F428960

General Info

Members Datasets Scaffolds Average Seq Length
381 192 359 440

Family's Representative Sequence

Representative Sequence 3300013104|Ga0157370_10065586|Ga0157370_100655862
Length 494
Sequence MTFKNLSEKLNKTARTLSVALPLIYLFCSVLFSADILSFVFQIIYQSTMAKQPVSSVSVGSLSKRDTLISILIIGLLFFIFGFVSWINAILIPYFKIACELSNFESYLVAFAFYISYFVMSVPSSFLLKSVGFKKGMMIGFWTMALGAFIFVPAALTRTYEVFLLGLFSLGAGLAILQTAANPYITVLGPKERAAQRISIMGICNKGAGILAPLLFAAVILKATDGELFKQLPLMNAAEKSAALDELIRRVIVPYACVGAVLVGLGLMVRYSPLPEIDTEHESEDVAAANSGKTSIFQFPHLILGAVAIFLHVGTQVIAIDTIIGYAGSMNIHLLEAKVFPSYTLFATICGYTIGILIIPKFISQVNVLRICTLLGTLFTLLIIFGHGPVRILGHTADISIWFVVLLGLANSLVWAGIWPLALDGLGRYTKLGASIMIMGLCGNAIMPLFYGYLADVYDLRTAYWVLFPCYLYLVFYAFKGYQIRNWSIQSINR

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2522125168 Dyadobacter beijingensis DSM 21582 Isolate Rhizosphere
3 2738543023 Pedobacter sp. OK628 Isolate Unclassified
4 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
5 2883068021 Chitinophaga rhizosphaerae T16R-86 Isolate Rhizosphere
6 2890737413 Parapedobacter sp. SGR-10 Isolate Rhizosphere
7 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
8 2896317667 Sphingobacterium sp. SGR-19 Isolate Rhizosphere
9 2898713307 Sphingobacterium sp. SGG-5 Isolate Rhizosphere
10 2904780799 Sphingobacterium sp. 1304 Isolate Rhizosphere
11 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere
12 2919177583 Sphingobacterium sp. 2149 Isolate Rhizosphere
13 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
14 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
15 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
16 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
17 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
18 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
19 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
20 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
21 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
22 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
23 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
24 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
25 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
26 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
27 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
28 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
29 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
30 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
31 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
32 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
33 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
34 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
35 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
36 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
37 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
38 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
39 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
40 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
41 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
42 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
43 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
44 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
45 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
46 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
47 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
48 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
49 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
50 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
51 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
73 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
81 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
82 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
83 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
84 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
85 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
86 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
91 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
92 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
93 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
94 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
95 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
96 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
97 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
98 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
101 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
143 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
144 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
145 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
146 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
147 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
148 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
149 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
150 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
151 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
152 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
153 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
154 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
155 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
156 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
157 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
158 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
159 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
160 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
161 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
162 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
163 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
164 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
165 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
166 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
167 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
168 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
169 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
170 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
171 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
173 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
174 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
175 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
176 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
177 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
178 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
179 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
180 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
181 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
182 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
183 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
184 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
185 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
186 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
187 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
188 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
189 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
190 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
191 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified
192 8055588893 Parapedobacter lycopersici KACC 18788 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.96
Metatranscriptomes 0
Isolates 6.04

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.67
Nodule 0
Rhizoplane 0.26
Rhizosphere 90.03
Stem 0
Stem Tuber 0
Unclassified 6.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_3553489 2162886007 Unclassified 2216
2 SwRhRL2b_contig_3954609 2162886007 Bacteria 5402
3 JGI24740J21852_10005610 3300001979 Bacteria 5287
4 rootH2_10010675 3300003320 Bacteria 6648
5 rootH2_10071087 3300003320 Bacteria 3414
6 rootH2_10232113 3300003320 Unclassified 2489
7 rootH2_10239942 3300003320 Bacteria 2739
8 rootL2_10011352 3300003322 Bacteria 20815
9 rootH1_10009463 3300003316 Bacteria 10028
10 rootH1_10009463 3300003323 Bacteria 4564
11 rootH1_10033229 3300003323 Bacteria 9790
12 rootH1_10114630 3300003323 Bacteria 4584
13 rootH1_10156747 3300003323 Unclassified 3952
14 rootH1_10173184 3300003323 Bacteria 1603
15 JGI25160J50197_1015433 3300003354 Bacteria 2506
16 Ga0055536_1006427 3300003781 Bacteria 5493
17 Ga0065165_1000508 3300005262 Bacteria 59970
18 Ga0065165_1021945 3300005262 Bacteria 2203
19 Ga0065714_10002827 3300005288 Bacteria 10778
20 Ga0065714_10004629 3300005288 Bacteria 13722
21 Ga0065714_10069832 3300005288 Bacteria 4070
22 Ga0065704_10000302 3300005289 Bacteria 36124
23 Ga0065704_10000568 3300005289 Bacteria 21884
24 Ga0065704_10096067 3300005289 Unclassified 2459
25 Ga0065704_10133755 3300005289 Bacteria 1596
26 Ga0065707_10126003 3300005295 Bacteria 2012
27 Ga0070676_10008223 3300005328 Bacteria 5616
28 Ga0070683_100001349 3300005329 Bacteria 18733
29 Ga0070670_100027584 3300005331 Bacteria 4885
30 Ga0070670_100061813 3300005331 Bacteria 3215
31 Ga0068869_100001560 3300005334 Bacteria 13605
32 Ga0068869_100035753 3300005334 Bacteria 3523
33 Ga0068869_100067117 3300005334 Unclassified 2645
34 Ga0068869_100117185 3300005334 Bacteria 2033
35 Ga0070666_10000261 3300005335 Bacteria 34842
36 Ga0070666_10011160 3300005335 Bacteria 5629
37 Ga0070680_100001551 3300005336 Bacteria 16772
38 Ga0070680_100121678 3300005336 Bacteria 2179
39 Ga0070682_100014510 3300005337 Unclassified 4555
40 Ga0068868_100017222 3300005338 Bacteria 5378
41 Ga0068868_100123948 3300005338 Bacteria 2109
42 Ga0068868_100163105 3300005338 Bacteria 1842
43 Ga0070660_100147287 3300005339 Bacteria 1892
44 Ga0070689_100003807 3300005340 Bacteria 10108
45 Ga0070689_100141918 3300005340 Unclassified 1932
46 Ga0070691_10001052 3300005341 Bacteria 11384
47 Ga0070661_100002750 3300005344 Bacteria 12061
48 Ga0070661_100088217 3300005344 Unclassified 2295
49 Ga0070668_100025418 3300005347 Bacteria 4489
50 Ga0070668_100081473 3300005347 Bacteria 2538
51 Ga0070669_100007018 3300005353 Bacteria 8097
52 Ga0070675_100059221 3300005354 Bacteria 3159
53 Ga0070673_100020262 3300005364 Bacteria 4794
54 Ga0070673_100188514 3300005364 Bacteria 1770
55 Ga0070688_100011013 3300005365 Bacteria 5012
56 Ga0070659_100030542 3300005366 Bacteria 4170
57 Ga0070662_100011878 3300005457 Bacteria 5759
58 Ga0070662_100114756 3300005457 Bacteria 2057
59 Ga0070662_100140176 3300005457 Bacteria 1873
60 Ga0070681_10015848 3300005458 Bacteria 7514
61 Ga0070681_10199711 3300005458 Unclassified 1918
62 Ga0068867_100110506 3300005459 Unclassified 2112
63 Ga0070679_100001501 3300005530 Bacteria 20739
64 Ga0070684_100023281 3300005535 Bacteria 5177
65 Ga0070684_100272812 3300005535 Bacteria 1549
66 Ga0068853_100010297 3300005539 Bacteria 7564
67 Ga0070672_100072912 3300005543 Bacteria 2735
68 Ga0070665_100198546 3300005548 Bacteria 2007
69 Ga0068855_100002878 3300005563 Bacteria 21113
70 Ga0068855_100027957 3300005563 Bacteria 6746
71 Ga0070664_100010434 3300005564 Bacteria 7532
72 Ga0070664_100030938 3300005564 Unclassified 4468
73 Ga0068857_100001667 3300005577 Bacteria 17833
74 Ga0068857_100030391 3300005577 Bacteria 4770
75 Ga0068856_100196850 3300005614 Bacteria 2029
76 Ga0068852_100065584 3300005616 Unclassified 3169
77 Ga0068852_100105323 3300005616 Bacteria 2555
78 Ga0068852_100129986 3300005616 Bacteria 2318
79 Ga0068852_100248370 3300005616 Bacteria 1704
80 Ga0068859_100000007 3300005617 Bacteria 390070
81 Ga0068859_100014275 3300005617 Bacteria 7965
82 Ga0068859_100029725 3300005617 Bacteria 5482
83 Ga0068859_100060992 3300005617 Bacteria 3800
84 Ga0068859_100122857 3300005617 Unclassified 2663
85 Ga0068859_100228218 3300005617 Bacteria 1950
86 Ga0068864_100006097 3300005618 Bacteria 9887
87 Ga0068864_100012492 3300005618 Bacteria 7022
88 Ga0068864_100041101 3300005618 Bacteria 3955
89 Ga0068861_100003633 3300005719 Bacteria 10277
90 Ga0068861_100065948 3300005719 Unclassified 2790
91 Ga0068870_10046210 3300005840 Unclassified 2282
92 Ga0068870_10048954 3300005840 Unclassified 2227
93 Ga0068863_100007108 3300005841 Bacteria 10977
94 Ga0068858_100002167 3300005842 Bacteria 19923
95 Ga0068860_100002777 3300005843 Bacteria 18200
96 Ga0068860_100003904 3300005843 Bacteria 15325
97 Ga0068860_100009959 3300005843 Bacteria 9419
98 Ga0068860_100040712 3300005843 Bacteria 4440
99 Ga0068862_100010120 3300005844 Bacteria 7785
100 Ga0097621_100018430 3300006237 Bacteria 5332
101 Ga0097621_100156224 3300006237 Bacteria 1958
102 Ga0075428_100019894 3300006844 Bacteria 7432
103 Ga0075428_100074304 3300006844 Bacteria 3713
104 Ga0068865_100031506 3300006881 Bacteria 3536
105 Ga0097620_100000007 3300006931 Bacteria 390070
106 Ga0097620_100014276 3300006931 Bacteria 7965
107 Ga0097620_100029729 3300006931 Bacteria 5482
108 Ga0097620_100060985 3300006931 Bacteria 3800
109 Ga0097620_100122856 3300006931 Unclassified 2663
110 Ga0097620_100228199 3300006931 Bacteria 1950
111 Ga0097620_100250603 3300006931 Bacteria 1861
112 Ga0105240_10000033 3300009093 Bacteria 279600
113 Ga0105240_10000058 3300009093 Bacteria 220830
114 Ga0105240_10000935 3300009093 Bacteria 51880
115 Ga0105240_10001962 3300009093 Bacteria 33999
116 Ga0105240_10022870 3300009093 Bacteria 8282
117 Ga0105240_10083325 3300009093 Bacteria 3924
118 Ga0111539_10002184 3300009094 Bacteria 26126
119 Ga0111539_10016216 3300009094 Bacteria 9242
120 Ga0105247_10026734 3300009101 Unclassified 3487
121 Ga0114129_10103712 3300009147 Bacteria 3931
122 Ga0114129_10294679 3300009147 Unclassified 2164
123 Ga0105241_10001508 3300009174 Bacteria 17850
124 Ga0105241_10009356 3300009174 Bacteria 7201
125 Ga0105241_10020495 3300009174 Bacteria 4885
126 Ga0105241_10062367 3300009174 Bacteria 2874
127 Ga0105242_10080983 3300009176 Bacteria 2714
128 Ga0105242_10104745 3300009176 Unclassified 2402
129 Ga0105248_10071385 3300009177 Unclassified 3901
130 Ga0105237_10000028 3300009545 Bacteria 201366
131 Ga0105237_10000126 3300009545 Bacteria 107192
132 Ga0105237_10002144 3300009545 Bacteria 24857
133 Ga0105237_10005985 3300009545 Bacteria 13624
134 Ga0105237_10027005 3300009545 Bacteria 5863
135 Ga0105249_10018828 3300009553 Bacteria 6154
136 Ga0105249_10021470 3300009553 Bacteria 5780
137 Ga0105249_10044297 3300009553 Bacteria 4046
138 Ga0105249_10055300 3300009553 Bacteria 3630
139 Ga0105249_10320954 3300009553 Bacteria 1560
140 Ga0105239_10000253 3300010375 Bacteria 79942
141 Ga0105239_10000771 3300010375 Bacteria 45346
142 Ga0105239_10052213 3300010375 Bacteria 4482
143 Ga0105239_10079690 3300010375 Bacteria 3604
144 Ga0105246_10011245 3300011119 Bacteria 5551
145 Ga0105246_10022431 3300011119 Bacteria 4073
146 Ga0157373_10002442 3300013100 Bacteria 14146
147 Ga0157373_10016884 3300013100 Bacteria 5323
148 Ga0157373_10024807 3300013100 Bacteria 4340
149 Ga0157373_10092951 3300013100 Bacteria 2124
150 Ga0157371_10002304 3300013102 Bacteria 18370
151 Ga0157371_10004906 3300013102 Bacteria 11494
152 Ga0157371_10051300 3300013102 Bacteria 2931
153 Ga0157370_10000493 3300013104 Bacteria 49035
154 Ga0157370_10057887 3300013104 Bacteria 3683
155 Ga0157370_10065586 3300013104 Bacteria 3435
156 Ga0157370_10136916 3300013104 Bacteria 2282
157 Ga0157370_10304532 3300013104 Bacteria 1471
158 Ga0157369_10020279 3300013105 Bacteria 7430
159 Ga0157369_10027127 3300013105 Bacteria 6351
160 Ga0157369_10060430 3300013105 Bacteria 4087
161 Ga0157369_10115359 3300013105 Bacteria 2852
162 Ga0157374_10000003 3300013296 Bacteria 854471
163 Ga0157374_10032086 3300013296 Bacteria 4780
164 Ga0157374_10095771 3300013296 Unclassified 2839
165 Ga0157374_10130898 3300013296 Bacteria 2428
166 Ga0157378_10119498 3300013297 Unclassified 2427
167 Ga0157378_10295493 3300013297 Bacteria 1566
168 Ga0163162_10000135 3300013306 Bacteria 67187
169 Ga0163162_10000437 3300013306 Bacteria 38437
170 Ga0163162_10000561 3300013306 Bacteria 34341
171 Ga0163162_10011356 3300013306 Bacteria 8683
172 Ga0163162_10028557 3300013306 Bacteria 5520
173 Ga0163162_10043510 3300013306 Unclassified 4497
174 Ga0163162_10191285 3300013306 Bacteria 2174
175 Ga0157372_10028809 3300013307 Bacteria 6060
176 Ga0157372_10059675 3300013307 Bacteria 4267
177 Ga0157372_10260970 3300013307 Bacteria 2012
178 Ga0157375_10019816 3300013308 Bacteria 6130
179 Ga0157375_10022513 3300013308 Bacteria 5800
180 Ga0157375_10072819 3300013308 Bacteria 3453
181 Ga0163163_10001371 3300014325 Bacteria 20552
182 Ga0163163_10015365 3300014325 Bacteria 7076
183 Ga0157380_10003195 3300014326 Bacteria 11186
184 Ga0157380_10013616 3300014326 Bacteria 5936
185 Ga0157377_10000788 3300014745 Bacteria 13103
186 Ga0157379_10006986 3300014968 Bacteria 9760
187 Ga0157379_10106114 3300014968 Bacteria 2521
188 Ga0157379_10202781 3300014968 Bacteria 1794
189 Ga0157379_10325990 3300014968 Bacteria 1403
190 Ga0157379_10331146 3300014968 Bacteria 1391
191 Ga0157376_10001332 3300014969 Bacteria 16298
192 Ga0157376_10096151 3300014969 Bacteria 2577
193 Ga0157376_10273530 3300014969 Bacteria 1588
194 Ga0182006_1004081 3300015261 Bacteria 7275
195 Ga0163161_10000129 3300017792 Bacteria 70623
196 Ga0163161_10008017 3300017792 Bacteria 7305
197 Ga0163161_10075733 3300017792 Bacteria 2470
198 Ga0163161_10103929 3300017792 Bacteria 2117
199 Ga0163161_10204154 3300017792 Unclassified 1524
200 Ga0213876_10004555 3300021384 Bacteria 7738
201 Ga0209676_1001400 3300025292 Bacteria 23333
202 Ga0209050_1001063 3300025298 Bacteria 33728
203 Ga0209050_1025763 3300025298 Bacteria 1989
204 Ga0207426_1000002 3300025302 Bacteria 1249660
205 Ga0207426_1000872 3300025302 Bacteria 31421
206 Ga0207710_10026770 3300025900 Unclassified 2493
207 Ga0207688_10022993 3300025901 Unclassified 3411
208 Ga0207680_10000134 3300025903 Bacteria 34906
209 Ga0207645_10016572 3300025907 Unclassified 4875
210 Ga0207645_10024850 3300025907 Unclassified 3881
211 Ga0207645_10098923 3300025907 Unclassified 1881
212 Ga0207643_10009216 3300025908 Bacteria 5300
213 Ga0207654_10002946 3300025911 Bacteria 8631
214 Ga0207654_10009480 3300025911 Bacteria 4945
215 Ga0207707_10000272 3300025912 Bacteria 55753
216 Ga0207695_10000023 3300025913 Bacteria 657903
217 Ga0207695_10000031 3300025913 Bacteria 526801
218 Ga0207695_10005638 3300025913 Bacteria 16519
219 Ga0207695_10010394 3300025913 Bacteria 11388
220 Ga0207671_10000576 3300025914 Bacteria 49354
221 Ga0207671_10002284 3300025914 Bacteria 20739
222 Ga0207671_10002873 3300025914 Bacteria 17860
223 Ga0207671_10006454 3300025914 Bacteria 10440
224 Ga0207671_10158798 3300025914 Unclassified 1750
225 Ga0207649_10009213 3300025920 Bacteria 5398
226 Ga0207649_10063284 3300025920 Unclassified 2335
227 Ga0207652_10000435 3300025921 Bacteria 43359
228 Ga0207652_10088639 3300025921 Bacteria 2715
229 Ga0207681_10005374 3300025923 Bacteria 7869
230 Ga0207694_10018715 3300025924 Bacteria 5234
231 Ga0207650_10050139 3300025925 Unclassified 3085
232 Ga0207659_10018136 3300025926 Bacteria 4609
233 Ga0207690_10133883 3300025932 Bacteria 1817
234 Ga0207706_10009705 3300025933 Bacteria 8834
235 Ga0207706_10009713 3300025933 Bacteria 8831
236 Ga0207706_10064988 3300025933 Bacteria 3213
237 Ga0207686_10128755 3300025934 Bacteria 1733
238 Ga0207670_10050852 3300025936 Bacteria 2780
239 Ga0207670_10132437 3300025936 Bacteria 1828
240 Ga0207669_10074456 3300025937 Unclassified 2147
241 Ga0207691_10039756 3300025940 Bacteria 4351
242 Ga0207691_10080638 3300025940 Unclassified 2926
243 Ga0207691_10127557 3300025940 Bacteria 2250
244 Ga0207689_10001960 3300025942 Bacteria 19434
245 Ga0207689_10003444 3300025942 Bacteria 14443
246 Ga0207689_10019351 3300025942 Bacteria 5739
247 Ga0207689_10021516 3300025942 Bacteria 5423
248 Ga0207689_10092134 3300025942 Unclassified 2489
249 Ga0207661_10001552 3300025944 Bacteria 15630
250 Ga0207661_10014681 3300025944 Bacteria 5746
251 Ga0207661_10053816 3300025944 Bacteria 3223
252 Ga0207661_10094531 3300025944 Bacteria 2497
253 Ga0207679_10000698 3300025945 Bacteria 22446
254 Ga0207679_10003832 3300025945 Bacteria 9322
255 Ga0207667_10018386 3300025949 Bacteria 7840
256 Ga0207667_10035834 3300025949 Bacteria 5322
257 Ga0207667_10044331 3300025949 Unclassified 4714
258 Ga0207651_10054548 3300025960 Unclassified 2740
259 Ga0207712_10023917 3300025961 Bacteria 4038
260 Ga0207712_10051481 3300025961 Bacteria 2880
261 Ga0207668_10204377 3300025972 Bacteria 1575
262 Ga0207677_10035770 3300026023 Bacteria 3229
263 Ga0207677_10036379 3300026023 Bacteria 3208
264 Ga0207703_10002393 3300026035 Bacteria 16301
265 Ga0207639_10002131 3300026041 Bacteria 13323
266 Ga0207639_10002433 3300026041 Bacteria 12518
267 Ga0207678_10195939 3300026067 Bacteria 1727
268 Ga0207641_10000234 3300026088 Bacteria 71612
269 Ga0207648_10139091 3300026089 Unclassified 2140
270 Ga0207648_10260834 3300026089 Bacteria 1546
271 Ga0207676_10018377 3300026095 Bacteria 5081
272 Ga0207676_10026018 3300026095 Unclassified 4346
273 Ga0207674_10004034 3300026116 Bacteria 17814
274 Ga0207674_10022600 3300026116 Bacteria 6750
275 Ga0207674_10038603 3300026116 Bacteria 4953
276 Ga0207674_10068693 3300026116 Bacteria 3565
277 Ga0207675_100005888 3300026118 Bacteria 11701
278 Ga0207675_100199068 3300026118 Bacteria 1924
279 Ga0207698_10004224 3300026142 Bacteria 8735
280 Ga0207698_10019898 3300026142 Bacteria 4608
281 Ga0268266_10000238 3300028379 Bacteria 93500
282 Ga0268266_10074057 3300028379 Unclassified 2957
283 Ga0268265_10008624 3300028380 Bacteria 6890
284 Ga0268264_10000094 3300028381 Bacteria 231083
285 Ga0268264_10003252 3300028381 Bacteria 14055
286 Ga0268264_10006129 3300028381 Bacteria 10159
287 Ga0268264_10006304 3300028381 Bacteria 10003
288 Ga0268264_10008710 3300028381 Bacteria 8428
289 Ga0268264_10015642 3300028381 Bacteria 6213
290 Ga0268264_10161995 3300028381 Bacteria 2016
291 Ga0307515_10000696 3300028794 Bacteria 77574
292 Ga0307511_10000514 3300030521 Bacteria 41715
293 Ga0307405_10039310 3300031731 Bacteria 2858
294 Ga0307412_10000029 3300031911 Bacteria 209074
295 Ga0307409_100124375 3300031995 Bacteria 2191
296 Ga0307416_100017137 3300032002 Bacteria 5057
297 Ga0307414_10000522 3300032004 Bacteria 19986
298 Ga0307415_100106226 3300032126 Bacteria 2072
299 Ga0307510_10004152 3300033180 Bacteria 17011
300 Ga0436365_1584543 3300039437 Bacteria 38465
301 Ga0439445_0002242 3300042004 Bacteria 4289
302 Ga0451577_0000232 3300042876 Bacteria 111987
303 Ga0451577_0001732 3300042876 Bacteria 28140
304 Ga0451577_0007130 3300042876 Bacteria 11023
305 Ga0451577_0019042 3300042876 Bacteria 6319
306 Ga0451577_0071152 3300042876 Bacteria 3102
307 Ga0451577_0292174 3300042876 Bacteria 1477
308 Ga0453683_0000204 3300044673 Bacteria 80031
309 Ga0453683_0001707 3300044673 Bacteria 18265
310 Ga0453683_0087883 3300044673 Bacteria 1948
311 Ga0453684_0000081 3300044712 Bacteria 402985
312 Ga0453684_0001073 3300044712 Bacteria 87085
313 Ga0453684_0002666 3300044712 Bacteria 42539
314 Ga0453684_0004066 3300044712 Bacteria 31787
315 Ga0453684_0049438 3300044712 Bacteria 5546
316 Ga0451576_0000294 3300045051 Bacteria 122276
317 Ga0451576_0000555 3300045051 Bacteria 80031
318 Ga0451576_0000569 3300045051 Bacteria 78838
319 Ga0451576_0002516 3300045051 Bacteria 27169
320 Ga0451576_0031640 3300045051 Bacteria 5640
321 Ga0451576_0196486 3300045051 Bacteria 2107
322 Ga0451576_0278069 3300045051 Unclassified 1750
323 Ga0495606_0031302 3300046507 Unclassified 3702
324 Ga0495618_0039781 3300046514 Bacteria 2957
325 Ga0495630_0018094 3300046517 Bacteria 5172
326 Ga0495644_0040709 3300046523 Bacteria 1751
327 Ga0495611_0000058 3300046648 Bacteria 79572
328 Ga0495611_0029390 3300046648 Bacteria 2410
329 Ga0495625_0079229 3300046660 Unclassified 2291
330 Ga0495670_0047473 3300046691 Bacteria 2147
331 Ga0495672_0008544 3300047320 Bacteria 7537
332 Ga0495687_000072 3300047443 Bacteria 155519
333 Ga0496110_0253107 3300048913 Bacteria 1603
334 Ga0496116_0007199 3300048919 Bacteria 9937
335 Ga0496117_0002011 3300048920 Bacteria 26938
336 Ga0496122_0004843 3300048925 Bacteria 16397
337 Ga0495678_017616 3300049459 Bacteria 3231
338 Ga0501034_0042117 3300049571 Bacteria 4622
339 Ga0501198_002849 3300049649 Unclassified 2348
340 Ga0501202_010475 3300049652 Unclassified 1721
341 Ga0501207_005574 3300049654 Unclassified 1746
342 Ga0501224_001381 3300049664 Unclassified 3210
343 Ga0501233_003758 3300049668 Unclassified 2747
344 Ga0501235_013766 3300049669 Bacteria 1782
345 Ga0501243_000246 3300049675 Bacteria 6840
346 Ga0501257_015160 3300049686 Bacteria 1778
347 Ga0501221_000233 3300049704 Bacteria 8017
348 Ga0501245_000980 3300049708 Bacteria 3660
349 nmdc:mga05p37_83658_c1 3300050507 Bacteria 3931
350 nmdc:mga09592_31757_c1 3300050508 Bacteria 4401
351 nmdc:mga06r32_106233_c1 3300050510 Bacteria 2758
352 nmdc:mga06r32_11542_c1 3300050510 Bacteria 7959
353 nmdc:mga08y16_125617_c1 3300050511 Unclassified 2669
354 Ga0495595_0053122 3300053084 Bacteria 1882
355 Ga0500583_0027243 3300053092 Bacteria 2465
356 Ga0500651_0000302 3300053093 Bacteria 28484
357 Ga0500616_0000015 3300053153 Bacteria 633259
358 Ga0500616_0013780 3300053153 Bacteria 4675
359 Ga0500622_0001280 3300053156 Bacteria 20467

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300014968 Ga0157379_10325990 Ga0157379_103259902 342
2 3300025921 Ga0207652_10088639 Ga0207652_100886392 352
3 3300003323 rootH1_10114630 rootH1_101146305 399
4 3300046523 Ga0495644_0040709 Ga0495644_0040709_263_1549 399
5 3300005288 Ga0065714_10002827 Ga0065714_100028275 401
6 3300013100 Ga0157373_10024807 Ga0157373_100248071 404
7 3300017792 Ga0163161_10103929 Ga0163161_101039292 404
8 3300046648 Ga0495611_0000058 Ga0495611_0000058_68813_70039 408
9 3300009093 Ga0105240_10000058 Ga0105240_1000005880 409
10 3300009545 Ga0105237_10027005 Ga0105237_100270052 409
11 3300025913 Ga0207695_10000031 Ga0207695_10000031132 409
12 3300025914 Ga0207671_10158798 Ga0207671_101587982 409
13 3300005616 Ga0068852_100129986 Ga0068852_1001299862 410
14 3300009545 Ga0105237_10000028 Ga0105237_1000002840 410
15 3300010375 Ga0105239_10000253 Ga0105239_1000025348 410
16 3300010375 Ga0105239_10052213 Ga0105239_100522133 410
17 3300025914 Ga0207671_10002873 Ga0207671_1000287313 410
18 3300025924 Ga0207694_10018715 Ga0207694_100187153 410
19 3300026041 Ga0207639_10002433 Ga0207639_100024332 410
20 3300033180 Ga0307510_10004152 Ga0307510_1000415212 411
21 3300046507 Ga0495606_0031302 Ga0495606_0031302_2004_3293 411
22 3300049686 Ga0501257_015160 Ga0501257_015160_108_1397 412
23 3300003320 rootH2_10010675 rootH2_100106757 413
24 3300001979 JGI24740J21852_10005610 JGI24740J21852_100056102 414
25 3300005336 Ga0070680_100121678 Ga0070680_1001216782 414
26 3300005338 Ga0068868_100163105 Ga0068868_1001631052 414
27 3300005339 Ga0070660_100147287 Ga0070660_1001472872 414
28 3300013102 Ga0157371_10004906 Ga0157371_100049063 416
29 3300013105 Ga0157369_10020279 Ga0157369_100202793 416
30 iso_pu_bacteria 2890737413 2890740813 416
31 3300005338 Ga0068868_100017222 Ga0068868_1000172223 418
32 3300005614 Ga0068856_100196850 Ga0068856_1001968502 418
33 3300005843 Ga0068860_100040712 Ga0068860_1000407122 418
34 3300009093 Ga0105240_10000935 Ga0105240_1000093529 418
35 3300009545 Ga0105237_10000126 Ga0105237_1000012637 418
36 3300009545 Ga0105237_10002144 Ga0105237_1000214412 418
37 3300010375 Ga0105239_10000771 Ga0105239_1000077118 418
38 3300025914 Ga0207671_10000576 Ga0207671_1000057626 418
39 3300025914 Ga0207671_10006454 Ga0207671_100064544 418
40 3300028381 Ga0268264_10006304 Ga0268264_100063045 418
41 3300053156 Ga0500622_0001280 Ga0500622_0001280_17788_19056 418
42 iso_pu_bacteria 2898713307 2898716394 418
43 3300003323 rootH1_10009463 rootH1_100094633 419
44 3300003323 rootH1_10173184 rootH1_101731841 419
45 3300009093 Ga0105240_10000033 Ga0105240_10000033143 419
46 3300013296 Ga0157374_10000003 Ga0157374_10000003562 419
47 3300013307 Ga0157372_10059675 Ga0157372_100596752 419
48 3300014969 Ga0157376_10001332 Ga0157376_100013327 419
49 3300025913 Ga0207695_10000023 Ga0207695_10000023448 419
50 3300053153 Ga0500616_0013780 Ga0500616_0013780_3175_4467 419
51 3300009553 Ga0105249_10044297 Ga0105249_100442972 420
52 3300013306 Ga0163162_10000437 Ga0163162_1000043721 420
53 3300003320 rootH2_10239942 rootH2_102399423 421
54 3300014969 Ga0157376_10273530 Ga0157376_102735301 421
55 3300025907 Ga0207645_10024850 Ga0207645_100248503 421
56 3300009093 Ga0105240_10022870 Ga0105240_100228704 423
57 3300009174 Ga0105241_10020495 Ga0105241_100204952 423
58 3300025913 Ga0207695_10005638 Ga0207695_100056389 423
59 iso_pu_bacteria 2738543023 2739300199 424
60 iso_pu_bacteria 2954016120 2954019380 424
61 3300031911 Ga0307412_10000029 Ga0307412_10000029112 427
62 3300005288 Ga0065714_10069832 Ga0065714_100698324 428
63 3300005289 Ga0065704_10000302 Ga0065704_1000030231 428
64 3300013102 Ga0157371_10002304 Ga0157371_100023047 428
65 3300017792 Ga0163161_10000129 Ga0163161_1000012945 428
66 3300032004 Ga0307414_10000522 Ga0307414_1000052212 428
67 3300048919 Ga0496116_0007199 Ga0496116_0007199_1843_3132 428
68 3300053093 Ga0500651_0000302 Ga0500651_0000302_24187_25473 428
69 3300013306 Ga0163162_10000561 Ga0163162_100005612 429
70 3300028381 Ga0268264_10000094 Ga0268264_1000009422 429
71 3300047443 Ga0495687_000072 Ga0495687_000072_16223_17512 429
72 3300049668 Ga0501233_003758 Ga0501233_003758_574_1869 429
73 3300005335 Ga0070666_10011160 Ga0070666_100111604 430
74 3300028379 Ga0268266_10000238 Ga0268266_1000023837 430
75 3300046648 Ga0495611_0029390 Ga0495611_0029390_720_2012 430
76 3300047320 Ga0495672_0008544 Ga0495672_0008544_1114_2409 430
77 3300053092 Ga0500583_0027243 Ga0500583_0027243_108_1400 430
78 3300003323 rootH1_10033229 rootH1_100332296 432
79 3300013306 Ga0163162_10191285 Ga0163162_101912852 432
80 3300003323 rootH1_10156747 rootH1_101567472 433
81 3300005458 Ga0070681_10199711 Ga0070681_101997112 433
82 3300005563 Ga0068855_100002878 Ga0068855_1000028782 433
83 3300009093 Ga0105240_10083325 Ga0105240_100833252 433
84 3300010375 Ga0105239_10079690 Ga0105239_100796902 433
85 3300013105 Ga0157369_10060430 Ga0157369_100604302 433
86 3300013307 Ga0157372_10028809 Ga0157372_100288092 433
87 3300025949 Ga0207667_10018386 Ga0207667_100183863 433
88 3300013307 Ga0157372_10260970 Ga0157372_102609702 434
89 3300042876 Ga0451577_0000232 Ga0451577_0000232_2807_4141 434
90 3300044712 Ga0453684_0001073 Ga0453684_0001073_82520_83854 434
91 3300045051 Ga0451576_0000569 Ga0451576_0000569_74674_76008 434
92 iso_pu_bacteria 2904780799 2904781456 434
93 iso_pu_bacteria 2919177583 2919177828 434
94 3300011119 Ga0105246_10022431 Ga0105246_100224314 435
95 3300013100 Ga0157373_10002442 Ga0157373_100024422 435
96 3300015261 Ga0182006_1004081 Ga0182006_10040813 435
97 iso_pu_bacteria 2896317667 2896318406 435
98 iso_pu_bacteria 8003151029 8003153215 435
99 2162886007 SwRhRL2b_contig_3954609 SwRhRL2b_0396.00006100 436
100 3300005289 Ga0065704_10000568 Ga0065704_1000056811 436
101 3300005328 Ga0070676_10008223 Ga0070676_100082233 436
102 3300005334 Ga0068869_100035753 Ga0068869_1000357533 436
103 3300005334 Ga0068869_100067117 Ga0068869_1000671172 436
104 3300005335 Ga0070666_10000261 Ga0070666_100002614 436
105 3300005347 Ga0070668_100025418 Ga0070668_1000254182 436
106 3300005364 Ga0070673_100020262 Ga0070673_1000202622 436
107 3300005457 Ga0070662_100114756 Ga0070662_1001147562 436
108 3300005616 Ga0068852_100105323 Ga0068852_1001053233 436
109 3300005617 Ga0068859_100000007 Ga0068859_100000007334 436
110 3300005617 Ga0068859_100014275 Ga0068859_1000142754 436
111 3300005617 Ga0068859_100060992 Ga0068859_1000609921 436
112 3300005618 Ga0068864_100006097 Ga0068864_1000060973 436
113 3300005719 Ga0068861_100065948 Ga0068861_1000659482 436
114 3300005841 Ga0068863_100007108 Ga0068863_1000071085 436
115 3300005842 Ga0068858_100002167 Ga0068858_1000021674 436
116 3300005843 Ga0068860_100002777 Ga0068860_1000027776 436
117 3300005843 Ga0068860_100003904 Ga0068860_1000039048 436
118 3300006237 Ga0097621_100018430 Ga0097621_1000184303 436
119 3300006881 Ga0068865_100031506 Ga0068865_1000315062 436
120 3300006931 Ga0097620_100000007 Ga0097620_100000007335 436
121 3300006931 Ga0097620_100014276 Ga0097620_1000142764 436
122 3300006931 Ga0097620_100060985 Ga0097620_1000609851 436
123 3300009101 Ga0105247_10026734 Ga0105247_100267341 436
124 3300009174 Ga0105241_10009356 Ga0105241_100093564 436
125 3300009176 Ga0105242_10080983 Ga0105242_100809833 436
126 3300009176 Ga0105242_10104745 Ga0105242_101047452 436
127 3300009545 Ga0105237_10005985 Ga0105237_100059853 436
128 3300009553 Ga0105249_10021470 Ga0105249_100214702 436
129 3300009553 Ga0105249_10055300 Ga0105249_100553002 436
130 3300011119 Ga0105246_10011245 Ga0105246_100112454 436
131 3300013296 Ga0157374_10095771 Ga0157374_100957713 436
132 3300013297 Ga0157378_10119498 Ga0157378_101194982 436
133 3300013306 Ga0163162_10000135 Ga0163162_1000013512 436
134 3300013306 Ga0163162_10011356 Ga0163162_100113563 436
135 3300013306 Ga0163162_10028557 Ga0163162_100285572 436
136 3300013308 Ga0157375_10022513 Ga0157375_100225133 436
137 3300014325 Ga0163163_10015365 Ga0163163_100153653 436
138 3300014968 Ga0157379_10006986 Ga0157379_100069866 436
139 3300014968 Ga0157379_10331146 Ga0157379_103311461 436
140 3300025900 Ga0207710_10026770 Ga0207710_100267701 436
141 3300025901 Ga0207688_10022993 Ga0207688_100229933 436
142 3300025903 Ga0207680_10000134 Ga0207680_1000013421 436
143 3300025911 Ga0207654_10009480 Ga0207654_100094804 436
144 3300025914 Ga0207671_10002284 Ga0207671_100022848 436
145 3300025934 Ga0207686_10128755 Ga0207686_101287551 436
146 3300025937 Ga0207669_10074456 Ga0207669_100744562 436
147 3300025942 Ga0207689_10001960 Ga0207689_100019603 436
148 3300025942 Ga0207689_10003444 Ga0207689_100034448 436
149 3300025942 Ga0207689_10021516 Ga0207689_100215162 436
150 3300025960 Ga0207651_10054548 Ga0207651_100545482 436
151 3300025961 Ga0207712_10023917 Ga0207712_100239172 436
152 3300026035 Ga0207703_10002393 Ga0207703_100023932 436
153 3300026088 Ga0207641_10000234 Ga0207641_1000023447 436
154 3300026095 Ga0207676_10018377 Ga0207676_100183773 436
155 3300026142 Ga0207698_10004224 Ga0207698_100042242 436
156 3300028381 Ga0268264_10006129 Ga0268264_100061294 436
157 3300028381 Ga0268264_10008710 Ga0268264_100087105 436
158 3300028381 Ga0268264_10015642 Ga0268264_100156423 436
159 3300042876 Ga0451577_0071152 Ga0451577_0071152_267_1610 436
160 3300042876 Ga0451577_0292174 Ga0451577_0292174_55_1407 436
161 3300044673 Ga0453683_0000204 Ga0453683_0000204_65631_66983 436
162 3300044673 Ga0453683_0001707 Ga0453683_0001707_10224_11567 436
163 3300045051 Ga0451576_0000555 Ga0451576_0000555_13049_14401 436
164 3300045051 Ga0451576_0002516 Ga0451576_0002516_8741_10093 436
165 3300045051 Ga0451576_0278069 Ga0451576_0278069_338_1681 436
166 iso_pu_bacteria 2522125168 2522549554 436
167 iso_pu_bacteria 8055588893 8055589872 436
168 3300013100 Ga0157373_10092951 Ga0157373_100929513 437
169 iso_pu_bacteria 2852627209 2852629264 437
170 3300003781 Ga0055536_1006427 Ga0055536_10064273 438
171 3300005262 Ga0065165_1000508 Ga0065165_100050840 438
172 3300005617 Ga0068859_100228218 Ga0068859_1002282181 438
173 3300005843 Ga0068860_100009959 Ga0068860_1000099596 438
174 3300005844 Ga0068862_100010120 Ga0068862_1000101203 438
175 3300006931 Ga0097620_100228199 Ga0097620_1002281991 438
176 3300013104 Ga0157370_10304532 Ga0157370_103045321 438
177 3300014326 Ga0157380_10003195 Ga0157380_100031952 438
178 3300021384 Ga0213876_10004555 Ga0213876_100045555 438
179 3300025292 Ga0209676_1001400 Ga0209676_100140014 438
180 3300025298 Ga0209050_1025763 Ga0209050_10257632 438
181 3300025942 Ga0207689_10092134 Ga0207689_100921341 438
182 3300028381 Ga0268264_10003252 Ga0268264_100032523 438
183 3300028794 Ga0307515_10000696 Ga0307515_100006965 438
184 3300031731 Ga0307405_10039310 Ga0307405_100393102 438
185 3300039437 Ga0436365_1584543 Ga0436365_1584543_18378_19700 438
186 3300046691 Ga0495670_0047473 Ga0495670_0047473_569_1888 438
187 3300048920 Ga0496117_0002011 Ga0496117_0002011_24446_25765 438
188 3300048925 Ga0496122_0004843 Ga0496122_0004843_9605_10924 438
189 3300050511 nmdc:mga08y16_125617_c1 nmdc:mga08y16_125617_c1_174_1496 438
190 iso_pu_bacteria 2910245624 2910246004 438
191 3300003320 rootH2_10071087 rootH2_100710872 439
192 3300003354 JGI25160J50197_1015433 JGI25160J50197_10154332 439
193 3300005262 Ga0065165_1021945 Ga0065165_10219451 439
194 3300005295 Ga0065707_10126003 Ga0065707_101260032 439
195 3300005364 Ga0070673_100188514 Ga0070673_1001885141 439
196 3300005535 Ga0070684_100272812 Ga0070684_1002728121 439
197 3300006844 Ga0075428_100074304 Ga0075428_1000743043 439
198 3300009147 Ga0114129_10294679 Ga0114129_102946792 439
199 3300013100 Ga0157373_10016884 Ga0157373_100168842 439
200 3300013102 Ga0157371_10051300 Ga0157371_100513003 439
201 3300013105 Ga0157369_10115359 Ga0157369_101153592 439
202 3300013296 Ga0157374_10032086 Ga0157374_100320863 439
203 3300025302 Ga0207426_1000002 Ga0207426_10000021048 439
204 3300025302 Ga0207426_1000872 Ga0207426_100087219 439
205 3300025932 Ga0207690_10133883 Ga0207690_101338832 439
206 3300025933 Ga0207706_10009713 Ga0207706_100097134 439
207 3300025944 Ga0207661_10053816 Ga0207661_100538162 439
208 3300025944 Ga0207661_10094531 Ga0207661_100945312 439
209 3300025949 Ga0207667_10035834 Ga0207667_100358344 439
210 3300026023 Ga0207677_10036379 Ga0207677_100363792 439
211 3300026116 Ga0207674_10038603 Ga0207674_100386035 439
212 3300026142 Ga0207698_10019898 Ga0207698_100198984 439
213 3300031995 Ga0307409_100124375 Ga0307409_1001243751 439
214 3300032002 Ga0307416_100017137 Ga0307416_1000171372 439
215 3300032126 Ga0307415_100106226 Ga0307415_1001062262 439
216 3300042876 Ga0451577_0001732 Ga0451577_0001732_8727_10052 439
217 3300044712 Ga0453684_0002666 Ga0453684_0002666_34003_35328 439
218 3300046660 Ga0495625_0079229 Ga0495625_0079229_475_1806 439
219 3300049459 Ga0495678_017616 Ga0495678_017616_541_1872 439
220 3300050510 nmdc:mga06r32_106233_c1 nmdc:mga06r32_106233_c1_437_1759 439
221 iso_pu_bacteria 2852627209 2852627443 439
222 iso_pu_bacteria 2910245624 2910246461 439
223 iso_pu_bacteria 2919186247 2919187432 439
224 iso_pu_bacteria 2939664404 2939665301 439
225 3300006931 Ga0097620_100250603 Ga0097620_1002506032 440
226 3300017792 Ga0163161_10008017 Ga0163161_100080176 440
227 3300026089 Ga0207648_10260834 Ga0207648_102608342 440
228 3300042876 Ga0451577_0019042 Ga0451577_0019042_4545_5876 440
229 3300044712 Ga0453684_0004066 Ga0453684_0004066_29324_30655 440
230 3300045051 Ga0451576_0031640 Ga0451576_0031640_3057_4388 440
231 3300013104 Ga0157370_10136916 Ga0157370_101369162 441
232 3300044673 Ga0453683_0087883 Ga0453683_0087883_597_1925 441
233 3300005288 Ga0065714_10004629 Ga0065714_100046297 442
234 3300005457 Ga0070662_100011878 Ga0070662_1000118785 442
235 3300013104 Ga0157370_10057887 Ga0157370_100578872 442
236 3300013297 Ga0157378_10295493 Ga0157378_102954931 442
237 3300025933 Ga0207706_10009705 Ga0207706_100097058 442
238 3300044712 Ga0453684_0000081 Ga0453684_0000081_299152_300489 442
239 3300045051 Ga0451576_0000294 Ga0451576_0000294_104493_105830 442
240 3300045051 Ga0451576_0196486 Ga0451576_0196486_370_1704 442
241 3300046514 Ga0495618_0039781 Ga0495618_0039781_1605_2939 442
242 3300046517 Ga0495630_0018094 Ga0495630_0018094_870_2204 442
243 3300053084 Ga0495595_0053122 Ga0495595_0053122_341_1675 442
244 3300009174 Ga0105241_10062367 Ga0105241_100623672 443
245 3300013105 Ga0157369_10027127 Ga0157369_100271274 443
246 3300005289 Ga0065704_10133755 Ga0065704_101337551 444
247 3300005618 Ga0068864_100041101 Ga0068864_1000411014 444
248 3300013104 Ga0157370_10065586 Ga0157370_100655862 444
249 3300013296 Ga0157374_10130898 Ga0157374_101308982 444
250 3300025940 Ga0207691_10127557 Ga0207691_101275572 444
251 iso_pu_bacteria 2738543023 2739300220 444
252 iso_pu_bacteria 2738543023 2739301376 444
253 iso_pu_bacteria 2919186247 2919190478 444
254 iso_pu_bacteria 2939664404 2939668759 444
255 3300005329 Ga0070683_100001349 Ga0070683_1000013491 445
256 3300005344 Ga0070661_100002750 Ga0070661_10000275014 445
257 3300005366 Ga0070659_100030542 Ga0070659_1000305421 445
258 3300005564 Ga0070664_100010434 Ga0070664_1000104347 445
259 3300005577 Ga0068857_100001667 Ga0068857_1000016671 445
260 3300014969 Ga0157376_10096151 Ga0157376_100961512 445
261 3300025920 Ga0207649_10009213 Ga0207649_100092135 445
262 3300025940 Ga0207691_10080638 Ga0207691_100806382 445
263 3300025944 Ga0207661_10001552 Ga0207661_100015521 445
264 3300025945 Ga0207679_10000698 Ga0207679_100006981 445
265 3300026041 Ga0207639_10002131 Ga0207639_100021311 445
266 3300026116 Ga0207674_10004034 Ga0207674_1000403417 445
267 iso_pu_bacteria 2896109856 2896114950 445
268 iso_pu_bacteria 2929154850 2929158272 446
269 3300005347 Ga0070668_100081473 Ga0070668_1000814732 447
270 3300005353 Ga0070669_100007018 Ga0070669_1000070182 447
271 3300005354 Ga0070675_100059221 Ga0070675_1000592213 447
272 3300005543 Ga0070672_100072912 Ga0070672_1000729122 447
273 3300005617 Ga0068859_100029725 Ga0068859_1000297252 447
274 3300005719 Ga0068861_100003633 Ga0068861_1000036338 447
275 3300005840 Ga0068870_10046210 Ga0068870_100462102 447
276 3300006931 Ga0097620_100029729 Ga0097620_1000297292 447
277 3300009094 Ga0111539_10016216 Ga0111539_100162162 447
278 3300009553 Ga0105249_10018828 Ga0105249_100188282 447
279 3300014326 Ga0157380_10013616 Ga0157380_100136161 447
280 3300014745 Ga0157377_10000788 Ga0157377_100007886 447
281 3300014968 Ga0157379_10106114 Ga0157379_101061142 447
282 3300025907 Ga0207645_10098923 Ga0207645_100989232 447
283 3300025908 Ga0207643_10009216 Ga0207643_100092164 447
284 3300025923 Ga0207681_10005374 Ga0207681_100053746 447
285 3300025926 Ga0207659_10018136 Ga0207659_100181361 447
286 3300025933 Ga0207706_10064988 Ga0207706_100649882 447
287 3300025936 Ga0207670_10132437 Ga0207670_101324371 447
288 3300025940 Ga0207691_10039756 Ga0207691_100397564 447
289 3300025961 Ga0207712_10051481 Ga0207712_100514812 447
290 3300025972 Ga0207668_10204377 Ga0207668_102043771 447
291 3300026118 Ga0207675_100005888 Ga0207675_1000058888 447
292 3300026118 Ga0207675_100199068 Ga0207675_1001990682 447
293 3300028380 Ga0268265_10008624 Ga0268265_100086245 447
294 3300042876 Ga0451577_0007130 Ga0451577_0007130_4951_6309 447
295 3300044712 Ga0453684_0049438 Ga0453684_0049438_38_1396 447
296 3300005334 Ga0068869_100117185 Ga0068869_1001171852 448
297 3300005336 Ga0070680_100001551 Ga0070680_1000015513 448
298 3300005337 Ga0070682_100014510 Ga0070682_1000145102 448
299 3300005340 Ga0070689_100141918 Ga0070689_1001419181 448
300 3300005341 Ga0070691_10001052 Ga0070691_100010526 448
301 3300005458 Ga0070681_10015848 Ga0070681_100158487 448
302 3300005459 Ga0068867_100110506 Ga0068867_1001105062 448
303 3300005530 Ga0070679_100001501 Ga0070679_1000015019 448
304 3300005539 Ga0068853_100010297 Ga0068853_1000102973 448
305 3300005563 Ga0068855_100027957 Ga0068855_1000279576 448
306 3300005616 Ga0068852_100248370 Ga0068852_1002483702 448
307 3300009093 Ga0105240_10001962 Ga0105240_100019627 448
308 3300009147 Ga0114129_10103712 Ga0114129_101037123 448
309 3300009174 Ga0105241_10001508 Ga0105241_100015089 448
310 3300013104 Ga0157370_10000493 Ga0157370_1000049331 448
311 3300013306 Ga0163162_10043510 Ga0163162_100435104 448
312 3300017792 Ga0163161_10204154 Ga0163161_102041542 448
313 3300025298 Ga0209050_1001063 Ga0209050_100106312 448
314 3300025907 Ga0207645_10016572 Ga0207645_100165723 448
315 3300025911 Ga0207654_10002946 Ga0207654_100029467 448
316 3300025912 Ga0207707_10000272 Ga0207707_1000027232 448
317 3300025913 Ga0207695_10010394 Ga0207695_100103947 448
318 3300025921 Ga0207652_10000435 Ga0207652_1000043524 448
319 3300025949 Ga0207667_10044331 Ga0207667_100443312 448
320 3300026089 Ga0207648_10139091 Ga0207648_101390912 448
321 3300050507 nmdc:mga05p37_83658_c1 nmdc:mga05p37_83658_c1_1192_2541 448
322 3300050508 nmdc:mga09592_31757_c1 nmdc:mga09592_31757_c1_455_1804 448
323 3300050510 nmdc:mga06r32_11542_c1 nmdc:mga06r32_11542_c1_555_1904 448
324 3300053153 Ga0500616_0000015 Ga0500616_0000015_66927_68282 448
325 iso_pu_bacteria 2883068021 2883068263 448
326 3300005331 Ga0070670_100027584 Ga0070670_1000275842 449
327 3300005334 Ga0068869_100001560 Ga0068869_1000015605 449
328 3300005338 Ga0068868_100123948 Ga0068868_1001239482 449
329 3300005340 Ga0070689_100003807 Ga0070689_1000038079 449
330 3300005344 Ga0070661_100088217 Ga0070661_1000882172 449
331 3300005365 Ga0070688_100011013 Ga0070688_1000110131 449
332 3300005457 Ga0070662_100140176 Ga0070662_1001401762 449
333 3300005535 Ga0070684_100023281 Ga0070684_1000232816 449
334 3300005548 Ga0070665_100198546 Ga0070665_1001985462 449
335 3300005564 Ga0070664_100030938 Ga0070664_1000309385 449
336 3300005577 Ga0068857_100030391 Ga0068857_1000303916 449
337 3300005617 Ga0068859_100122857 Ga0068859_1001228573 449
338 3300005618 Ga0068864_100012492 Ga0068864_1000124926 449
339 3300006844 Ga0075428_100019894 Ga0075428_1000198942 449
340 3300006931 Ga0097620_100122856 Ga0097620_1001228563 449
341 3300009094 Ga0111539_10002184 Ga0111539_100021847 449
342 3300013308 Ga0157375_10019816 Ga0157375_100198163 449
343 3300014325 Ga0163163_10001371 Ga0163163_100013715 449
344 3300025920 Ga0207649_10063284 Ga0207649_100632842 449
345 3300025925 Ga0207650_10050139 Ga0207650_100501392 449
346 3300025936 Ga0207670_10050852 Ga0207670_100508522 449
347 3300025942 Ga0207689_10019351 Ga0207689_100193516 449
348 3300025944 Ga0207661_10014681 Ga0207661_100146815 449
349 3300025945 Ga0207679_10003832 Ga0207679_1000383212 449
350 3300026023 Ga0207677_10035770 Ga0207677_100357703 449
351 3300026067 Ga0207678_10195939 Ga0207678_101959392 449
352 3300026095 Ga0207676_10026018 Ga0207676_100260183 449
353 3300026116 Ga0207674_10022600 Ga0207674_100226007 449
354 3300028379 Ga0268266_10074057 Ga0268266_100740572 449
355 3300048913 Ga0496110_0253107 Ga0496110_0253107_12_1367 449
356 3300049571 Ga0501034_0042117 Ga0501034_0042117_1549_2943 449
357 3300003320 rootH2_10232113 rootH2_102321132 450
358 3300003322 rootL2_10011352 rootL2_100113527 450
359 3300005331 Ga0070670_100061813 Ga0070670_1000618132 450
360 3300005840 Ga0068870_10048954 Ga0068870_100489542 450
361 3300026116 Ga0207674_10068693 Ga0207674_100686933 450
362 3300042004 Ga0439445_0002242 Ga0439445_0002242_2472_3869 450
363 3300049649 Ga0501198_002849 Ga0501198_002849_164_1522 450
364 3300049652 Ga0501202_010475 Ga0501202_010475_93_1451 450
365 3300049654 Ga0501207_005574 Ga0501207_005574_261_1619 450
366 3300049664 Ga0501224_001381 Ga0501224_001381_650_2008 450
367 3300049669 Ga0501235_013766 Ga0501235_013766_413_1771 450
368 3300049675 Ga0501243_000246 Ga0501243_000246_1381_2739 450
369 3300049704 Ga0501221_000233 Ga0501221_000233_637_1995 450
370 3300049708 Ga0501245_000980 Ga0501245_000980_593_1951 450
371 2162886007 SwRhRL2b_contig_3553489 SwRhRL2b_0377.00002780 451
372 3300005289 Ga0065704_10096067 Ga0065704_100960672 451
373 3300005616 Ga0068852_100065584 Ga0068852_1000655843 451
374 3300006237 Ga0097621_100156224 Ga0097621_1001562242 451
375 3300009177 Ga0105248_10071385 Ga0105248_100713854 451
376 3300009553 Ga0105249_10320954 Ga0105249_103209541 451
377 3300013308 Ga0157375_10072819 Ga0157375_100728193 451
378 3300014968 Ga0157379_10202781 Ga0157379_102027812 451
379 3300017792 Ga0163161_10075733 Ga0163161_100757332 451
380 3300028381 Ga0268264_10161995 Ga0268264_101619952 451
381 3300030521 Ga0307511_10000514 Ga0307511_100005148 451

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07690

MFS_1

Major Facilitator Superfamily

74

441

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
3o7p-assembly1.cif.gz_A crystal structure of the e.coli fucose:proton symporter, fucp (n162a) 0.8721 16 431
3o7q-assembly1.cif.gz_A crystal structure of a major facilitator superfamily (mfs) transporter, fucp, in the outward conformation 0.8652 16 431
3o7p-assembly1.cif.gz_A crystal structure of the e.coli fucose:proton symporter, fucp (n162a) 0.8621 16 431
3o7q-assembly1.cif.gz_A crystal structure of a major facilitator superfamily (mfs) transporter, fucp, in the outward conformation 0.8554 16 431
7ckr-assembly1.cif.gz_A cryo-em structure of the human mct1/basigin-2 complex in the presence of anti-cancer drug candidate bay-8002 in the outward-open conformation. 0.7947 23 431
ID Description Score Start End Superfamily
af_A0A1D6I3B4_2_197_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.8833 15 226 1.20.1250.20
af_P11551_22_243_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.8668 16 233 1.20.1250.20
af_A0A0R0HMJ0_13_161_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.8611 62 220 1.20.1250.20
af_A0A1D6L8U4_23_213_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.8604 19 226 1.20.1250.20
af_P21503_7_181_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.8536 21 224 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A354GF75-F1-model_v4 Glucose/galactose MFS transporter 0.9251 10 200 GO:0005886
GO:0022857
AF-I9YG61-F1-model_v4 deleted 0.9224 12 439
AF-F0EYN3-F1-model_v4 Glucose/galactose transporter WARNING 0.9213 11 439 GO:0005354
GO:0005886
GO:0055056
GO:1904659
AF-I9YG61-F1-model_v4 deleted 0.9202 12 439
AF-A0A7V1TV56-F1-model_v4 L-fucose:H+ symporter permease 0.9168 1 432 GO:0005354
GO:0005886
GO:0015535
GO:0055056
GO:1904659

Feature Viewer

pLDDT pTM Quality
88.25 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map