F428960
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 381 | 192 | 359 | 440 |
Family's Representative Sequence
| Representative Sequence | 3300013104|Ga0157370_10065586|Ga0157370_100655862 |
| Length | 494 |
| Sequence | MTFKNLSEKLNKTARTLSVALPLIYLFCSVLFSADILSFVFQIIYQSTMAKQPVSSVSVGSLSKRDTLISILIIGLLFFIFGFVSWINAILIPYFKIACELSNFESYLVAFAFYISYFVMSVPSSFLLKSVGFKKGMMIGFWTMALGAFIFVPAALTRTYEVFLLGLFSLGAGLAILQTAANPYITVLGPKERAAQRISIMGICNKGAGILAPLLFAAVILKATDGELFKQLPLMNAAEKSAALDELIRRVIVPYACVGAVLVGLGLMVRYSPLPEIDTEHESEDVAAANSGKTSIFQFPHLILGAVAIFLHVGTQVIAIDTIIGYAGSMNIHLLEAKVFPSYTLFATICGYTIGILIIPKFISQVNVLRICTLLGTLFTLLIIFGHGPVRILGHTADISIWFVVLLGLANSLVWAGIWPLALDGLGRYTKLGASIMIMGLCGNAIMPLFYGYLADVYDLRTAYWVLFPCYLYLVFYAFKGYQIRNWSIQSINR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2522125168 | Dyadobacter beijingensis DSM 21582 | Isolate | Rhizosphere |
| 3 | 2738543023 | Pedobacter sp. OK628 | Isolate | Unclassified |
| 4 | 2852627209 | Pedobacter sp. AK017 | Isolate | Rhizosphere |
| 5 | 2883068021 | Chitinophaga rhizosphaerae T16R-86 | Isolate | Rhizosphere |
| 6 | 2890737413 | Parapedobacter sp. SGR-10 | Isolate | Rhizosphere |
| 7 | 2896109856 | Chitinophaga sp. SYP-B3965 | Isolate | Rhizosphere |
| 8 | 2896317667 | Sphingobacterium sp. SGR-19 | Isolate | Rhizosphere |
| 9 | 2898713307 | Sphingobacterium sp. SGG-5 | Isolate | Rhizosphere |
| 10 | 2904780799 | Sphingobacterium sp. 1304 | Isolate | Rhizosphere |
| 11 | 2910245624 | Adhaeribacter radiodurans KUDC8001 | Isolate | Rhizosphere |
| 12 | 2919177583 | Sphingobacterium sp. 2149 | Isolate | Rhizosphere |
| 13 | 2919186247 | Pedobacter africanus 2697 | Isolate | Rhizosphere |
| 14 | 2929154850 | Filimonas sp. R-72421 Hybrid assembly | Isolate | Unclassified |
| 15 | 2939664404 | Pedobacter africanus 2990 | Isolate | Rhizosphere |
| 16 | 2954016120 | Flavobacterium sp. W4I14 | Isolate | Rhizosphere |
| 17 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 18 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 19 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 20 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 21 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 22 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 23 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 24 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 25 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 26 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 27 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 31 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 35 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 37 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 44 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 48 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 51 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 54 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 56 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 57 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 58 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 59 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 60 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 61 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 62 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 63 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 64 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 65 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 66 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 68 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 69 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 96 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 98 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 99 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 100 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 101 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 143 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 144 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 145 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 146 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 147 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 148 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 149 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 150 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 151 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 152 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 153 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 154 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 155 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 156 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 157 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 167 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 168 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 169 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 170 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 172 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 173 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 174 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 175 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 176 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 177 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 178 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 179 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 180 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 181 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 182 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 183 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 184 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 185 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 186 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 188 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 189 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 190 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 191 | 8003151029 | Chitinophaga sp. GbtcB8 | Isolate | Unclassified |
| 192 | 8055588893 | Parapedobacter lycopersici KACC 18788 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.96 |
| Metatranscriptomes | 0 |
| Isolates | 6.04 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.67 |
| Nodule | 0 |
| Rhizoplane | 0.26 |
| Rhizosphere | 90.03 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.04 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_3553489 | 2162886007 | Unclassified | 2216 |
| 2 | SwRhRL2b_contig_3954609 | 2162886007 | Bacteria | 5402 |
| 3 | JGI24740J21852_10005610 | 3300001979 | Bacteria | 5287 |
| 4 | rootH2_10010675 | 3300003320 | Bacteria | 6648 |
| 5 | rootH2_10071087 | 3300003320 | Bacteria | 3414 |
| 6 | rootH2_10232113 | 3300003320 | Unclassified | 2489 |
| 7 | rootH2_10239942 | 3300003320 | Bacteria | 2739 |
| 8 | rootL2_10011352 | 3300003322 | Bacteria | 20815 |
| 9 | rootH1_10009463 | 3300003316 | Bacteria | 10028 |
| 10 | rootH1_10009463 | 3300003323 | Bacteria | 4564 |
| 11 | rootH1_10033229 | 3300003323 | Bacteria | 9790 |
| 12 | rootH1_10114630 | 3300003323 | Bacteria | 4584 |
| 13 | rootH1_10156747 | 3300003323 | Unclassified | 3952 |
| 14 | rootH1_10173184 | 3300003323 | Bacteria | 1603 |
| 15 | JGI25160J50197_1015433 | 3300003354 | Bacteria | 2506 |
| 16 | Ga0055536_1006427 | 3300003781 | Bacteria | 5493 |
| 17 | Ga0065165_1000508 | 3300005262 | Bacteria | 59970 |
| 18 | Ga0065165_1021945 | 3300005262 | Bacteria | 2203 |
| 19 | Ga0065714_10002827 | 3300005288 | Bacteria | 10778 |
| 20 | Ga0065714_10004629 | 3300005288 | Bacteria | 13722 |
| 21 | Ga0065714_10069832 | 3300005288 | Bacteria | 4070 |
| 22 | Ga0065704_10000302 | 3300005289 | Bacteria | 36124 |
| 23 | Ga0065704_10000568 | 3300005289 | Bacteria | 21884 |
| 24 | Ga0065704_10096067 | 3300005289 | Unclassified | 2459 |
| 25 | Ga0065704_10133755 | 3300005289 | Bacteria | 1596 |
| 26 | Ga0065707_10126003 | 3300005295 | Bacteria | 2012 |
| 27 | Ga0070676_10008223 | 3300005328 | Bacteria | 5616 |
| 28 | Ga0070683_100001349 | 3300005329 | Bacteria | 18733 |
| 29 | Ga0070670_100027584 | 3300005331 | Bacteria | 4885 |
| 30 | Ga0070670_100061813 | 3300005331 | Bacteria | 3215 |
| 31 | Ga0068869_100001560 | 3300005334 | Bacteria | 13605 |
| 32 | Ga0068869_100035753 | 3300005334 | Bacteria | 3523 |
| 33 | Ga0068869_100067117 | 3300005334 | Unclassified | 2645 |
| 34 | Ga0068869_100117185 | 3300005334 | Bacteria | 2033 |
| 35 | Ga0070666_10000261 | 3300005335 | Bacteria | 34842 |
| 36 | Ga0070666_10011160 | 3300005335 | Bacteria | 5629 |
| 37 | Ga0070680_100001551 | 3300005336 | Bacteria | 16772 |
| 38 | Ga0070680_100121678 | 3300005336 | Bacteria | 2179 |
| 39 | Ga0070682_100014510 | 3300005337 | Unclassified | 4555 |
| 40 | Ga0068868_100017222 | 3300005338 | Bacteria | 5378 |
| 41 | Ga0068868_100123948 | 3300005338 | Bacteria | 2109 |
| 42 | Ga0068868_100163105 | 3300005338 | Bacteria | 1842 |
| 43 | Ga0070660_100147287 | 3300005339 | Bacteria | 1892 |
| 44 | Ga0070689_100003807 | 3300005340 | Bacteria | 10108 |
| 45 | Ga0070689_100141918 | 3300005340 | Unclassified | 1932 |
| 46 | Ga0070691_10001052 | 3300005341 | Bacteria | 11384 |
| 47 | Ga0070661_100002750 | 3300005344 | Bacteria | 12061 |
| 48 | Ga0070661_100088217 | 3300005344 | Unclassified | 2295 |
| 49 | Ga0070668_100025418 | 3300005347 | Bacteria | 4489 |
| 50 | Ga0070668_100081473 | 3300005347 | Bacteria | 2538 |
| 51 | Ga0070669_100007018 | 3300005353 | Bacteria | 8097 |
| 52 | Ga0070675_100059221 | 3300005354 | Bacteria | 3159 |
| 53 | Ga0070673_100020262 | 3300005364 | Bacteria | 4794 |
| 54 | Ga0070673_100188514 | 3300005364 | Bacteria | 1770 |
| 55 | Ga0070688_100011013 | 3300005365 | Bacteria | 5012 |
| 56 | Ga0070659_100030542 | 3300005366 | Bacteria | 4170 |
| 57 | Ga0070662_100011878 | 3300005457 | Bacteria | 5759 |
| 58 | Ga0070662_100114756 | 3300005457 | Bacteria | 2057 |
| 59 | Ga0070662_100140176 | 3300005457 | Bacteria | 1873 |
| 60 | Ga0070681_10015848 | 3300005458 | Bacteria | 7514 |
| 61 | Ga0070681_10199711 | 3300005458 | Unclassified | 1918 |
| 62 | Ga0068867_100110506 | 3300005459 | Unclassified | 2112 |
| 63 | Ga0070679_100001501 | 3300005530 | Bacteria | 20739 |
| 64 | Ga0070684_100023281 | 3300005535 | Bacteria | 5177 |
| 65 | Ga0070684_100272812 | 3300005535 | Bacteria | 1549 |
| 66 | Ga0068853_100010297 | 3300005539 | Bacteria | 7564 |
| 67 | Ga0070672_100072912 | 3300005543 | Bacteria | 2735 |
| 68 | Ga0070665_100198546 | 3300005548 | Bacteria | 2007 |
| 69 | Ga0068855_100002878 | 3300005563 | Bacteria | 21113 |
| 70 | Ga0068855_100027957 | 3300005563 | Bacteria | 6746 |
| 71 | Ga0070664_100010434 | 3300005564 | Bacteria | 7532 |
| 72 | Ga0070664_100030938 | 3300005564 | Unclassified | 4468 |
| 73 | Ga0068857_100001667 | 3300005577 | Bacteria | 17833 |
| 74 | Ga0068857_100030391 | 3300005577 | Bacteria | 4770 |
| 75 | Ga0068856_100196850 | 3300005614 | Bacteria | 2029 |
| 76 | Ga0068852_100065584 | 3300005616 | Unclassified | 3169 |
| 77 | Ga0068852_100105323 | 3300005616 | Bacteria | 2555 |
| 78 | Ga0068852_100129986 | 3300005616 | Bacteria | 2318 |
| 79 | Ga0068852_100248370 | 3300005616 | Bacteria | 1704 |
| 80 | Ga0068859_100000007 | 3300005617 | Bacteria | 390070 |
| 81 | Ga0068859_100014275 | 3300005617 | Bacteria | 7965 |
| 82 | Ga0068859_100029725 | 3300005617 | Bacteria | 5482 |
| 83 | Ga0068859_100060992 | 3300005617 | Bacteria | 3800 |
| 84 | Ga0068859_100122857 | 3300005617 | Unclassified | 2663 |
| 85 | Ga0068859_100228218 | 3300005617 | Bacteria | 1950 |
| 86 | Ga0068864_100006097 | 3300005618 | Bacteria | 9887 |
| 87 | Ga0068864_100012492 | 3300005618 | Bacteria | 7022 |
| 88 | Ga0068864_100041101 | 3300005618 | Bacteria | 3955 |
| 89 | Ga0068861_100003633 | 3300005719 | Bacteria | 10277 |
| 90 | Ga0068861_100065948 | 3300005719 | Unclassified | 2790 |
| 91 | Ga0068870_10046210 | 3300005840 | Unclassified | 2282 |
| 92 | Ga0068870_10048954 | 3300005840 | Unclassified | 2227 |
| 93 | Ga0068863_100007108 | 3300005841 | Bacteria | 10977 |
| 94 | Ga0068858_100002167 | 3300005842 | Bacteria | 19923 |
| 95 | Ga0068860_100002777 | 3300005843 | Bacteria | 18200 |
| 96 | Ga0068860_100003904 | 3300005843 | Bacteria | 15325 |
| 97 | Ga0068860_100009959 | 3300005843 | Bacteria | 9419 |
| 98 | Ga0068860_100040712 | 3300005843 | Bacteria | 4440 |
| 99 | Ga0068862_100010120 | 3300005844 | Bacteria | 7785 |
| 100 | Ga0097621_100018430 | 3300006237 | Bacteria | 5332 |
| 101 | Ga0097621_100156224 | 3300006237 | Bacteria | 1958 |
| 102 | Ga0075428_100019894 | 3300006844 | Bacteria | 7432 |
| 103 | Ga0075428_100074304 | 3300006844 | Bacteria | 3713 |
| 104 | Ga0068865_100031506 | 3300006881 | Bacteria | 3536 |
| 105 | Ga0097620_100000007 | 3300006931 | Bacteria | 390070 |
| 106 | Ga0097620_100014276 | 3300006931 | Bacteria | 7965 |
| 107 | Ga0097620_100029729 | 3300006931 | Bacteria | 5482 |
| 108 | Ga0097620_100060985 | 3300006931 | Bacteria | 3800 |
| 109 | Ga0097620_100122856 | 3300006931 | Unclassified | 2663 |
| 110 | Ga0097620_100228199 | 3300006931 | Bacteria | 1950 |
| 111 | Ga0097620_100250603 | 3300006931 | Bacteria | 1861 |
| 112 | Ga0105240_10000033 | 3300009093 | Bacteria | 279600 |
| 113 | Ga0105240_10000058 | 3300009093 | Bacteria | 220830 |
| 114 | Ga0105240_10000935 | 3300009093 | Bacteria | 51880 |
| 115 | Ga0105240_10001962 | 3300009093 | Bacteria | 33999 |
| 116 | Ga0105240_10022870 | 3300009093 | Bacteria | 8282 |
| 117 | Ga0105240_10083325 | 3300009093 | Bacteria | 3924 |
| 118 | Ga0111539_10002184 | 3300009094 | Bacteria | 26126 |
| 119 | Ga0111539_10016216 | 3300009094 | Bacteria | 9242 |
| 120 | Ga0105247_10026734 | 3300009101 | Unclassified | 3487 |
| 121 | Ga0114129_10103712 | 3300009147 | Bacteria | 3931 |
| 122 | Ga0114129_10294679 | 3300009147 | Unclassified | 2164 |
| 123 | Ga0105241_10001508 | 3300009174 | Bacteria | 17850 |
| 124 | Ga0105241_10009356 | 3300009174 | Bacteria | 7201 |
| 125 | Ga0105241_10020495 | 3300009174 | Bacteria | 4885 |
| 126 | Ga0105241_10062367 | 3300009174 | Bacteria | 2874 |
| 127 | Ga0105242_10080983 | 3300009176 | Bacteria | 2714 |
| 128 | Ga0105242_10104745 | 3300009176 | Unclassified | 2402 |
| 129 | Ga0105248_10071385 | 3300009177 | Unclassified | 3901 |
| 130 | Ga0105237_10000028 | 3300009545 | Bacteria | 201366 |
| 131 | Ga0105237_10000126 | 3300009545 | Bacteria | 107192 |
| 132 | Ga0105237_10002144 | 3300009545 | Bacteria | 24857 |
| 133 | Ga0105237_10005985 | 3300009545 | Bacteria | 13624 |
| 134 | Ga0105237_10027005 | 3300009545 | Bacteria | 5863 |
| 135 | Ga0105249_10018828 | 3300009553 | Bacteria | 6154 |
| 136 | Ga0105249_10021470 | 3300009553 | Bacteria | 5780 |
| 137 | Ga0105249_10044297 | 3300009553 | Bacteria | 4046 |
| 138 | Ga0105249_10055300 | 3300009553 | Bacteria | 3630 |
| 139 | Ga0105249_10320954 | 3300009553 | Bacteria | 1560 |
| 140 | Ga0105239_10000253 | 3300010375 | Bacteria | 79942 |
| 141 | Ga0105239_10000771 | 3300010375 | Bacteria | 45346 |
| 142 | Ga0105239_10052213 | 3300010375 | Bacteria | 4482 |
| 143 | Ga0105239_10079690 | 3300010375 | Bacteria | 3604 |
| 144 | Ga0105246_10011245 | 3300011119 | Bacteria | 5551 |
| 145 | Ga0105246_10022431 | 3300011119 | Bacteria | 4073 |
| 146 | Ga0157373_10002442 | 3300013100 | Bacteria | 14146 |
| 147 | Ga0157373_10016884 | 3300013100 | Bacteria | 5323 |
| 148 | Ga0157373_10024807 | 3300013100 | Bacteria | 4340 |
| 149 | Ga0157373_10092951 | 3300013100 | Bacteria | 2124 |
| 150 | Ga0157371_10002304 | 3300013102 | Bacteria | 18370 |
| 151 | Ga0157371_10004906 | 3300013102 | Bacteria | 11494 |
| 152 | Ga0157371_10051300 | 3300013102 | Bacteria | 2931 |
| 153 | Ga0157370_10000493 | 3300013104 | Bacteria | 49035 |
| 154 | Ga0157370_10057887 | 3300013104 | Bacteria | 3683 |
| 155 | Ga0157370_10065586 | 3300013104 | Bacteria | 3435 |
| 156 | Ga0157370_10136916 | 3300013104 | Bacteria | 2282 |
| 157 | Ga0157370_10304532 | 3300013104 | Bacteria | 1471 |
| 158 | Ga0157369_10020279 | 3300013105 | Bacteria | 7430 |
| 159 | Ga0157369_10027127 | 3300013105 | Bacteria | 6351 |
| 160 | Ga0157369_10060430 | 3300013105 | Bacteria | 4087 |
| 161 | Ga0157369_10115359 | 3300013105 | Bacteria | 2852 |
| 162 | Ga0157374_10000003 | 3300013296 | Bacteria | 854471 |
| 163 | Ga0157374_10032086 | 3300013296 | Bacteria | 4780 |
| 164 | Ga0157374_10095771 | 3300013296 | Unclassified | 2839 |
| 165 | Ga0157374_10130898 | 3300013296 | Bacteria | 2428 |
| 166 | Ga0157378_10119498 | 3300013297 | Unclassified | 2427 |
| 167 | Ga0157378_10295493 | 3300013297 | Bacteria | 1566 |
| 168 | Ga0163162_10000135 | 3300013306 | Bacteria | 67187 |
| 169 | Ga0163162_10000437 | 3300013306 | Bacteria | 38437 |
| 170 | Ga0163162_10000561 | 3300013306 | Bacteria | 34341 |
| 171 | Ga0163162_10011356 | 3300013306 | Bacteria | 8683 |
| 172 | Ga0163162_10028557 | 3300013306 | Bacteria | 5520 |
| 173 | Ga0163162_10043510 | 3300013306 | Unclassified | 4497 |
| 174 | Ga0163162_10191285 | 3300013306 | Bacteria | 2174 |
| 175 | Ga0157372_10028809 | 3300013307 | Bacteria | 6060 |
| 176 | Ga0157372_10059675 | 3300013307 | Bacteria | 4267 |
| 177 | Ga0157372_10260970 | 3300013307 | Bacteria | 2012 |
| 178 | Ga0157375_10019816 | 3300013308 | Bacteria | 6130 |
| 179 | Ga0157375_10022513 | 3300013308 | Bacteria | 5800 |
| 180 | Ga0157375_10072819 | 3300013308 | Bacteria | 3453 |
| 181 | Ga0163163_10001371 | 3300014325 | Bacteria | 20552 |
| 182 | Ga0163163_10015365 | 3300014325 | Bacteria | 7076 |
| 183 | Ga0157380_10003195 | 3300014326 | Bacteria | 11186 |
| 184 | Ga0157380_10013616 | 3300014326 | Bacteria | 5936 |
| 185 | Ga0157377_10000788 | 3300014745 | Bacteria | 13103 |
| 186 | Ga0157379_10006986 | 3300014968 | Bacteria | 9760 |
| 187 | Ga0157379_10106114 | 3300014968 | Bacteria | 2521 |
| 188 | Ga0157379_10202781 | 3300014968 | Bacteria | 1794 |
| 189 | Ga0157379_10325990 | 3300014968 | Bacteria | 1403 |
| 190 | Ga0157379_10331146 | 3300014968 | Bacteria | 1391 |
| 191 | Ga0157376_10001332 | 3300014969 | Bacteria | 16298 |
| 192 | Ga0157376_10096151 | 3300014969 | Bacteria | 2577 |
| 193 | Ga0157376_10273530 | 3300014969 | Bacteria | 1588 |
| 194 | Ga0182006_1004081 | 3300015261 | Bacteria | 7275 |
| 195 | Ga0163161_10000129 | 3300017792 | Bacteria | 70623 |
| 196 | Ga0163161_10008017 | 3300017792 | Bacteria | 7305 |
| 197 | Ga0163161_10075733 | 3300017792 | Bacteria | 2470 |
| 198 | Ga0163161_10103929 | 3300017792 | Bacteria | 2117 |
| 199 | Ga0163161_10204154 | 3300017792 | Unclassified | 1524 |
| 200 | Ga0213876_10004555 | 3300021384 | Bacteria | 7738 |
| 201 | Ga0209676_1001400 | 3300025292 | Bacteria | 23333 |
| 202 | Ga0209050_1001063 | 3300025298 | Bacteria | 33728 |
| 203 | Ga0209050_1025763 | 3300025298 | Bacteria | 1989 |
| 204 | Ga0207426_1000002 | 3300025302 | Bacteria | 1249660 |
| 205 | Ga0207426_1000872 | 3300025302 | Bacteria | 31421 |
| 206 | Ga0207710_10026770 | 3300025900 | Unclassified | 2493 |
| 207 | Ga0207688_10022993 | 3300025901 | Unclassified | 3411 |
| 208 | Ga0207680_10000134 | 3300025903 | Bacteria | 34906 |
| 209 | Ga0207645_10016572 | 3300025907 | Unclassified | 4875 |
| 210 | Ga0207645_10024850 | 3300025907 | Unclassified | 3881 |
| 211 | Ga0207645_10098923 | 3300025907 | Unclassified | 1881 |
| 212 | Ga0207643_10009216 | 3300025908 | Bacteria | 5300 |
| 213 | Ga0207654_10002946 | 3300025911 | Bacteria | 8631 |
| 214 | Ga0207654_10009480 | 3300025911 | Bacteria | 4945 |
| 215 | Ga0207707_10000272 | 3300025912 | Bacteria | 55753 |
| 216 | Ga0207695_10000023 | 3300025913 | Bacteria | 657903 |
| 217 | Ga0207695_10000031 | 3300025913 | Bacteria | 526801 |
| 218 | Ga0207695_10005638 | 3300025913 | Bacteria | 16519 |
| 219 | Ga0207695_10010394 | 3300025913 | Bacteria | 11388 |
| 220 | Ga0207671_10000576 | 3300025914 | Bacteria | 49354 |
| 221 | Ga0207671_10002284 | 3300025914 | Bacteria | 20739 |
| 222 | Ga0207671_10002873 | 3300025914 | Bacteria | 17860 |
| 223 | Ga0207671_10006454 | 3300025914 | Bacteria | 10440 |
| 224 | Ga0207671_10158798 | 3300025914 | Unclassified | 1750 |
| 225 | Ga0207649_10009213 | 3300025920 | Bacteria | 5398 |
| 226 | Ga0207649_10063284 | 3300025920 | Unclassified | 2335 |
| 227 | Ga0207652_10000435 | 3300025921 | Bacteria | 43359 |
| 228 | Ga0207652_10088639 | 3300025921 | Bacteria | 2715 |
| 229 | Ga0207681_10005374 | 3300025923 | Bacteria | 7869 |
| 230 | Ga0207694_10018715 | 3300025924 | Bacteria | 5234 |
| 231 | Ga0207650_10050139 | 3300025925 | Unclassified | 3085 |
| 232 | Ga0207659_10018136 | 3300025926 | Bacteria | 4609 |
| 233 | Ga0207690_10133883 | 3300025932 | Bacteria | 1817 |
| 234 | Ga0207706_10009705 | 3300025933 | Bacteria | 8834 |
| 235 | Ga0207706_10009713 | 3300025933 | Bacteria | 8831 |
| 236 | Ga0207706_10064988 | 3300025933 | Bacteria | 3213 |
| 237 | Ga0207686_10128755 | 3300025934 | Bacteria | 1733 |
| 238 | Ga0207670_10050852 | 3300025936 | Bacteria | 2780 |
| 239 | Ga0207670_10132437 | 3300025936 | Bacteria | 1828 |
| 240 | Ga0207669_10074456 | 3300025937 | Unclassified | 2147 |
| 241 | Ga0207691_10039756 | 3300025940 | Bacteria | 4351 |
| 242 | Ga0207691_10080638 | 3300025940 | Unclassified | 2926 |
| 243 | Ga0207691_10127557 | 3300025940 | Bacteria | 2250 |
| 244 | Ga0207689_10001960 | 3300025942 | Bacteria | 19434 |
| 245 | Ga0207689_10003444 | 3300025942 | Bacteria | 14443 |
| 246 | Ga0207689_10019351 | 3300025942 | Bacteria | 5739 |
| 247 | Ga0207689_10021516 | 3300025942 | Bacteria | 5423 |
| 248 | Ga0207689_10092134 | 3300025942 | Unclassified | 2489 |
| 249 | Ga0207661_10001552 | 3300025944 | Bacteria | 15630 |
| 250 | Ga0207661_10014681 | 3300025944 | Bacteria | 5746 |
| 251 | Ga0207661_10053816 | 3300025944 | Bacteria | 3223 |
| 252 | Ga0207661_10094531 | 3300025944 | Bacteria | 2497 |
| 253 | Ga0207679_10000698 | 3300025945 | Bacteria | 22446 |
| 254 | Ga0207679_10003832 | 3300025945 | Bacteria | 9322 |
| 255 | Ga0207667_10018386 | 3300025949 | Bacteria | 7840 |
| 256 | Ga0207667_10035834 | 3300025949 | Bacteria | 5322 |
| 257 | Ga0207667_10044331 | 3300025949 | Unclassified | 4714 |
| 258 | Ga0207651_10054548 | 3300025960 | Unclassified | 2740 |
| 259 | Ga0207712_10023917 | 3300025961 | Bacteria | 4038 |
| 260 | Ga0207712_10051481 | 3300025961 | Bacteria | 2880 |
| 261 | Ga0207668_10204377 | 3300025972 | Bacteria | 1575 |
| 262 | Ga0207677_10035770 | 3300026023 | Bacteria | 3229 |
| 263 | Ga0207677_10036379 | 3300026023 | Bacteria | 3208 |
| 264 | Ga0207703_10002393 | 3300026035 | Bacteria | 16301 |
| 265 | Ga0207639_10002131 | 3300026041 | Bacteria | 13323 |
| 266 | Ga0207639_10002433 | 3300026041 | Bacteria | 12518 |
| 267 | Ga0207678_10195939 | 3300026067 | Bacteria | 1727 |
| 268 | Ga0207641_10000234 | 3300026088 | Bacteria | 71612 |
| 269 | Ga0207648_10139091 | 3300026089 | Unclassified | 2140 |
| 270 | Ga0207648_10260834 | 3300026089 | Bacteria | 1546 |
| 271 | Ga0207676_10018377 | 3300026095 | Bacteria | 5081 |
| 272 | Ga0207676_10026018 | 3300026095 | Unclassified | 4346 |
| 273 | Ga0207674_10004034 | 3300026116 | Bacteria | 17814 |
| 274 | Ga0207674_10022600 | 3300026116 | Bacteria | 6750 |
| 275 | Ga0207674_10038603 | 3300026116 | Bacteria | 4953 |
| 276 | Ga0207674_10068693 | 3300026116 | Bacteria | 3565 |
| 277 | Ga0207675_100005888 | 3300026118 | Bacteria | 11701 |
| 278 | Ga0207675_100199068 | 3300026118 | Bacteria | 1924 |
| 279 | Ga0207698_10004224 | 3300026142 | Bacteria | 8735 |
| 280 | Ga0207698_10019898 | 3300026142 | Bacteria | 4608 |
| 281 | Ga0268266_10000238 | 3300028379 | Bacteria | 93500 |
| 282 | Ga0268266_10074057 | 3300028379 | Unclassified | 2957 |
| 283 | Ga0268265_10008624 | 3300028380 | Bacteria | 6890 |
| 284 | Ga0268264_10000094 | 3300028381 | Bacteria | 231083 |
| 285 | Ga0268264_10003252 | 3300028381 | Bacteria | 14055 |
| 286 | Ga0268264_10006129 | 3300028381 | Bacteria | 10159 |
| 287 | Ga0268264_10006304 | 3300028381 | Bacteria | 10003 |
| 288 | Ga0268264_10008710 | 3300028381 | Bacteria | 8428 |
| 289 | Ga0268264_10015642 | 3300028381 | Bacteria | 6213 |
| 290 | Ga0268264_10161995 | 3300028381 | Bacteria | 2016 |
| 291 | Ga0307515_10000696 | 3300028794 | Bacteria | 77574 |
| 292 | Ga0307511_10000514 | 3300030521 | Bacteria | 41715 |
| 293 | Ga0307405_10039310 | 3300031731 | Bacteria | 2858 |
| 294 | Ga0307412_10000029 | 3300031911 | Bacteria | 209074 |
| 295 | Ga0307409_100124375 | 3300031995 | Bacteria | 2191 |
| 296 | Ga0307416_100017137 | 3300032002 | Bacteria | 5057 |
| 297 | Ga0307414_10000522 | 3300032004 | Bacteria | 19986 |
| 298 | Ga0307415_100106226 | 3300032126 | Bacteria | 2072 |
| 299 | Ga0307510_10004152 | 3300033180 | Bacteria | 17011 |
| 300 | Ga0436365_1584543 | 3300039437 | Bacteria | 38465 |
| 301 | Ga0439445_0002242 | 3300042004 | Bacteria | 4289 |
| 302 | Ga0451577_0000232 | 3300042876 | Bacteria | 111987 |
| 303 | Ga0451577_0001732 | 3300042876 | Bacteria | 28140 |
| 304 | Ga0451577_0007130 | 3300042876 | Bacteria | 11023 |
| 305 | Ga0451577_0019042 | 3300042876 | Bacteria | 6319 |
| 306 | Ga0451577_0071152 | 3300042876 | Bacteria | 3102 |
| 307 | Ga0451577_0292174 | 3300042876 | Bacteria | 1477 |
| 308 | Ga0453683_0000204 | 3300044673 | Bacteria | 80031 |
| 309 | Ga0453683_0001707 | 3300044673 | Bacteria | 18265 |
| 310 | Ga0453683_0087883 | 3300044673 | Bacteria | 1948 |
| 311 | Ga0453684_0000081 | 3300044712 | Bacteria | 402985 |
| 312 | Ga0453684_0001073 | 3300044712 | Bacteria | 87085 |
| 313 | Ga0453684_0002666 | 3300044712 | Bacteria | 42539 |
| 314 | Ga0453684_0004066 | 3300044712 | Bacteria | 31787 |
| 315 | Ga0453684_0049438 | 3300044712 | Bacteria | 5546 |
| 316 | Ga0451576_0000294 | 3300045051 | Bacteria | 122276 |
| 317 | Ga0451576_0000555 | 3300045051 | Bacteria | 80031 |
| 318 | Ga0451576_0000569 | 3300045051 | Bacteria | 78838 |
| 319 | Ga0451576_0002516 | 3300045051 | Bacteria | 27169 |
| 320 | Ga0451576_0031640 | 3300045051 | Bacteria | 5640 |
| 321 | Ga0451576_0196486 | 3300045051 | Bacteria | 2107 |
| 322 | Ga0451576_0278069 | 3300045051 | Unclassified | 1750 |
| 323 | Ga0495606_0031302 | 3300046507 | Unclassified | 3702 |
| 324 | Ga0495618_0039781 | 3300046514 | Bacteria | 2957 |
| 325 | Ga0495630_0018094 | 3300046517 | Bacteria | 5172 |
| 326 | Ga0495644_0040709 | 3300046523 | Bacteria | 1751 |
| 327 | Ga0495611_0000058 | 3300046648 | Bacteria | 79572 |
| 328 | Ga0495611_0029390 | 3300046648 | Bacteria | 2410 |
| 329 | Ga0495625_0079229 | 3300046660 | Unclassified | 2291 |
| 330 | Ga0495670_0047473 | 3300046691 | Bacteria | 2147 |
| 331 | Ga0495672_0008544 | 3300047320 | Bacteria | 7537 |
| 332 | Ga0495687_000072 | 3300047443 | Bacteria | 155519 |
| 333 | Ga0496110_0253107 | 3300048913 | Bacteria | 1603 |
| 334 | Ga0496116_0007199 | 3300048919 | Bacteria | 9937 |
| 335 | Ga0496117_0002011 | 3300048920 | Bacteria | 26938 |
| 336 | Ga0496122_0004843 | 3300048925 | Bacteria | 16397 |
| 337 | Ga0495678_017616 | 3300049459 | Bacteria | 3231 |
| 338 | Ga0501034_0042117 | 3300049571 | Bacteria | 4622 |
| 339 | Ga0501198_002849 | 3300049649 | Unclassified | 2348 |
| 340 | Ga0501202_010475 | 3300049652 | Unclassified | 1721 |
| 341 | Ga0501207_005574 | 3300049654 | Unclassified | 1746 |
| 342 | Ga0501224_001381 | 3300049664 | Unclassified | 3210 |
| 343 | Ga0501233_003758 | 3300049668 | Unclassified | 2747 |
| 344 | Ga0501235_013766 | 3300049669 | Bacteria | 1782 |
| 345 | Ga0501243_000246 | 3300049675 | Bacteria | 6840 |
| 346 | Ga0501257_015160 | 3300049686 | Bacteria | 1778 |
| 347 | Ga0501221_000233 | 3300049704 | Bacteria | 8017 |
| 348 | Ga0501245_000980 | 3300049708 | Bacteria | 3660 |
| 349 | nmdc:mga05p37_83658_c1 | 3300050507 | Bacteria | 3931 |
| 350 | nmdc:mga09592_31757_c1 | 3300050508 | Bacteria | 4401 |
| 351 | nmdc:mga06r32_106233_c1 | 3300050510 | Bacteria | 2758 |
| 352 | nmdc:mga06r32_11542_c1 | 3300050510 | Bacteria | 7959 |
| 353 | nmdc:mga08y16_125617_c1 | 3300050511 | Unclassified | 2669 |
| 354 | Ga0495595_0053122 | 3300053084 | Bacteria | 1882 |
| 355 | Ga0500583_0027243 | 3300053092 | Bacteria | 2465 |
| 356 | Ga0500651_0000302 | 3300053093 | Bacteria | 28484 |
| 357 | Ga0500616_0000015 | 3300053153 | Bacteria | 633259 |
| 358 | Ga0500616_0013780 | 3300053153 | Bacteria | 4675 |
| 359 | Ga0500622_0001280 | 3300053156 | Bacteria | 20467 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300014968 | Ga0157379_10325990 | Ga0157379_103259902 | 342 |
| 2 | 3300025921 | Ga0207652_10088639 | Ga0207652_100886392 | 352 |
| 3 | 3300003323 | rootH1_10114630 | rootH1_101146305 | 399 |
| 4 | 3300046523 | Ga0495644_0040709 | Ga0495644_0040709_263_1549 | 399 |
| 5 | 3300005288 | Ga0065714_10002827 | Ga0065714_100028275 | 401 |
| 6 | 3300013100 | Ga0157373_10024807 | Ga0157373_100248071 | 404 |
| 7 | 3300017792 | Ga0163161_10103929 | Ga0163161_101039292 | 404 |
| 8 | 3300046648 | Ga0495611_0000058 | Ga0495611_0000058_68813_70039 | 408 |
| 9 | 3300009093 | Ga0105240_10000058 | Ga0105240_1000005880 | 409 |
| 10 | 3300009545 | Ga0105237_10027005 | Ga0105237_100270052 | 409 |
| 11 | 3300025913 | Ga0207695_10000031 | Ga0207695_10000031132 | 409 |
| 12 | 3300025914 | Ga0207671_10158798 | Ga0207671_101587982 | 409 |
| 13 | 3300005616 | Ga0068852_100129986 | Ga0068852_1001299862 | 410 |
| 14 | 3300009545 | Ga0105237_10000028 | Ga0105237_1000002840 | 410 |
| 15 | 3300010375 | Ga0105239_10000253 | Ga0105239_1000025348 | 410 |
| 16 | 3300010375 | Ga0105239_10052213 | Ga0105239_100522133 | 410 |
| 17 | 3300025914 | Ga0207671_10002873 | Ga0207671_1000287313 | 410 |
| 18 | 3300025924 | Ga0207694_10018715 | Ga0207694_100187153 | 410 |
| 19 | 3300026041 | Ga0207639_10002433 | Ga0207639_100024332 | 410 |
| 20 | 3300033180 | Ga0307510_10004152 | Ga0307510_1000415212 | 411 |
| 21 | 3300046507 | Ga0495606_0031302 | Ga0495606_0031302_2004_3293 | 411 |
| 22 | 3300049686 | Ga0501257_015160 | Ga0501257_015160_108_1397 | 412 |
| 23 | 3300003320 | rootH2_10010675 | rootH2_100106757 | 413 |
| 24 | 3300001979 | JGI24740J21852_10005610 | JGI24740J21852_100056102 | 414 |
| 25 | 3300005336 | Ga0070680_100121678 | Ga0070680_1001216782 | 414 |
| 26 | 3300005338 | Ga0068868_100163105 | Ga0068868_1001631052 | 414 |
| 27 | 3300005339 | Ga0070660_100147287 | Ga0070660_1001472872 | 414 |
| 28 | 3300013102 | Ga0157371_10004906 | Ga0157371_100049063 | 416 |
| 29 | 3300013105 | Ga0157369_10020279 | Ga0157369_100202793 | 416 |
| 30 | iso_pu_bacteria | 2890737413 | 2890740813 | 416 |
| 31 | 3300005338 | Ga0068868_100017222 | Ga0068868_1000172223 | 418 |
| 32 | 3300005614 | Ga0068856_100196850 | Ga0068856_1001968502 | 418 |
| 33 | 3300005843 | Ga0068860_100040712 | Ga0068860_1000407122 | 418 |
| 34 | 3300009093 | Ga0105240_10000935 | Ga0105240_1000093529 | 418 |
| 35 | 3300009545 | Ga0105237_10000126 | Ga0105237_1000012637 | 418 |
| 36 | 3300009545 | Ga0105237_10002144 | Ga0105237_1000214412 | 418 |
| 37 | 3300010375 | Ga0105239_10000771 | Ga0105239_1000077118 | 418 |
| 38 | 3300025914 | Ga0207671_10000576 | Ga0207671_1000057626 | 418 |
| 39 | 3300025914 | Ga0207671_10006454 | Ga0207671_100064544 | 418 |
| 40 | 3300028381 | Ga0268264_10006304 | Ga0268264_100063045 | 418 |
| 41 | 3300053156 | Ga0500622_0001280 | Ga0500622_0001280_17788_19056 | 418 |
| 42 | iso_pu_bacteria | 2898713307 | 2898716394 | 418 |
| 43 | 3300003323 | rootH1_10009463 | rootH1_100094633 | 419 |
| 44 | 3300003323 | rootH1_10173184 | rootH1_101731841 | 419 |
| 45 | 3300009093 | Ga0105240_10000033 | Ga0105240_10000033143 | 419 |
| 46 | 3300013296 | Ga0157374_10000003 | Ga0157374_10000003562 | 419 |
| 47 | 3300013307 | Ga0157372_10059675 | Ga0157372_100596752 | 419 |
| 48 | 3300014969 | Ga0157376_10001332 | Ga0157376_100013327 | 419 |
| 49 | 3300025913 | Ga0207695_10000023 | Ga0207695_10000023448 | 419 |
| 50 | 3300053153 | Ga0500616_0013780 | Ga0500616_0013780_3175_4467 | 419 |
| 51 | 3300009553 | Ga0105249_10044297 | Ga0105249_100442972 | 420 |
| 52 | 3300013306 | Ga0163162_10000437 | Ga0163162_1000043721 | 420 |
| 53 | 3300003320 | rootH2_10239942 | rootH2_102399423 | 421 |
| 54 | 3300014969 | Ga0157376_10273530 | Ga0157376_102735301 | 421 |
| 55 | 3300025907 | Ga0207645_10024850 | Ga0207645_100248503 | 421 |
| 56 | 3300009093 | Ga0105240_10022870 | Ga0105240_100228704 | 423 |
| 57 | 3300009174 | Ga0105241_10020495 | Ga0105241_100204952 | 423 |
| 58 | 3300025913 | Ga0207695_10005638 | Ga0207695_100056389 | 423 |
| 59 | iso_pu_bacteria | 2738543023 | 2739300199 | 424 |
| 60 | iso_pu_bacteria | 2954016120 | 2954019380 | 424 |
| 61 | 3300031911 | Ga0307412_10000029 | Ga0307412_10000029112 | 427 |
| 62 | 3300005288 | Ga0065714_10069832 | Ga0065714_100698324 | 428 |
| 63 | 3300005289 | Ga0065704_10000302 | Ga0065704_1000030231 | 428 |
| 64 | 3300013102 | Ga0157371_10002304 | Ga0157371_100023047 | 428 |
| 65 | 3300017792 | Ga0163161_10000129 | Ga0163161_1000012945 | 428 |
| 66 | 3300032004 | Ga0307414_10000522 | Ga0307414_1000052212 | 428 |
| 67 | 3300048919 | Ga0496116_0007199 | Ga0496116_0007199_1843_3132 | 428 |
| 68 | 3300053093 | Ga0500651_0000302 | Ga0500651_0000302_24187_25473 | 428 |
| 69 | 3300013306 | Ga0163162_10000561 | Ga0163162_100005612 | 429 |
| 70 | 3300028381 | Ga0268264_10000094 | Ga0268264_1000009422 | 429 |
| 71 | 3300047443 | Ga0495687_000072 | Ga0495687_000072_16223_17512 | 429 |
| 72 | 3300049668 | Ga0501233_003758 | Ga0501233_003758_574_1869 | 429 |
| 73 | 3300005335 | Ga0070666_10011160 | Ga0070666_100111604 | 430 |
| 74 | 3300028379 | Ga0268266_10000238 | Ga0268266_1000023837 | 430 |
| 75 | 3300046648 | Ga0495611_0029390 | Ga0495611_0029390_720_2012 | 430 |
| 76 | 3300047320 | Ga0495672_0008544 | Ga0495672_0008544_1114_2409 | 430 |
| 77 | 3300053092 | Ga0500583_0027243 | Ga0500583_0027243_108_1400 | 430 |
| 78 | 3300003323 | rootH1_10033229 | rootH1_100332296 | 432 |
| 79 | 3300013306 | Ga0163162_10191285 | Ga0163162_101912852 | 432 |
| 80 | 3300003323 | rootH1_10156747 | rootH1_101567472 | 433 |
| 81 | 3300005458 | Ga0070681_10199711 | Ga0070681_101997112 | 433 |
| 82 | 3300005563 | Ga0068855_100002878 | Ga0068855_1000028782 | 433 |
| 83 | 3300009093 | Ga0105240_10083325 | Ga0105240_100833252 | 433 |
| 84 | 3300010375 | Ga0105239_10079690 | Ga0105239_100796902 | 433 |
| 85 | 3300013105 | Ga0157369_10060430 | Ga0157369_100604302 | 433 |
| 86 | 3300013307 | Ga0157372_10028809 | Ga0157372_100288092 | 433 |
| 87 | 3300025949 | Ga0207667_10018386 | Ga0207667_100183863 | 433 |
| 88 | 3300013307 | Ga0157372_10260970 | Ga0157372_102609702 | 434 |
| 89 | 3300042876 | Ga0451577_0000232 | Ga0451577_0000232_2807_4141 | 434 |
| 90 | 3300044712 | Ga0453684_0001073 | Ga0453684_0001073_82520_83854 | 434 |
| 91 | 3300045051 | Ga0451576_0000569 | Ga0451576_0000569_74674_76008 | 434 |
| 92 | iso_pu_bacteria | 2904780799 | 2904781456 | 434 |
| 93 | iso_pu_bacteria | 2919177583 | 2919177828 | 434 |
| 94 | 3300011119 | Ga0105246_10022431 | Ga0105246_100224314 | 435 |
| 95 | 3300013100 | Ga0157373_10002442 | Ga0157373_100024422 | 435 |
| 96 | 3300015261 | Ga0182006_1004081 | Ga0182006_10040813 | 435 |
| 97 | iso_pu_bacteria | 2896317667 | 2896318406 | 435 |
| 98 | iso_pu_bacteria | 8003151029 | 8003153215 | 435 |
| 99 | 2162886007 | SwRhRL2b_contig_3954609 | SwRhRL2b_0396.00006100 | 436 |
| 100 | 3300005289 | Ga0065704_10000568 | Ga0065704_1000056811 | 436 |
| 101 | 3300005328 | Ga0070676_10008223 | Ga0070676_100082233 | 436 |
| 102 | 3300005334 | Ga0068869_100035753 | Ga0068869_1000357533 | 436 |
| 103 | 3300005334 | Ga0068869_100067117 | Ga0068869_1000671172 | 436 |
| 104 | 3300005335 | Ga0070666_10000261 | Ga0070666_100002614 | 436 |
| 105 | 3300005347 | Ga0070668_100025418 | Ga0070668_1000254182 | 436 |
| 106 | 3300005364 | Ga0070673_100020262 | Ga0070673_1000202622 | 436 |
| 107 | 3300005457 | Ga0070662_100114756 | Ga0070662_1001147562 | 436 |
| 108 | 3300005616 | Ga0068852_100105323 | Ga0068852_1001053233 | 436 |
| 109 | 3300005617 | Ga0068859_100000007 | Ga0068859_100000007334 | 436 |
| 110 | 3300005617 | Ga0068859_100014275 | Ga0068859_1000142754 | 436 |
| 111 | 3300005617 | Ga0068859_100060992 | Ga0068859_1000609921 | 436 |
| 112 | 3300005618 | Ga0068864_100006097 | Ga0068864_1000060973 | 436 |
| 113 | 3300005719 | Ga0068861_100065948 | Ga0068861_1000659482 | 436 |
| 114 | 3300005841 | Ga0068863_100007108 | Ga0068863_1000071085 | 436 |
| 115 | 3300005842 | Ga0068858_100002167 | Ga0068858_1000021674 | 436 |
| 116 | 3300005843 | Ga0068860_100002777 | Ga0068860_1000027776 | 436 |
| 117 | 3300005843 | Ga0068860_100003904 | Ga0068860_1000039048 | 436 |
| 118 | 3300006237 | Ga0097621_100018430 | Ga0097621_1000184303 | 436 |
| 119 | 3300006881 | Ga0068865_100031506 | Ga0068865_1000315062 | 436 |
| 120 | 3300006931 | Ga0097620_100000007 | Ga0097620_100000007335 | 436 |
| 121 | 3300006931 | Ga0097620_100014276 | Ga0097620_1000142764 | 436 |
| 122 | 3300006931 | Ga0097620_100060985 | Ga0097620_1000609851 | 436 |
| 123 | 3300009101 | Ga0105247_10026734 | Ga0105247_100267341 | 436 |
| 124 | 3300009174 | Ga0105241_10009356 | Ga0105241_100093564 | 436 |
| 125 | 3300009176 | Ga0105242_10080983 | Ga0105242_100809833 | 436 |
| 126 | 3300009176 | Ga0105242_10104745 | Ga0105242_101047452 | 436 |
| 127 | 3300009545 | Ga0105237_10005985 | Ga0105237_100059853 | 436 |
| 128 | 3300009553 | Ga0105249_10021470 | Ga0105249_100214702 | 436 |
| 129 | 3300009553 | Ga0105249_10055300 | Ga0105249_100553002 | 436 |
| 130 | 3300011119 | Ga0105246_10011245 | Ga0105246_100112454 | 436 |
| 131 | 3300013296 | Ga0157374_10095771 | Ga0157374_100957713 | 436 |
| 132 | 3300013297 | Ga0157378_10119498 | Ga0157378_101194982 | 436 |
| 133 | 3300013306 | Ga0163162_10000135 | Ga0163162_1000013512 | 436 |
| 134 | 3300013306 | Ga0163162_10011356 | Ga0163162_100113563 | 436 |
| 135 | 3300013306 | Ga0163162_10028557 | Ga0163162_100285572 | 436 |
| 136 | 3300013308 | Ga0157375_10022513 | Ga0157375_100225133 | 436 |
| 137 | 3300014325 | Ga0163163_10015365 | Ga0163163_100153653 | 436 |
| 138 | 3300014968 | Ga0157379_10006986 | Ga0157379_100069866 | 436 |
| 139 | 3300014968 | Ga0157379_10331146 | Ga0157379_103311461 | 436 |
| 140 | 3300025900 | Ga0207710_10026770 | Ga0207710_100267701 | 436 |
| 141 | 3300025901 | Ga0207688_10022993 | Ga0207688_100229933 | 436 |
| 142 | 3300025903 | Ga0207680_10000134 | Ga0207680_1000013421 | 436 |
| 143 | 3300025911 | Ga0207654_10009480 | Ga0207654_100094804 | 436 |
| 144 | 3300025914 | Ga0207671_10002284 | Ga0207671_100022848 | 436 |
| 145 | 3300025934 | Ga0207686_10128755 | Ga0207686_101287551 | 436 |
| 146 | 3300025937 | Ga0207669_10074456 | Ga0207669_100744562 | 436 |
| 147 | 3300025942 | Ga0207689_10001960 | Ga0207689_100019603 | 436 |
| 148 | 3300025942 | Ga0207689_10003444 | Ga0207689_100034448 | 436 |
| 149 | 3300025942 | Ga0207689_10021516 | Ga0207689_100215162 | 436 |
| 150 | 3300025960 | Ga0207651_10054548 | Ga0207651_100545482 | 436 |
| 151 | 3300025961 | Ga0207712_10023917 | Ga0207712_100239172 | 436 |
| 152 | 3300026035 | Ga0207703_10002393 | Ga0207703_100023932 | 436 |
| 153 | 3300026088 | Ga0207641_10000234 | Ga0207641_1000023447 | 436 |
| 154 | 3300026095 | Ga0207676_10018377 | Ga0207676_100183773 | 436 |
| 155 | 3300026142 | Ga0207698_10004224 | Ga0207698_100042242 | 436 |
| 156 | 3300028381 | Ga0268264_10006129 | Ga0268264_100061294 | 436 |
| 157 | 3300028381 | Ga0268264_10008710 | Ga0268264_100087105 | 436 |
| 158 | 3300028381 | Ga0268264_10015642 | Ga0268264_100156423 | 436 |
| 159 | 3300042876 | Ga0451577_0071152 | Ga0451577_0071152_267_1610 | 436 |
| 160 | 3300042876 | Ga0451577_0292174 | Ga0451577_0292174_55_1407 | 436 |
| 161 | 3300044673 | Ga0453683_0000204 | Ga0453683_0000204_65631_66983 | 436 |
| 162 | 3300044673 | Ga0453683_0001707 | Ga0453683_0001707_10224_11567 | 436 |
| 163 | 3300045051 | Ga0451576_0000555 | Ga0451576_0000555_13049_14401 | 436 |
| 164 | 3300045051 | Ga0451576_0002516 | Ga0451576_0002516_8741_10093 | 436 |
| 165 | 3300045051 | Ga0451576_0278069 | Ga0451576_0278069_338_1681 | 436 |
| 166 | iso_pu_bacteria | 2522125168 | 2522549554 | 436 |
| 167 | iso_pu_bacteria | 8055588893 | 8055589872 | 436 |
| 168 | 3300013100 | Ga0157373_10092951 | Ga0157373_100929513 | 437 |
| 169 | iso_pu_bacteria | 2852627209 | 2852629264 | 437 |
| 170 | 3300003781 | Ga0055536_1006427 | Ga0055536_10064273 | 438 |
| 171 | 3300005262 | Ga0065165_1000508 | Ga0065165_100050840 | 438 |
| 172 | 3300005617 | Ga0068859_100228218 | Ga0068859_1002282181 | 438 |
| 173 | 3300005843 | Ga0068860_100009959 | Ga0068860_1000099596 | 438 |
| 174 | 3300005844 | Ga0068862_100010120 | Ga0068862_1000101203 | 438 |
| 175 | 3300006931 | Ga0097620_100228199 | Ga0097620_1002281991 | 438 |
| 176 | 3300013104 | Ga0157370_10304532 | Ga0157370_103045321 | 438 |
| 177 | 3300014326 | Ga0157380_10003195 | Ga0157380_100031952 | 438 |
| 178 | 3300021384 | Ga0213876_10004555 | Ga0213876_100045555 | 438 |
| 179 | 3300025292 | Ga0209676_1001400 | Ga0209676_100140014 | 438 |
| 180 | 3300025298 | Ga0209050_1025763 | Ga0209050_10257632 | 438 |
| 181 | 3300025942 | Ga0207689_10092134 | Ga0207689_100921341 | 438 |
| 182 | 3300028381 | Ga0268264_10003252 | Ga0268264_100032523 | 438 |
| 183 | 3300028794 | Ga0307515_10000696 | Ga0307515_100006965 | 438 |
| 184 | 3300031731 | Ga0307405_10039310 | Ga0307405_100393102 | 438 |
| 185 | 3300039437 | Ga0436365_1584543 | Ga0436365_1584543_18378_19700 | 438 |
| 186 | 3300046691 | Ga0495670_0047473 | Ga0495670_0047473_569_1888 | 438 |
| 187 | 3300048920 | Ga0496117_0002011 | Ga0496117_0002011_24446_25765 | 438 |
| 188 | 3300048925 | Ga0496122_0004843 | Ga0496122_0004843_9605_10924 | 438 |
| 189 | 3300050511 | nmdc:mga08y16_125617_c1 | nmdc:mga08y16_125617_c1_174_1496 | 438 |
| 190 | iso_pu_bacteria | 2910245624 | 2910246004 | 438 |
| 191 | 3300003320 | rootH2_10071087 | rootH2_100710872 | 439 |
| 192 | 3300003354 | JGI25160J50197_1015433 | JGI25160J50197_10154332 | 439 |
| 193 | 3300005262 | Ga0065165_1021945 | Ga0065165_10219451 | 439 |
| 194 | 3300005295 | Ga0065707_10126003 | Ga0065707_101260032 | 439 |
| 195 | 3300005364 | Ga0070673_100188514 | Ga0070673_1001885141 | 439 |
| 196 | 3300005535 | Ga0070684_100272812 | Ga0070684_1002728121 | 439 |
| 197 | 3300006844 | Ga0075428_100074304 | Ga0075428_1000743043 | 439 |
| 198 | 3300009147 | Ga0114129_10294679 | Ga0114129_102946792 | 439 |
| 199 | 3300013100 | Ga0157373_10016884 | Ga0157373_100168842 | 439 |
| 200 | 3300013102 | Ga0157371_10051300 | Ga0157371_100513003 | 439 |
| 201 | 3300013105 | Ga0157369_10115359 | Ga0157369_101153592 | 439 |
| 202 | 3300013296 | Ga0157374_10032086 | Ga0157374_100320863 | 439 |
| 203 | 3300025302 | Ga0207426_1000002 | Ga0207426_10000021048 | 439 |
| 204 | 3300025302 | Ga0207426_1000872 | Ga0207426_100087219 | 439 |
| 205 | 3300025932 | Ga0207690_10133883 | Ga0207690_101338832 | 439 |
| 206 | 3300025933 | Ga0207706_10009713 | Ga0207706_100097134 | 439 |
| 207 | 3300025944 | Ga0207661_10053816 | Ga0207661_100538162 | 439 |
| 208 | 3300025944 | Ga0207661_10094531 | Ga0207661_100945312 | 439 |
| 209 | 3300025949 | Ga0207667_10035834 | Ga0207667_100358344 | 439 |
| 210 | 3300026023 | Ga0207677_10036379 | Ga0207677_100363792 | 439 |
| 211 | 3300026116 | Ga0207674_10038603 | Ga0207674_100386035 | 439 |
| 212 | 3300026142 | Ga0207698_10019898 | Ga0207698_100198984 | 439 |
| 213 | 3300031995 | Ga0307409_100124375 | Ga0307409_1001243751 | 439 |
| 214 | 3300032002 | Ga0307416_100017137 | Ga0307416_1000171372 | 439 |
| 215 | 3300032126 | Ga0307415_100106226 | Ga0307415_1001062262 | 439 |
| 216 | 3300042876 | Ga0451577_0001732 | Ga0451577_0001732_8727_10052 | 439 |
| 217 | 3300044712 | Ga0453684_0002666 | Ga0453684_0002666_34003_35328 | 439 |
| 218 | 3300046660 | Ga0495625_0079229 | Ga0495625_0079229_475_1806 | 439 |
| 219 | 3300049459 | Ga0495678_017616 | Ga0495678_017616_541_1872 | 439 |
| 220 | 3300050510 | nmdc:mga06r32_106233_c1 | nmdc:mga06r32_106233_c1_437_1759 | 439 |
| 221 | iso_pu_bacteria | 2852627209 | 2852627443 | 439 |
| 222 | iso_pu_bacteria | 2910245624 | 2910246461 | 439 |
| 223 | iso_pu_bacteria | 2919186247 | 2919187432 | 439 |
| 224 | iso_pu_bacteria | 2939664404 | 2939665301 | 439 |
| 225 | 3300006931 | Ga0097620_100250603 | Ga0097620_1002506032 | 440 |
| 226 | 3300017792 | Ga0163161_10008017 | Ga0163161_100080176 | 440 |
| 227 | 3300026089 | Ga0207648_10260834 | Ga0207648_102608342 | 440 |
| 228 | 3300042876 | Ga0451577_0019042 | Ga0451577_0019042_4545_5876 | 440 |
| 229 | 3300044712 | Ga0453684_0004066 | Ga0453684_0004066_29324_30655 | 440 |
| 230 | 3300045051 | Ga0451576_0031640 | Ga0451576_0031640_3057_4388 | 440 |
| 231 | 3300013104 | Ga0157370_10136916 | Ga0157370_101369162 | 441 |
| 232 | 3300044673 | Ga0453683_0087883 | Ga0453683_0087883_597_1925 | 441 |
| 233 | 3300005288 | Ga0065714_10004629 | Ga0065714_100046297 | 442 |
| 234 | 3300005457 | Ga0070662_100011878 | Ga0070662_1000118785 | 442 |
| 235 | 3300013104 | Ga0157370_10057887 | Ga0157370_100578872 | 442 |
| 236 | 3300013297 | Ga0157378_10295493 | Ga0157378_102954931 | 442 |
| 237 | 3300025933 | Ga0207706_10009705 | Ga0207706_100097058 | 442 |
| 238 | 3300044712 | Ga0453684_0000081 | Ga0453684_0000081_299152_300489 | 442 |
| 239 | 3300045051 | Ga0451576_0000294 | Ga0451576_0000294_104493_105830 | 442 |
| 240 | 3300045051 | Ga0451576_0196486 | Ga0451576_0196486_370_1704 | 442 |
| 241 | 3300046514 | Ga0495618_0039781 | Ga0495618_0039781_1605_2939 | 442 |
| 242 | 3300046517 | Ga0495630_0018094 | Ga0495630_0018094_870_2204 | 442 |
| 243 | 3300053084 | Ga0495595_0053122 | Ga0495595_0053122_341_1675 | 442 |
| 244 | 3300009174 | Ga0105241_10062367 | Ga0105241_100623672 | 443 |
| 245 | 3300013105 | Ga0157369_10027127 | Ga0157369_100271274 | 443 |
| 246 | 3300005289 | Ga0065704_10133755 | Ga0065704_101337551 | 444 |
| 247 | 3300005618 | Ga0068864_100041101 | Ga0068864_1000411014 | 444 |
| 248 | 3300013104 | Ga0157370_10065586 | Ga0157370_100655862 | 444 |
| 249 | 3300013296 | Ga0157374_10130898 | Ga0157374_101308982 | 444 |
| 250 | 3300025940 | Ga0207691_10127557 | Ga0207691_101275572 | 444 |
| 251 | iso_pu_bacteria | 2738543023 | 2739300220 | 444 |
| 252 | iso_pu_bacteria | 2738543023 | 2739301376 | 444 |
| 253 | iso_pu_bacteria | 2919186247 | 2919190478 | 444 |
| 254 | iso_pu_bacteria | 2939664404 | 2939668759 | 444 |
| 255 | 3300005329 | Ga0070683_100001349 | Ga0070683_1000013491 | 445 |
| 256 | 3300005344 | Ga0070661_100002750 | Ga0070661_10000275014 | 445 |
| 257 | 3300005366 | Ga0070659_100030542 | Ga0070659_1000305421 | 445 |
| 258 | 3300005564 | Ga0070664_100010434 | Ga0070664_1000104347 | 445 |
| 259 | 3300005577 | Ga0068857_100001667 | Ga0068857_1000016671 | 445 |
| 260 | 3300014969 | Ga0157376_10096151 | Ga0157376_100961512 | 445 |
| 261 | 3300025920 | Ga0207649_10009213 | Ga0207649_100092135 | 445 |
| 262 | 3300025940 | Ga0207691_10080638 | Ga0207691_100806382 | 445 |
| 263 | 3300025944 | Ga0207661_10001552 | Ga0207661_100015521 | 445 |
| 264 | 3300025945 | Ga0207679_10000698 | Ga0207679_100006981 | 445 |
| 265 | 3300026041 | Ga0207639_10002131 | Ga0207639_100021311 | 445 |
| 266 | 3300026116 | Ga0207674_10004034 | Ga0207674_1000403417 | 445 |
| 267 | iso_pu_bacteria | 2896109856 | 2896114950 | 445 |
| 268 | iso_pu_bacteria | 2929154850 | 2929158272 | 446 |
| 269 | 3300005347 | Ga0070668_100081473 | Ga0070668_1000814732 | 447 |
| 270 | 3300005353 | Ga0070669_100007018 | Ga0070669_1000070182 | 447 |
| 271 | 3300005354 | Ga0070675_100059221 | Ga0070675_1000592213 | 447 |
| 272 | 3300005543 | Ga0070672_100072912 | Ga0070672_1000729122 | 447 |
| 273 | 3300005617 | Ga0068859_100029725 | Ga0068859_1000297252 | 447 |
| 274 | 3300005719 | Ga0068861_100003633 | Ga0068861_1000036338 | 447 |
| 275 | 3300005840 | Ga0068870_10046210 | Ga0068870_100462102 | 447 |
| 276 | 3300006931 | Ga0097620_100029729 | Ga0097620_1000297292 | 447 |
| 277 | 3300009094 | Ga0111539_10016216 | Ga0111539_100162162 | 447 |
| 278 | 3300009553 | Ga0105249_10018828 | Ga0105249_100188282 | 447 |
| 279 | 3300014326 | Ga0157380_10013616 | Ga0157380_100136161 | 447 |
| 280 | 3300014745 | Ga0157377_10000788 | Ga0157377_100007886 | 447 |
| 281 | 3300014968 | Ga0157379_10106114 | Ga0157379_101061142 | 447 |
| 282 | 3300025907 | Ga0207645_10098923 | Ga0207645_100989232 | 447 |
| 283 | 3300025908 | Ga0207643_10009216 | Ga0207643_100092164 | 447 |
| 284 | 3300025923 | Ga0207681_10005374 | Ga0207681_100053746 | 447 |
| 285 | 3300025926 | Ga0207659_10018136 | Ga0207659_100181361 | 447 |
| 286 | 3300025933 | Ga0207706_10064988 | Ga0207706_100649882 | 447 |
| 287 | 3300025936 | Ga0207670_10132437 | Ga0207670_101324371 | 447 |
| 288 | 3300025940 | Ga0207691_10039756 | Ga0207691_100397564 | 447 |
| 289 | 3300025961 | Ga0207712_10051481 | Ga0207712_100514812 | 447 |
| 290 | 3300025972 | Ga0207668_10204377 | Ga0207668_102043771 | 447 |
| 291 | 3300026118 | Ga0207675_100005888 | Ga0207675_1000058888 | 447 |
| 292 | 3300026118 | Ga0207675_100199068 | Ga0207675_1001990682 | 447 |
| 293 | 3300028380 | Ga0268265_10008624 | Ga0268265_100086245 | 447 |
| 294 | 3300042876 | Ga0451577_0007130 | Ga0451577_0007130_4951_6309 | 447 |
| 295 | 3300044712 | Ga0453684_0049438 | Ga0453684_0049438_38_1396 | 447 |
| 296 | 3300005334 | Ga0068869_100117185 | Ga0068869_1001171852 | 448 |
| 297 | 3300005336 | Ga0070680_100001551 | Ga0070680_1000015513 | 448 |
| 298 | 3300005337 | Ga0070682_100014510 | Ga0070682_1000145102 | 448 |
| 299 | 3300005340 | Ga0070689_100141918 | Ga0070689_1001419181 | 448 |
| 300 | 3300005341 | Ga0070691_10001052 | Ga0070691_100010526 | 448 |
| 301 | 3300005458 | Ga0070681_10015848 | Ga0070681_100158487 | 448 |
| 302 | 3300005459 | Ga0068867_100110506 | Ga0068867_1001105062 | 448 |
| 303 | 3300005530 | Ga0070679_100001501 | Ga0070679_1000015019 | 448 |
| 304 | 3300005539 | Ga0068853_100010297 | Ga0068853_1000102973 | 448 |
| 305 | 3300005563 | Ga0068855_100027957 | Ga0068855_1000279576 | 448 |
| 306 | 3300005616 | Ga0068852_100248370 | Ga0068852_1002483702 | 448 |
| 307 | 3300009093 | Ga0105240_10001962 | Ga0105240_100019627 | 448 |
| 308 | 3300009147 | Ga0114129_10103712 | Ga0114129_101037123 | 448 |
| 309 | 3300009174 | Ga0105241_10001508 | Ga0105241_100015089 | 448 |
| 310 | 3300013104 | Ga0157370_10000493 | Ga0157370_1000049331 | 448 |
| 311 | 3300013306 | Ga0163162_10043510 | Ga0163162_100435104 | 448 |
| 312 | 3300017792 | Ga0163161_10204154 | Ga0163161_102041542 | 448 |
| 313 | 3300025298 | Ga0209050_1001063 | Ga0209050_100106312 | 448 |
| 314 | 3300025907 | Ga0207645_10016572 | Ga0207645_100165723 | 448 |
| 315 | 3300025911 | Ga0207654_10002946 | Ga0207654_100029467 | 448 |
| 316 | 3300025912 | Ga0207707_10000272 | Ga0207707_1000027232 | 448 |
| 317 | 3300025913 | Ga0207695_10010394 | Ga0207695_100103947 | 448 |
| 318 | 3300025921 | Ga0207652_10000435 | Ga0207652_1000043524 | 448 |
| 319 | 3300025949 | Ga0207667_10044331 | Ga0207667_100443312 | 448 |
| 320 | 3300026089 | Ga0207648_10139091 | Ga0207648_101390912 | 448 |
| 321 | 3300050507 | nmdc:mga05p37_83658_c1 | nmdc:mga05p37_83658_c1_1192_2541 | 448 |
| 322 | 3300050508 | nmdc:mga09592_31757_c1 | nmdc:mga09592_31757_c1_455_1804 | 448 |
| 323 | 3300050510 | nmdc:mga06r32_11542_c1 | nmdc:mga06r32_11542_c1_555_1904 | 448 |
| 324 | 3300053153 | Ga0500616_0000015 | Ga0500616_0000015_66927_68282 | 448 |
| 325 | iso_pu_bacteria | 2883068021 | 2883068263 | 448 |
| 326 | 3300005331 | Ga0070670_100027584 | Ga0070670_1000275842 | 449 |
| 327 | 3300005334 | Ga0068869_100001560 | Ga0068869_1000015605 | 449 |
| 328 | 3300005338 | Ga0068868_100123948 | Ga0068868_1001239482 | 449 |
| 329 | 3300005340 | Ga0070689_100003807 | Ga0070689_1000038079 | 449 |
| 330 | 3300005344 | Ga0070661_100088217 | Ga0070661_1000882172 | 449 |
| 331 | 3300005365 | Ga0070688_100011013 | Ga0070688_1000110131 | 449 |
| 332 | 3300005457 | Ga0070662_100140176 | Ga0070662_1001401762 | 449 |
| 333 | 3300005535 | Ga0070684_100023281 | Ga0070684_1000232816 | 449 |
| 334 | 3300005548 | Ga0070665_100198546 | Ga0070665_1001985462 | 449 |
| 335 | 3300005564 | Ga0070664_100030938 | Ga0070664_1000309385 | 449 |
| 336 | 3300005577 | Ga0068857_100030391 | Ga0068857_1000303916 | 449 |
| 337 | 3300005617 | Ga0068859_100122857 | Ga0068859_1001228573 | 449 |
| 338 | 3300005618 | Ga0068864_100012492 | Ga0068864_1000124926 | 449 |
| 339 | 3300006844 | Ga0075428_100019894 | Ga0075428_1000198942 | 449 |
| 340 | 3300006931 | Ga0097620_100122856 | Ga0097620_1001228563 | 449 |
| 341 | 3300009094 | Ga0111539_10002184 | Ga0111539_100021847 | 449 |
| 342 | 3300013308 | Ga0157375_10019816 | Ga0157375_100198163 | 449 |
| 343 | 3300014325 | Ga0163163_10001371 | Ga0163163_100013715 | 449 |
| 344 | 3300025920 | Ga0207649_10063284 | Ga0207649_100632842 | 449 |
| 345 | 3300025925 | Ga0207650_10050139 | Ga0207650_100501392 | 449 |
| 346 | 3300025936 | Ga0207670_10050852 | Ga0207670_100508522 | 449 |
| 347 | 3300025942 | Ga0207689_10019351 | Ga0207689_100193516 | 449 |
| 348 | 3300025944 | Ga0207661_10014681 | Ga0207661_100146815 | 449 |
| 349 | 3300025945 | Ga0207679_10003832 | Ga0207679_1000383212 | 449 |
| 350 | 3300026023 | Ga0207677_10035770 | Ga0207677_100357703 | 449 |
| 351 | 3300026067 | Ga0207678_10195939 | Ga0207678_101959392 | 449 |
| 352 | 3300026095 | Ga0207676_10026018 | Ga0207676_100260183 | 449 |
| 353 | 3300026116 | Ga0207674_10022600 | Ga0207674_100226007 | 449 |
| 354 | 3300028379 | Ga0268266_10074057 | Ga0268266_100740572 | 449 |
| 355 | 3300048913 | Ga0496110_0253107 | Ga0496110_0253107_12_1367 | 449 |
| 356 | 3300049571 | Ga0501034_0042117 | Ga0501034_0042117_1549_2943 | 449 |
| 357 | 3300003320 | rootH2_10232113 | rootH2_102321132 | 450 |
| 358 | 3300003322 | rootL2_10011352 | rootL2_100113527 | 450 |
| 359 | 3300005331 | Ga0070670_100061813 | Ga0070670_1000618132 | 450 |
| 360 | 3300005840 | Ga0068870_10048954 | Ga0068870_100489542 | 450 |
| 361 | 3300026116 | Ga0207674_10068693 | Ga0207674_100686933 | 450 |
| 362 | 3300042004 | Ga0439445_0002242 | Ga0439445_0002242_2472_3869 | 450 |
| 363 | 3300049649 | Ga0501198_002849 | Ga0501198_002849_164_1522 | 450 |
| 364 | 3300049652 | Ga0501202_010475 | Ga0501202_010475_93_1451 | 450 |
| 365 | 3300049654 | Ga0501207_005574 | Ga0501207_005574_261_1619 | 450 |
| 366 | 3300049664 | Ga0501224_001381 | Ga0501224_001381_650_2008 | 450 |
| 367 | 3300049669 | Ga0501235_013766 | Ga0501235_013766_413_1771 | 450 |
| 368 | 3300049675 | Ga0501243_000246 | Ga0501243_000246_1381_2739 | 450 |
| 369 | 3300049704 | Ga0501221_000233 | Ga0501221_000233_637_1995 | 450 |
| 370 | 3300049708 | Ga0501245_000980 | Ga0501245_000980_593_1951 | 450 |
| 371 | 2162886007 | SwRhRL2b_contig_3553489 | SwRhRL2b_0377.00002780 | 451 |
| 372 | 3300005289 | Ga0065704_10096067 | Ga0065704_100960672 | 451 |
| 373 | 3300005616 | Ga0068852_100065584 | Ga0068852_1000655843 | 451 |
| 374 | 3300006237 | Ga0097621_100156224 | Ga0097621_1001562242 | 451 |
| 375 | 3300009177 | Ga0105248_10071385 | Ga0105248_100713854 | 451 |
| 376 | 3300009553 | Ga0105249_10320954 | Ga0105249_103209541 | 451 |
| 377 | 3300013308 | Ga0157375_10072819 | Ga0157375_100728193 | 451 |
| 378 | 3300014968 | Ga0157379_10202781 | Ga0157379_102027812 | 451 |
| 379 | 3300017792 | Ga0163161_10075733 | Ga0163161_100757332 | 451 |
| 380 | 3300028381 | Ga0268264_10161995 | Ga0268264_101619952 | 451 |
| 381 | 3300030521 | Ga0307511_10000514 | Ga0307511_100005148 | 451 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3o7p-assembly1.cif.gz_A | crystal structure of the e.coli fucose:proton symporter, fucp (n162a) | 0.8721 | 16 | 431 |
| 3o7q-assembly1.cif.gz_A | crystal structure of a major facilitator superfamily (mfs) transporter, fucp, in the outward conformation | 0.8652 | 16 | 431 |
| 3o7p-assembly1.cif.gz_A | crystal structure of the e.coli fucose:proton symporter, fucp (n162a) | 0.8621 | 16 | 431 |
| 3o7q-assembly1.cif.gz_A | crystal structure of a major facilitator superfamily (mfs) transporter, fucp, in the outward conformation | 0.8554 | 16 | 431 |
| 7ckr-assembly1.cif.gz_A | cryo-em structure of the human mct1/basigin-2 complex in the presence of anti-cancer drug candidate bay-8002 in the outward-open conformation. | 0.7947 | 23 | 431 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A1D6I3B4_2_197_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.8833 | 15 | 226 | 1.20.1250.20 |
| af_P11551_22_243_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.8668 | 16 | 233 | 1.20.1250.20 |
| af_A0A0R0HMJ0_13_161_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.8611 | 62 | 220 | 1.20.1250.20 |
| af_A0A1D6L8U4_23_213_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.8604 | 19 | 226 | 1.20.1250.20 |
| af_P21503_7_181_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.8536 | 21 | 224 | 1.20.1250.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A354GF75-F1-model_v4 | Glucose/galactose MFS transporter | 0.9251 | 10 | 200 |
GO:0005886
GO:0022857 |
| AF-I9YG61-F1-model_v4 | deleted | 0.9224 | 12 | 439 |
|
| AF-F0EYN3-F1-model_v4 | Glucose/galactose transporter WARNING | 0.9213 | 11 | 439 |
GO:0005354
GO:0005886 GO:0055056 GO:1904659 |
| AF-I9YG61-F1-model_v4 | deleted | 0.9202 | 12 | 439 |
|
| AF-A0A7V1TV56-F1-model_v4 | L-fucose:H+ symporter permease | 0.9168 | 1 | 432 |
GO:0005354
GO:0005886 GO:0015535 GO:0055056 GO:1904659 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar