 153
232 3300013306 Ga0163162_10537192 Ga0163162_105371923 153
233 3300013307 Ga0157372_10024209 Ga0157372_100242096 153
234 3300013308 Ga0157375_10011357 Ga0157375_100113575 153
235 3300013308 Ga0157375_10229850 Ga0157375_102298504 153
236 3300013308 Ga0157375_11530822 Ga0157375_115308222 153
237 3300014325 Ga0163163_10000006 Ga0163163_10000006191 153
238 3300014325 Ga0163163_10014059 Ga0163163_100140596 153
239 3300014325 Ga0163163_10158809 Ga0163163_101588092 153
240 3300014325 Ga0163163_11980615 Ga0163163_119806151 153
241 3300014326 Ga0157380_10635882 Ga0157380_106358821 153
242 3300014968 Ga0157379_10000605 Ga0157379_100006057 153
243 3300014968 Ga0157379_10095234 Ga0157379_100952342 153
244 3300014968 Ga0157379_10263791 Ga0157379_102637911 153
245 3300014968 Ga0157379_11971209 Ga0157379_119712091 153
246 3300014969 Ga0157376_10145202 Ga0157376_101452022 153
247 3300025230 Ga0209563_118387 Ga0209563_1183872 153
248 3300025231 Ga0207427_116952 Ga0207427_1169521 153
249 3300025261 Ga0209233_1000013 Ga0209233_1000013510 153
250 3300025261 Ga0209233_1007476 Ga0209233_10074763 153
251 3300025297 Ga0209758_1000013 Ga0209758_100001336 153
252 3300025901 Ga0207688_10016755 Ga0207688_100167555 153
253 3300025903 Ga0207680_10015411 Ga0207680_100154115 153
254 3300025903 Ga0207680_10042591 Ga0207680_100425914 153
255 3300025907 Ga0207645_10027200 Ga0207645_100272004 153
256 3300025907 Ga0207645_10571400 Ga0207645_105714002 153
257 3300025908 Ga0207643_10092806 Ga0207643_100928063 153
258 3300025909 Ga0207705_10002737 Ga0207705_100027372 153
259 3300025909 Ga0207705_10180448 Ga0207705_101804482 153
260 3300025911 Ga0207654_10009595 Ga0207654_100095954 153
261 3300025911 Ga0207654_10135877 Ga0207654_101358773 153
262 3300025912 Ga0207707_10115820 Ga0207707_101158204 153
263 3300025912 Ga0207707_10154383 Ga0207707_101543833 153
264 3300025913 Ga0207695_10024152 Ga0207695_100241527 153
265 3300025913 Ga0207695_10068651 Ga0207695_100686513 153
266 3300025913 Ga0207695_10108011 Ga0207695_101080113 153
267 3300025913 Ga0207695_10246639 Ga0207695_102466393 153
268 3300025913 Ga0207695_11716862 Ga0207695_117168621 153
269 3300025914 Ga0207671_10111432 Ga0207671_101114323 153
270 3300025914 Ga0207671_10401681 Ga0207671_104016811 153
271 3300025917 Ga0207660_10068902 Ga0207660_100689025 153
272 3300025918 Ga0207662_10111557 Ga0207662_101115573 153
273 3300025919 Ga0207657_10008929 Ga0207657_100089296 153
274 3300025919 Ga0207657_10019317 Ga0207657_100193175 153
275 3300025920 Ga0207649_10065522 Ga0207649_100655224 153
276 3300025921 Ga0207652_10012053 Ga0207652_100120533 153
277 3300025921 Ga0207652_10305800 Ga0207652_103058003 153
278 3300025924 Ga0207694_10082000 Ga0207694_100820002 153
279 3300025924 Ga0207694_10212792 Ga0207694_102127922 153
280 3300025925 Ga0207650_10194592 Ga0207650_101945923 153
281 3300025926 Ga0207659_10027797 Ga0207659_100277974 153
282 3300025926 Ga0207659_10109267 Ga0207659_101092674 153
283 3300025928 Ga0207700_11121421 Ga0207700_111214211 153
284 3300025933 Ga0207706_11207530 Ga0207706_112075301 153
285 3300025934 Ga0207686_10171414 Ga0207686_101714143 153
286 3300025935 Ga0207709_11564659 Ga0207709_115646591 153
287 3300025937 Ga0207669_10611463 Ga0207669_106114632 153
288 3300025938 Ga0207704_10163412 Ga0207704_101634123 153
289 3300025942 Ga0207689_10022424 Ga0207689_100224246 153
290 3300025942 Ga0207689_10097246 Ga0207689_100972462 153
291 3300025942 Ga0207689_10110017 Ga0207689_101100175 153
292 3300025944 Ga0207661_10055010 Ga0207661_100550102 153
293 3300025945 Ga0207679_11412532 Ga0207679_114125321 153
294 3300025949 Ga0207667_10252112 Ga0207667_102521122 153
295 3300025949 Ga0207667_10316025 Ga0207667_103160253 153
296 3300025949 Ga0207667_10488473 Ga0207667_104884732 153
297 3300025960 Ga0207651_10482684 Ga0207651_104826842 153
298 3300025961 Ga0207712_11414782 Ga0207712_114147822 153
299 3300025972 Ga0207668_10356271 Ga0207668_103562712 153
300 3300025986 Ga0207658_10024071 Ga0207658_100240715 153
301 3300025986 Ga0207658_10066504 Ga0207658_100665044 153
302 3300026035 Ga0207703_10046062 Ga0207703_100460625 153
303 3300026035 Ga0207703_10125427 Ga0207703_101254273 153
304 3300026041 Ga0207639_10262667 Ga0207639_102626673 153
305 3300026041 Ga0207639_10596892 Ga0207639_105968922 153
306 3300026041 Ga0207639_10771992 Ga0207639_107719922 153
307 3300026067 Ga0207678_10278224 Ga0207678_102782242 153
308 3300026089 Ga0207648_10019524 Ga0207648_100195245 153
309 3300026089 Ga0207648_10022437 Ga0207648_100224378 153
310 3300026089 Ga0207648_11326896 Ga0207648_113268962 153
311 3300026095 Ga0207676_10055023 Ga0207676_100550234 153
312 3300026095 Ga0207676_10451851 Ga0207676_104518513 153
313 3300026116 Ga0207674_10079742 Ga0207674_100797421 153
314 3300026116 Ga0207674_11166031 Ga0207674_111660312 153
315 3300026118 Ga0207675_100112676 Ga0207675_1001126764 153
316 3300026121 Ga0207683_10008775 Ga0207683_100087758 153
317 3300026121 Ga0207683_10074021 Ga0207683_100740214 153
318 3300028379 Ga0268266_10000975 Ga0268266_1000097535 153
319 3300028379 Ga0268266_10014103 Ga0268266_100141038 153
320 3300028379 Ga0268266_10051777 Ga0268266_100517775 153
321 3300028379 Ga0268266_10142830 Ga0268266_101428302 153
322 3300028379 Ga0268266_10454964 Ga0268266_104549642 153
323 3300028381 Ga0268264_10054695 Ga0268264_100546953 153
324 3300028381 Ga0268264_10102962 Ga0268264_101029624 153
325 3300028577 Ga0265318_10000568 Ga0265318_1000056815 153
326 3300028800 Ga0265338_10004077 Ga0265338_100040777 153
327 3300028800 Ga0265338_10018601 Ga0265338_100186011 153
328 3300031235 Ga0265330_10020629 Ga0265330_100206293 153
329 3300031238 Ga0265332_10025546 Ga0265332_100255464 153
330 3300031238 Ga0265332_10054006 Ga0265332_100540063 153
331 3300031239 Ga0265328_10058343 Ga0265328_100583432 153
332 3300031247 Ga0265340_10004659 Ga0265340_100046595 153
333 3300031247 Ga0265340_10178172 Ga0265340_101781723 153
334 3300031249 Ga0265339_10065507 Ga0265339_100655071 153
335 3300031250 Ga0265331_10018706 Ga0265331_100187063 153
336 3300031344 Ga0265316_10037926 Ga0265316_100379264 153
337 3300031595 Ga0265313_10002805 Ga0265313_1000280514 153
338 3300031595 Ga0265313_10033893 Ga0265313_100338933 153
339 3300031711 Ga0265314_10005911 Ga0265314_100059115 153
340 3300031711 Ga0265314_10013083 Ga0265314_100130833 153
341 3300031712 Ga0265342_10040044 Ga0265342_100400444 153
342 3300031712 Ga0265342_10177334 Ga0265342_101773342 153
343 3300037312 Ga0395899_0392944 Ga0395899_0392944_402_872 153
344 3300037418 Ga0395900_0201363 Ga0395900_0201363_562_1032 153
345 3300037466 Ga0395898_0013029 Ga0395898_0013029_878_1348 153
346 3300038443 Ga0395901_0024715 Ga0395901_0024715_2625_3095 153
347 3300041441 Ga0451787_241163 Ga0451787_241163_358_819 153
348 3300044694 Ga0466963_1243346 Ga0466963_1243346_32_502 153
349 3300046459 Ga0495629_0848251 Ga0495629_0848251_100_561 153
350 3300046460 Ga0495638_0500588 Ga0495638_0500588_93_554 153
351 3300046515 Ga0495620_0384268 Ga0495620_0384268_42_503 153
352 3300046557 Ga0495622_0047541 Ga0495622_0047541_1340_1801 153
353 3300046648 Ga0495611_0256775 Ga0495611_0256775_44_523 153
354 3300046660 Ga0495625_0064346 Ga0495625_0064346_552_1013 153
355 3300046675 Ga0495657_0069724 Ga0495657_0069724_1223_1684 153
356 3300046678 Ga0495599_0713730 Ga0495599_0713730_70_531 153
357 3300047320 Ga0495672_0182577 Ga0495672_0182577_38_499 153
358 3300048924 Ga0496121_0003884 Ga0496121_0003884_13270_13731 153
359 3300049569 Ga0501032_0074448 Ga0501032_0074448_1376_1837 153
360 3300049571 Ga0501034_0199987 Ga0501034_0199987_923_1384 153
361 3300049571 Ga0501034_0377079 Ga0501034_0377079_38_511 153
362 3300049580 Ga0501046_0984062 Ga0501046_0984062_94_555 153
363 3300049581 Ga0501047_0019746 Ga0501047_0019746_3350_3811 153
364 3300049581 Ga0501047_0481125 Ga0501047_0481125_459_935 153
365 3300049585 Ga0501069_0672514 Ga0501069_0672514_62_535 153
366 3300049589 Ga0501073_0127358 Ga0501073_0127358_728_1198 153
367 3300049742 Ga0501080_1428746 Ga0501080_1428746_87_560 153
368 3300049744 Ga0501083_0031695 Ga0501083_0031695_2538_3011 153
369 3300049822 Ga0501035_0026973 Ga0501035_0026973_2661_3122 153
370 3300049823 Ga0501044_0988330 Ga0501044_0988330_104_580 153
371 3300053080 Ga0500635_0055027 Ga0500635_0055027_132_593 153
372 3300053087 Ga0500643_000021 Ga0500643_000021_172452_172913 153
373 3300053116 Ga0500592_054004 Ga0500592_054004_92_553 153
374 3300053118 Ga0500594_0073466 Ga0500594_0073466_275_736 153
375 3300053119 Ga0500595_001931 Ga0500595_001931_521_982 153
376 3300053119 Ga0500595_020812 Ga0500595_020812_808_1269 153
377 3300053136 Ga0500559_0136919 Ga0500559_0136919_510_971 153
378 3300053139 Ga0500568_0028081 Ga0500568_0028081_1116_1577 153
379 3300053140 Ga0500573_0000012 Ga0500573_0000012_81372_81836 153
380 3300054114 Ga0501084_1032804 Ga0501084_1032804_186_659 153
381 3300060353 Ga0501082_0013584 Ga0501082_0013584_4595_5068 153

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02391

MoaE

MoaE protein

9

123

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1nvi-assembly1.cif.gz_E-2 orthorhombic crystal form of molybdopterin synthase 0.9531 2 147
1nvj-assembly1.cif.gz_A deletion mutant (delta 141) of molybdopterin synthase 0.9469 2 124
4ap8-assembly1.cif.gz_A crystal structure of human molybdopterin synthase catalytic subunit (mocs2b) 0.9271 2 126
6jc0-assembly1.cif.gz_B structural analysis of molybdopterin synthases from two mycobacteria pathogens 0.9258 3 137
1nvj-assembly1.cif.gz_B deletion mutant (delta 141) of molybdopterin synthase 0.9218 2 124
ID Description Score Start End Superfamily
5mpoC00 Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Molybdopterin biosynthesis MoaE subunit 0.9432 2 126 3.90.1170.40
1fmaE00 Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Molybdopterin biosynthesis MoaE subunit 0.9412 2 147 3.90.1170.40
af_Q6AY59_40_191_3.90.1170.40 Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Molybdopterin biosynthesis MoaE subunit 0.9237 2 137 3.90.1170.40
af_P9WJR1_4_141_3.90.1170.40 Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Molybdopterin biosynthesis MoaE subunit 0.9232 2 135 3.90.1170.40
1nvjC00 Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Molybdopterin biosynthesis MoaE subunit 0.9211 2 124 3.90.1170.40
ID Description Score Start End GO Terms
AF-A0A1S6EVI5-F1-model_v4 Molybdopterin synthase catalytic subunit (EC 2.8.1.12) (MPT synthase subunit 2) (Molybdenum cofactor biosynthesis protein E) (Molybdopterin-converting factor large subunit) (Molybdopterin-converting factor subunit 2) 0.9746 2 147 GO:0006777
GO:0030366
AF-A0A0F3IWA1-F1-model_v4 Molybdopterin synthase catalytic subunit (EC 2.8.1.12) (MPT synthase subunit 2) (Molybdenum cofactor biosynthesis protein E) (Molybdopterin-converting factor large subunit) (Molybdopterin-converting factor subunit 2) 0.9732 2 147 GO:0006777
GO:0030366
AF-A0A7V7CTJ6-F1-model_v4 Molybdopterin synthase catalytic subunit (EC 2.8.1.12) (MPT synthase subunit 2) (Molybdenum cofactor biosynthesis protein E) (Molybdopterin-converting factor large subunit) (Molybdopterin-converting factor subunit 2) 0.9725 1 147 GO:0006777
AF-V4ND30-F1-model_v4 Molybdopterin synthase catalytic subunit (EC 2.8.1.12) (MPT synthase subunit 2) (Molybdenum cofactor biosynthesis protein E) (Molybdopterin-converting factor large subunit) (Molybdopterin-converting factor subunit 2) 0.9707 2 147 GO:0006777
GO:0030366
AF-Q9AC50-F1-model_v4 Molybdopterin synthase catalytic subunit (EC 2.8.1.12) (MPT synthase subunit 2) (Molybdenum cofactor biosynthesis protein E) (Molybdopterin-converting factor large subunit) (Molybdopterin-converting factor subunit 2) 0.9701 1 151 GO:0006777
GO:0030366

Feature Viewer

pLDDT pTM Quality
90.61 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map