F428952

General Info

Members Datasets Scaffolds Average Seq Length
381 218 762 356

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_10090997|Ga0114129_100909973
Length 369
Sequence MGKKRSARKVEDMSAVSAPETGPDAGAVWHYGDPLGEQRAAADGAVVVDRSHRAVLMLTGKDRKTWLHSISSQHVSDLPDGAVTQNLSLDGQGRVEDHWIQTQLDGVTYLDTEAWRGEPLLTYLRKMVFWADASVEPADLAVLSLLGPKLADPQVVDALGIGSLPAEDAAVPLPGGGFLRRMAGQTIELDLVVPREQAAAWRQRLVDAGVRPAGVWAYEAHRVAALRPRLGVDTDERTIPHEVGWIGTAVHLDKGCYRGQETVARVHNLGKPPRMLVLVHLDGAADRPATGDPVLAGGRTVGRLGTVVDHVDEGPIALALLKRGLPADTPLTTGGQTEVAAVIDPDSMPPTDAVGAGRLAVEQLRGRAR

Samples

Sample ID Description Type Environment
1 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
31 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
46 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
47 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
48 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
49 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
50 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
51 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
52 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
53 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
54 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
55 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
56 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
57 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
60 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
64 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
72 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
73 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
74 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
80 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
81 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
82 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
83 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
84 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
85 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
86 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
126 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
130 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
131 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
132 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
133 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
134 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
135 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
136 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
137 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
138 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
139 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
140 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
141 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
142 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
143 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
144 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
145 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
146 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
147 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
148 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
149 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
150 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
151 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
152 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
153 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
154 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
155 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
156 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
157 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
158 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
159 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
160 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
161 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
162 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
163 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
164 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
165 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
166 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
167 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
168 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
169 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
170 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
171 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
172 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
173 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
174 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
175 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
176 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
177 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
178 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
179 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
180 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
181 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
182 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
183 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
184 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
185 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
186 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
187 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
188 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
189 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
190 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
191 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
192 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
193 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
194 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
196 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
197 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
198 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
199 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
200 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
201 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
202 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
203 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
204 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
205 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
206 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
207 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
208 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
209 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
210 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
211 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
212 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
213 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
214 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
215 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
216 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
217 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
218 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.43
Metatranscriptomes 0
Isolates 1.57

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.97
Nodule 0.26
Rhizoplane 13.39
Rhizosphere 67.98
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0114129_10090997 3300009147 Bacteria 4228
2 JGI24744J21845_10001174 3300002077 Bacteria 5107
3 JGI24744J21845_10002957 3300002077 Bacteria 3478
4 Ga0070676_10058441 3300005328 Bacteria 2285
5 Ga0068869_100002932 3300005334 Bacteria 10356
6 Ga0070666_10080072 3300005335 Bacteria 2232
7 Ga0070682_100051447 3300005337 Bacteria 2575
8 Ga0070682_100168043 3300005337 Bacteria 1522
9 Ga0068868_100019230 3300005338 Bacteria 5117
10 Ga0070660_100068648 3300005339 Bacteria 2763
11 Ga0070689_100073179 3300005340 Bacteria 2679
12 Ga0070687_100037260 3300005343 Bacteria 2430
13 Ga0070687_100173044 3300005343 Bacteria 1287
14 Ga0070692_10026143 3300005345 Bacteria 2882
15 Ga0070668_100006625 3300005347 Bacteria 8583
16 Ga0070668_100009869 3300005347 Bacteria 7071
17 Ga0070668_100068015 3300005347 Bacteria 2768
18 Ga0070668_100096613 3300005347 Bacteria 2335
19 Ga0070669_100001060 3300005353 Bacteria 20122
20 Ga0070669_100068281 3300005353 Bacteria 2624
21 Ga0070675_100468882 3300005354 Bacteria 1131
22 Ga0070671_100000693 3300005355 Bacteria 24230
23 Ga0070674_100041160 3300005356 Bacteria 3129
24 Ga0070674_100056610 3300005356 Bacteria 2719
25 Ga0070674_100379163 3300005356 Bacteria 1150
26 Ga0070688_100020667 3300005365 Bacteria 3831
27 Ga0070659_100015792 3300005366 Bacteria 5659
28 Ga0070667_100000960 3300005367 Bacteria 26531
29 Ga0070667_100017794 3300005367 Bacteria 5891
30 Ga0070667_100042622 3300005367 Bacteria 3808
31 Ga0070667_100095006 3300005367 Bacteria 2569
32 Ga0070714_100013034 3300005435 Bacteria 6651
33 Ga0070714_100179863 3300005435 Bacteria 1924
34 Ga0070710_10001385 3300005437 Bacteria 11439
35 Ga0070710_10007934 3300005437 Bacteria 5158
36 Ga0070710_10014992 3300005437 Bacteria 3913
37 Ga0070711_100002751 3300005439 Bacteria 10083
38 Ga0070711_100010221 3300005439 Bacteria 5801
39 Ga0070700_100002767 3300005441 Bacteria 8967
40 Ga0070694_100015528 3300005444 Bacteria 4785
41 Ga0070663_100076732 3300005455 Bacteria 2445
42 Ga0070663_100103658 3300005455 Bacteria 2127
43 Ga0070678_100002337 3300005456 Bacteria 10354
44 Ga0070678_100051691 3300005456 Bacteria 2980
45 Ga0070678_100225975 3300005456 Bacteria 1558
46 Ga0070662_100010075 3300005457 Bacteria 6192
47 Ga0070662_100031513 3300005457 Bacteria 3721
48 Ga0068867_100005051 3300005459 Bacteria 9313
49 Ga0068853_100003834 3300005539 Bacteria 11516
50 Ga0070695_100027954 3300005545 Bacteria 3497
51 Ga0070696_100006372 3300005546 Bacteria 7894
52 Ga0070665_100030751 3300005548 Bacteria 5403
53 Ga0070665_100288864 3300005548 Bacteria 1642
54 Ga0070704_100013226 3300005549 Bacteria 5117
55 Ga0068854_100003641 3300005578 Bacteria 9642
56 Ga0068854_100021027 3300005578 Bacteria 4423
57 Ga0070702_100031729 3300005615 Bacteria 2893
58 Ga0068852_100171324 3300005616 Bacteria 2035
59 Ga0068859_100004535 3300005617 Bacteria 14163
60 Ga0068859_100171541 3300005617 Bacteria 2250
61 Ga0068866_10001953 3300005718 Bacteria 8594
62 Ga0068861_100015468 3300005719 Bacteria 5377
63 Ga0068870_10122080 3300005840 Bacteria 1502
64 Ga0068863_100000105 3300005841 Bacteria 90388
65 Ga0068863_100006517 3300005841 Bacteria 11453
66 Ga0068858_100010352 3300005842 Bacteria 8832
67 Ga0068858_100043854 3300005842 Bacteria 4147
68 Ga0068858_100123180 3300005842 Bacteria 2426
69 Ga0068860_100000209 3300005843 Bacteria 92811
70 Ga0068860_100039127 3300005843 Bacteria 4536
71 Ga0068860_100132431 3300005843 Bacteria 2393
72 Ga0068862_100000400 3300005844 Bacteria 46788
73 Ga0068862_100005740 3300005844 Bacteria 10354
74 Ga0068862_100121536 3300005844 Bacteria 2302
75 Ga0081455_10063460 3300005937 Bacteria 3100
76 Ga0075365_10006929 3300006038 Bacteria 6295
77 Ga0075365_10010254 3300006038 Bacteria 5445
78 Ga0075365_10014943 3300006038 Bacteria 4683
79 Ga0075365_10194326 3300006038 Bacteria 1420
80 Ga0075368_10055450 3300006042 Bacteria 1580
81 Ga0075363_100012220 3300006048 Bacteria 4133
82 Ga0075363_100028716 3300006048 Bacteria 2864
83 Ga0075363_100033222 3300006048 Bacteria 2685
84 Ga0075363_100041847 3300006048 Bacteria 2417
85 Ga0075364_10038668 3300006051 Bacteria 3091
86 Ga0075364_10174895 3300006051 Bacteria 1452
87 Ga0070715_10008744 3300006163 Bacteria 3541
88 Ga0070716_100007934 3300006173 Bacteria 5255
89 Ga0070716_100045054 3300006173 Bacteria 2474
90 Ga0070712_100003957 3300006175 Bacteria 9111
91 Ga0075362_10006017 3300006177 Bacteria 4491
92 Ga0075367_10131615 3300006178 Bacteria 1546
93 Ga0075369_10000684 3300006186 Bacteria 10833
94 Ga0075369_10095615 3300006186 Bacteria 1329
95 Ga0075366_10074083 3300006195 Bacteria 2030
96 Ga0075370_10021810 3300006353 Bacteria 3511
97 Ga0075370_10030623 3300006353 Bacteria 3003
98 Ga0068871_100050321 3300006358 Bacteria 3370
99 Ga0075428_100005448 3300006844 Bacteria 14146
100 Ga0075430_100029560 3300006846 Bacteria 4650
101 Ga0068865_100002783 3300006881 Bacteria 10391
102 Ga0068865_100151200 3300006881 Bacteria 1761
103 Ga0097620_100004535 3300006931 Bacteria 14163
104 Ga0097620_100171556 3300006931 Bacteria 2250
105 Ga0105245_10006580 3300009098 Bacteria 10200
106 Ga0105247_10000141 3300009101 Bacteria 70210
107 Ga0105247_10003401 3300009101 Bacteria 10399
108 Ga0105243_10071346 3300009148 Bacteria 2808
109 Ga0105241_10006169 3300009174 Bacteria 8841
110 Ga0105241_10411272 3300009174 Bacteria 1189
111 Ga0105242_10004138 3300009176 Bacteria 11293
112 Ga0105248_10001091 3300009177 Bacteria 30053
113 Ga0105248_10031723 3300009177 Bacteria 5903
114 Ga0105248_10304932 3300009177 Bacteria 1793
115 Ga0105237_10001867 3300009545 Bacteria 26871
116 Ga0105249_10000031 3300009553 Bacteria 220006
117 Ga0105249_10046773 3300009553 Bacteria 3939
118 Ga0105249_10111788 3300009553 Bacteria 2583
119 Ga0105239_10007046 3300010375 Bacteria 12936
120 Ga0105239_10078911 3300010375 Bacteria 3623
121 Ga0105246_10215937 3300011119 Bacteria 1500
122 Ga0157369_10090170 3300013105 Bacteria 3273
123 Ga0157378_10046847 3300013297 Bacteria 3842
124 Ga0163162_10078903 3300013306 Bacteria 3358
125 Ga0157372_10415364 3300013307 Bacteria 1568
126 Ga0157375_10001251 3300013308 Bacteria 21991
127 Ga0157375_10292102 3300013308 Bacteria 1793
128 Ga0163163_10045788 3300014325 Bacteria 4296
129 Ga0157380_10018585 3300014326 Bacteria 5162
130 Ga0157377_10064889 3300014745 Bacteria 2096
131 Ga0157377_10100709 3300014745 Bacteria 1721
132 Ga0157379_10008367 3300014968 Bacteria 8990
133 Ga0157379_10094948 3300014968 Bacteria 2676
134 Ga0157376_10032320 3300014969 Bacteria 4201
135 Ga0163161_10021613 3300017792 Bacteria 4522
136 Ga0163161_10118394 3300017792 Bacteria 1988
137 Ga0213876_10001902 3300021384 Bacteria 12559
138 Ga0213876_10038564 3300021384 Bacteria 2522
139 Ga0213875_10021377 3300021388 Bacteria 3100
140 Ga0207692_10003535 3300025898 Bacteria 6110
141 Ga0207642_10000179 3300025899 Bacteria 18334
142 Ga0207710_10000164 3300025900 Bacteria 70180
143 Ga0207710_10001390 3300025900 Bacteria 12141
144 Ga0207688_10001929 3300025901 Bacteria 11111
145 Ga0207688_10002258 3300025901 Bacteria 10371
146 Ga0207680_10077955 3300025903 Bacteria 2074
147 Ga0207680_10090671 3300025903 Bacteria 1943
148 Ga0207685_10001342 3300025905 Bacteria 5082
149 Ga0207685_10002772 3300025905 Bacteria 4099
150 Ga0207645_10017196 3300025907 Bacteria 4776
151 Ga0207645_10047682 3300025907 Bacteria 2735
152 Ga0207693_10005747 3300025915 Bacteria 10294
153 Ga0207693_10013467 3300025915 Bacteria 6594
154 Ga0207663_10002588 3300025916 Bacteria 8701
155 Ga0207663_10016705 3300025916 Bacteria 4076
156 Ga0207657_10160359 3300025919 Bacteria 1827
157 Ga0207681_10000456 3300025923 Bacteria 28674
158 Ga0207681_10119405 3300025923 Bacteria 1931
159 Ga0207687_10041467 3300025927 Bacteria 3161
160 Ga0207664_10149096 3300025929 Bacteria 1986
161 Ga0207644_10029843 3300025931 Bacteria 3785
162 Ga0207644_10213613 3300025931 Bacteria 1526
163 Ga0207644_10231272 3300025931 Bacteria 1469
164 Ga0207690_10087294 3300025932 Bacteria 2195
165 Ga0207690_10179197 3300025932 Bacteria 1594
166 Ga0207706_10033181 3300025933 Bacteria 4595
167 Ga0207706_10048673 3300025933 Bacteria 3748
168 Ga0207686_10027906 3300025934 Bacteria 3311
169 Ga0207709_10002137 3300025935 Bacteria 12664
170 Ga0207670_10009159 3300025936 Bacteria 5631
171 Ga0207669_10001598 3300025937 Bacteria 9649
172 Ga0207704_10002309 3300025938 Bacteria 8573
173 Ga0207704_10026691 3300025938 Bacteria 3172
174 Ga0207665_10021691 3300025939 Bacteria 4225
175 Ga0207665_10054257 3300025939 Bacteria 2703
176 Ga0207691_10026272 3300025940 Bacteria 5465
177 Ga0207691_10065125 3300025940 Bacteria 3300
178 Ga0207711_10000196 3300025941 Bacteria 64910
179 Ga0207711_10003673 3300025941 Bacteria 13256
180 Ga0207711_10371536 3300025941 Bacteria 1326
181 Ga0207689_10002479 3300025942 Bacteria 17159
182 Ga0207689_10029767 3300025942 Bacteria 4554
183 Ga0207667_10108612 3300025949 Bacteria 2862
184 Ga0207712_10000029 3300025961 Bacteria 220014
185 Ga0207712_10034853 3300025961 Bacteria 3414
186 Ga0207712_10074058 3300025961 Bacteria 2458
187 Ga0207668_10025503 3300025972 Bacteria 3826
188 Ga0207668_10028943 3300025972 Bacteria 3627
189 Ga0207640_10001076 3300025981 Bacteria 15126
190 Ga0207658_10000517 3300025986 Bacteria 35169
191 Ga0207658_10011131 3300025986 Bacteria 6126
192 Ga0207658_10070096 3300025986 Bacteria 2651
193 Ga0207658_10118017 3300025986 Bacteria 2110
194 Ga0207658_10172298 3300025986 Bacteria 1784
195 Ga0207677_10013097 3300026023 Bacteria 4794
196 Ga0207703_10007260 3300026035 Bacteria 8811
197 Ga0207703_10074182 3300026035 Bacteria 2816
198 Ga0207703_10166927 3300026035 Bacteria 1933
199 Ga0207639_10003868 3300026041 Bacteria 10088
200 Ga0207678_10043825 3300026067 Bacteria 3871
201 Ga0207678_10123082 3300026067 Bacteria 2213
202 Ga0207708_10019587 3300026075 Bacteria 5101
203 Ga0207708_10088725 3300026075 Bacteria 2382
204 Ga0207641_10000581 3300026088 Bacteria 40291
205 Ga0207641_10026429 3300026088 Bacteria 4790
206 Ga0207675_100008196 3300026118 Bacteria 9845
207 Ga0207675_100135793 3300026118 Bacteria 2334
208 Ga0207683_10006112 3300026121 Bacteria 10312
209 Ga0207683_10017811 3300026121 Bacteria 6058
210 Ga0207698_10047714 3300026142 Bacteria 3247
211 Ga0207698_10169790 3300026142 Bacteria 1919
212 Ga0209813_10023766 3300027866 Bacteria 1745
213 Ga0268266_10006438 3300028379 Bacteria 10754
214 Ga0268266_10227640 3300028379 Bacteria 1716
215 Ga0268265_10000389 3300028380 Bacteria 46920
216 Ga0268265_10015615 3300028380 Bacteria 5199
217 Ga0268264_10000017 3300028381 Bacteria 498037
218 Ga0268264_10004905 3300028381 Bacteria 11335
219 Ga0307413_10166908 3300031824 Bacteria 1553
220 Ga0307410_10007287 3300031852 Bacteria 6045
221 Ga0307409_100011193 3300031995 Bacteria 5638
222 Ga0307414_10161883 3300032004 Bacteria 1778
223 Ga0307415_100137723 3300032126 Bacteria 1859
224 Ga0373962_0037065 3300035242 Bacteria 1360
225 Ga0436364_0090351 3300037853 Bacteria 12081
226 Ga0436364_0632914 3300037853 Bacteria 6072
227 Ga0436365_1818399 3300039437 Bacteria 33160
228 Ga0436365_1833781 3300039437 Bacteria 32006
229 Ga0436363_1636492 3300039450 Bacteria 3700
230 Ga0439466_0001147 3300041411 Bacteria 10298
231 Ga0439466_0012543 3300041411 Bacteria 3120
232 Ga0439465_0000834 3300041413 Bacteria 9713
233 Ga0439465_0001830 3300041413 Bacteria 6955
234 Ga0439465_0001856 3300041413 Bacteria 6913
235 Ga0439431_0006206 3300041997 Bacteria 2638
236 Ga0439434_0019119 3300042435 Bacteria 2053
237 Ga0466972_0013919 3300044658 Bacteria 4035
238 Ga0466965_0002797 3300044683 Bacteria 7508
239 Ga0466966_0024221 3300044684 Bacteria 3972
240 Ga0466966_0061612 3300044684 Bacteria 2366
241 Ga0466961_0014354 3300044693 Bacteria 5083
242 Ga0466961_0153025 3300044693 Bacteria 1439
243 Ga0466963_0053479 3300044694 Bacteria 2681
244 Ga0466963_0071248 3300044694 Bacteria 2339
245 Ga0466964_0003506 3300044706 Bacteria 5728
246 Ga0466971_0005069 3300044719 Bacteria 5706
247 Ga0466971_0050061 3300044719 Bacteria 1880
248 Ga0466968_0022362 3300044735 Bacteria 2570
249 Ga0466970_0020813 3300044765 Bacteria 3412
250 Ga0466957_0020030 3300044842 Bacteria 3937
251 Ga0466957_0186882 3300044842 Bacteria 1355
252 Ga0466960_0014545 3300044901 Bacteria 3372
253 Ga0466959_0003472 3300045049 Bacteria 10320
254 Ga0466959_0023697 3300045049 Bacteria 4543
255 Ga0466959_0031822 3300045049 Bacteria 3904
256 Ga0466958_0016528 3300045836 Bacteria 4250
257 Ga0466958_0019392 3300045836 Bacteria 3959
258 Ga0466958_0185829 3300045836 Bacteria 1320
259 Ga0466967_0034788 3300045976 Bacteria 4281
260 Ga0466967_0058051 3300045976 Bacteria 3419
261 Ga0466967_0061763 3300045976 Bacteria 3325
262 Ga0495629_0019549 3300046459 Bacteria 4838
263 Ga0495638_0002708 3300046460 Bacteria 14252
264 Ga0495638_0021490 3300046460 Bacteria 4251
265 Ga0495641_0030727 3300046461 Bacteria 2572
266 Ga0495639_0027016 3300046475 Bacteria 2540
267 Ga0495606_0047622 3300046507 Bacteria 2825
268 Ga0495648_0017429 3300046524 Bacteria 5132
269 Ga0495640_0055687 3300046533 Bacteria 2705
270 Ga0495668_0010283 3300046616 Bacteria 5676
271 Ga0495674_0075580 3300047319 Bacteria 2899
272 Ga0495672_0019498 3300047320 Bacteria 4470
273 Ga0495672_0025777 3300047320 Bacteria 3758
274 Ga0495676_0087904 3300047321 Bacteria 2333
275 Ga0495673_0000524 3300047469 Bacteria 40257
276 Ga0495593_0009997 3300047673 Bacteria 5498
277 Ga0496100_0002372 3300048903 Bacteria 9526
278 Ga0496100_0004442 3300048903 Bacteria 7436
279 Ga0496100_0006094 3300048903 Bacteria 6554
280 Ga0496100_0014470 3300048903 Bacteria 4580
281 Ga0496100_0025025 3300048903 Bacteria 3647
282 Ga0496101_0000031 3300048904 Bacteria 195195
283 Ga0496101_0000462 3300048904 Bacteria 25778
284 Ga0496101_0004267 3300048904 Bacteria 8963
285 Ga0496101_0024169 3300048904 Bacteria 4203
286 Ga0496102_0000065 3300048905 Bacteria 161370
287 Ga0496102_0000387 3300048905 Bacteria 51915
288 Ga0496102_0004258 3300048905 Bacteria 12095
289 Ga0496102_0033307 3300048905 Bacteria 4628
290 Ga0496102_0110407 3300048905 Bacteria 2563
291 Ga0496102_0163161 3300048905 Bacteria 2096
292 Ga0496103_0000048 3300048906 Bacteria 160911
293 Ga0496103_0000292 3300048906 Bacteria 46843
294 Ga0496103_0008169 3300048906 Bacteria 6211
295 Ga0496103_0037103 3300048906 Bacteria 2986
296 Ga0496103_0144361 3300048906 Bacteria 1523
297 Ga0496104_0043139 3300048907 Bacteria 4236
298 Ga0496104_0066382 3300048907 Bacteria 3426
299 Ga0496104_0218974 3300048907 Bacteria 1816
300 Ga0496105_0004783 3300048908 Bacteria 10224
301 Ga0496105_0036301 3300048908 Bacteria 4060
302 Ga0496106_0014170 3300048909 Bacteria 5888
303 Ga0496106_0021865 3300048909 Bacteria 4751
304 Ga0496106_0024285 3300048909 Bacteria 4505
305 Ga0496107_0000521 3300048910 Bacteria 21374
306 Ga0496107_0012739 3300048910 Bacteria 5876
307 Ga0496107_0036367 3300048910 Bacteria 3532
308 Ga0496107_0128730 3300048910 Bacteria 1868
309 Ga0496108_0018250 3300048911 Bacteria 5745
310 Ga0496108_0079023 3300048911 Bacteria 2785
311 Ga0496109_0003239 3300048912 Bacteria 13560
312 Ga0496109_0055463 3300048912 Bacteria 3615
313 Ga0496109_0113572 3300048912 Bacteria 2519
314 Ga0496109_0434803 3300048912 Bacteria 1239
315 Ga0496110_0012823 3300048913 Bacteria 6905
316 Ga0496110_0025582 3300048913 Bacteria 5046
317 Ga0496111_0021874 3300048914 Bacteria 4470
318 Ga0496112_0005299 3300048915 Bacteria 11126
319 Ga0496112_0019057 3300048915 Bacteria 6468
320 Ga0496112_0032478 3300048915 Bacteria 5069
321 Ga0496112_0077919 3300048915 Bacteria 3278
322 Ga0496112_0172227 3300048915 Bacteria 2130
323 Ga0496113_0235163 3300048916 Bacteria 1461
324 Ga0496114_0007157 3300048917 Bacteria 8801
325 Ga0496114_0070756 3300048917 Bacteria 2931
326 Ga0496115_0001385 3300048918 Bacteria 17323
327 Ga0496115_0006246 3300048918 Bacteria 8716
328 Ga0496116_0000125 3300048919 Bacteria 160885
329 Ga0496116_0007305 3300048919 Bacteria 9841
330 Ga0496117_0000111 3300048920 Bacteria 184570
331 Ga0496117_0001572 3300048920 Bacteria 32413
332 Ga0496117_0157292 3300048920 Bacteria 1336
333 Ga0496118_0000083 3300048921 Bacteria 184570
334 Ga0496118_0000272 3300048921 Bacteria 91016
335 Ga0496118_0001353 3300048921 Bacteria 36982
336 Ga0496119_0002640 3300048922 Bacteria 19420
337 Ga0496119_0027667 3300048922 Bacteria 3890
338 Ga0496119_0060815 3300048922 Bacteria 2259
339 Ga0496120_0013212 3300048923 Bacteria 5572
340 Ga0496120_0015070 3300048923 Bacteria 5115
341 Ga0496121_0000728 3300048924 Bacteria 60874
342 Ga0496124_0085384 3300048927 Bacteria 2586
343 Ga0496125_0031000 3300048928 Bacteria 4773
344 Ga0496125_0092316 3300048928 Bacteria 2264
345 Ga0496126_0000220 3300048929 Bacteria 124547
346 Ga0496126_0001476 3300048929 Bacteria 36542
347 Ga0496126_0095751 3300048929 Bacteria 2603
348 Ga0501034_0046887 3300049571 Bacteria 4366
349 Ga0501034_0338218 3300049571 Bacteria 1436
350 Ga0501069_0175020 3300049585 Bacteria 1239
351 nmdc:mga03n38_15549_c1 3300050490 Bacteria 2940
352 nmdc:mga03n38_84882_c1 3300050490 Bacteria 1496
353 nmdc:mga00v17_161227_c1 3300050491 Bacteria 1444
354 nmdc:mga00v17_26858_c1 3300050491 Bacteria 3358
355 nmdc:mga00v17_2758_c1 3300050491 Bacteria 9012
356 nmdc:mga0yw44_14775_c1 3300050492 Bacteria 4158
357 nmdc:mga0yw44_19636_c1 3300050492 Bacteria 3731
358 nmdc:mga06z11_3182_c1 3300050494 Bacteria 6337
359 nmdc:mga07m45_18539_c1 3300050496 Bacteria 3759
360 nmdc:mga07m45_9460_c1 3300050496 Bacteria 5056
361 nmdc:mga05p37_68519_c1 3300050507 Bacteria 4363
362 nmdc:mga0qj67_16380_c1 3300050509 Bacteria 5621
363 nmdc:mga08y16_105645_c1 3300050511 Bacteria 2931
364 nmdc:mga0sz30_29227_c1 3300050516 Bacteria 2271
365 nmdc:mga0sz30_83198_c1 3300050516 Bacteria 1386
366 Ga0495655_0038740 3300053083 Bacteria 1204
367 Ga0500643_003235 3300053087 Bacteria 7931
368 Ga0500643_016362 3300053087 Bacteria 2514
369 Ga0500562_015948 3300053108 Bacteria 1930
370 Ga0500652_003572 3300053131 Bacteria 4718
371 Ga0500559_0102452 3300053136 Bacteria 1320
372 Ga0500616_0002138 3300053153 Bacteria 17100
373 Ga0500645_000056 3300053730 Bacteria 92126
374 Ga0466962_0006764 3300061719 Bacteria 5501
375 Ga0466962_0046047 3300061719 Bacteria 2085
376 2738706329 2738541274 Bacteria 6909446
377 2739328819 2738543028 Bacteria 6917070
378 2842139515 2842134933 Bacteria 5847019
379 2902797214 2902792274 Bacteria 7270173
380 2902804109 2902799365 Bacteria 5419524
381 2939585109 2939582691 Bacteria 7088898
382 Ga0114129_10090997
383 JGI24744J21845_10001174
384 JGI24744J21845_10002957
385 Ga0070676_10058441
386 Ga0068869_100002932
387 Ga0070666_10080072
388 Ga0070682_100051447
389 Ga0070682_100168043
390 Ga0068868_100019230
391 Ga0070660_100068648
392 Ga0070689_100073179
393 Ga0070687_100037260
394 Ga0070687_100173044
395 Ga0070692_10026143
396 Ga0070668_100006625
397 Ga0070668_100009869
398 Ga0070668_100068015
399 Ga0070668_100096613
400 Ga0070669_100001060
401 Ga0070669_100068281
402 Ga0070675_100468882
403 Ga0070671_100000693
404 Ga0070674_100041160
405 Ga0070674_100056610
406 Ga0070674_100379163
407 Ga0070688_100020667
408 Ga0070659_100015792
409 Ga0070667_100000960
410 Ga0070667_100017794
411 Ga0070667_100042622
412 Ga0070667_100095006
413 Ga0070714_100013034
414 Ga0070714_100179863
415 Ga0070710_10001385
416 Ga0070710_10007934
417 Ga0070710_10014992
418 Ga0070711_100002751
419 Ga0070711_100010221
420 Ga0070700_100002767
421 Ga0070694_100015528
422 Ga0070663_100076732
423 Ga0070663_100103658
424 Ga0070678_100002337
425 Ga0070678_100051691
426 Ga0070678_100225975
427 Ga0070662_100010075
428 Ga0070662_100031513
429 Ga0068867_100005051
430 Ga0068853_100003834
431 Ga0070695_100027954
432 Ga0070696_100006372
433 Ga0070665_100030751
434 Ga0070665_100288864
435 Ga0070704_100013226
436 Ga0068854_100003641
437 Ga0068854_100021027
438 Ga0070702_100031729
439 Ga0068852_100171324
440 Ga0068859_100004535
441 Ga0068859_100171541
442 Ga0068866_10001953
443 Ga0068861_100015468
444 Ga0068870_10122080
445 Ga0068863_100000105
446 Ga0068863_100006517
447 Ga0068858_100010352
448 Ga0068858_100043854
449 Ga0068858_100123180
450 Ga0068860_100000209
451 Ga0068860_100039127
452 Ga0068860_100132431
453 Ga0068862_100000400
454 Ga0068862_100005740
455 Ga0068862_100121536
456 Ga0081455_10063460
457 Ga0075365_10006929
458 Ga0075365_10010254
459 Ga0075365_10014943
460 Ga0075365_10194326
461 Ga0075368_10055450
462 Ga0075363_100012220
463 Ga0075363_100028716
464 Ga0075363_100033222
465 Ga0075363_100041847
466 Ga0075364_10038668
467 Ga0075364_10174895
468 Ga0070715_10008744
469 Ga0070716_100007934
470 Ga0070716_100045054
471 Ga0070712_100003957
472 Ga0075362_10006017
473 Ga0075367_10131615
474 Ga0075369_10000684
475 Ga0075369_10095615
476 Ga0075366_10074083
477 Ga0075370_10021810
478 Ga0075370_10030623
479 Ga0068871_100050321
480 Ga0075428_100005448
481 Ga0075430_100029560
482 Ga0068865_100002783
483 Ga0068865_100151200
484 Ga0097620_100004535
485 Ga0097620_100171556
486 Ga0105245_10006580
487 Ga0105247_10000141
488 Ga0105247_10003401
489 Ga0105243_10071346
490 Ga0105241_10006169
491 Ga0105241_10411272
492 Ga0105242_10004138
493 Ga0105248_10001091
494 Ga0105248_10031723
495 Ga0105248_10304932
496 Ga0105237_10001867
497 Ga0105249_10000031
498 Ga0105249_10046773
499 Ga0105249_10111788
500 Ga0105239_10007046
501 Ga0105239_10078911
502 Ga0105246_10215937
503 Ga0157369_10090170
504 Ga0157378_10046847
505 Ga0163162_10078903
506 Ga0157372_10415364
507 Ga0157375_10001251
508 Ga0157375_10292102
509 Ga0163163_10045788
510 Ga0157380_10018585
511 Ga0157377_10064889
512 Ga0157377_10100709
513 Ga0157379_10008367
514 Ga0157379_10094948
515 Ga0157376_10032320
516 Ga0163161_10021613
517 Ga0163161_10118394
518 Ga0213876_10001902
519 Ga0213876_10038564
520 Ga0213875_10021377
521 Ga0207692_10003535
522 Ga0207642_10000179
523 Ga0207710_10000164
524 Ga0207710_10001390
525 Ga0207688_10001929
526 Ga0207688_10002258
527 Ga0207680_10077955
528 Ga0207680_10090671
529 Ga0207685_10001342
530 Ga0207685_10002772
531 Ga0207645_10017196
532 Ga0207645_10047682
533 Ga0207693_10005747
534 Ga0207693_10013467
535 Ga0207663_10002588
536 Ga0207663_10016705
537 Ga0207657_10160359
538 Ga0207681_10000456
539 Ga0207681_10119405
540 Ga0207687_10041467
541 Ga0207664_10149096
542 Ga0207644_10029843
543 Ga0207644_10213613
544 Ga0207644_10231272
545 Ga0207690_10087294
546 Ga0207690_10179197
547 Ga0207706_10033181
548 Ga0207706_10048673
549 Ga0207686_10027906
550 Ga0207709_10002137
551 Ga0207670_10009159
552 Ga0207669_10001598
553 Ga0207704_10002309
554 Ga0207704_10026691
555 Ga0207665_10021691
556 Ga0207665_10054257
557 Ga0207691_10026272
558 Ga0207691_10065125
559 Ga0207711_10000196
560 Ga0207711_10003673
561 Ga0207711_10371536
562 Ga0207689_10002479
563 Ga0207689_10029767
564 Ga0207667_10108612
565 Ga0207712_10000029
566 Ga0207712_10034853
567 Ga0207712_10074058
568 Ga0207668_10025503
569 Ga0207668_10028943
570 Ga0207640_10001076
571 Ga0207658_10000517
572 Ga0207658_10011131
573 Ga0207658_10070096
574 Ga0207658_10118017
575 Ga0207658_10172298
576 Ga0207677_10013097
577 Ga0207703_10007260
578 Ga0207703_10074182
579 Ga0207703_10166927
580 Ga0207639_10003868
581 Ga0207678_10043825
582 Ga0207678_10123082
583 Ga0207708_10019587
584 Ga0207708_10088725
585 Ga0207641_10000581
586 Ga0207641_10026429
587 Ga0207675_100008196
588 Ga0207675_100135793
589 Ga0207683_10006112
590 Ga0207683_10017811
591 Ga0207698_10047714
592 Ga0207698_10169790
593 Ga0209813_10023766
594 Ga0268266_10006438
595 Ga0268266_10227640
596 Ga0268265_10000389
597 Ga0268265_10015615
598 Ga0268264_10000017
599 Ga0268264_10004905
600 Ga0307413_10166908
601 Ga0307410_10007287
602 Ga0307409_100011193
603 Ga0307414_10161883
604 Ga0307415_100137723
605 Ga0373962_0037065
606 Ga0436364_0090351
607 Ga0436364_0632914
608 Ga0436365_1818399
609 Ga0436365_1833781
610 Ga0436363_1636492
611 Ga0439466_0001147
612 Ga0439466_0012543
613 Ga0439465_0000834
614 Ga0439465_0001830
615 Ga0439465_0001856
616 Ga0439431_0006206
617 Ga0439434_0019119
618 Ga0466972_0013919
619 Ga0466965_0002797
620 Ga0466966_0024221
621 Ga0466966_0061612
622 Ga0466961_0014354
623 Ga0466961_0153025
624 Ga0466963_0053479
625 Ga0466963_0071248
626 Ga0466964_0003506
627 Ga0466971_0005069
628 Ga0466971_0050061
629 Ga0466968_0022362
630 Ga0466970_0020813
631 Ga0466957_0020030
632 Ga0466957_0186882
633 Ga0466960_0014545
634 Ga0466959_0003472
635 Ga0466959_0023697
636 Ga0466959_0031822
637 Ga0466958_0016528
638 Ga0466958_0019392
639 Ga0466958_0185829
640 Ga0466967_0034788
641 Ga0466967_0058051
642 Ga0466967_0061763
643 Ga0495629_0019549
644 Ga0495638_0002708
645 Ga0495638_0021490
646 Ga0495641_0030727
647 Ga0495639_0027016
648 Ga0495606_0047622
649 Ga0495648_0017429
650 Ga0495640_0055687
651 Ga0495668_0010283
652 Ga0495674_0075580
653 Ga0495672_0019498
654 Ga0495672_0025777
655 Ga0495676_0087904
656 Ga0495673_0000524
657 Ga0495593_0009997
658 Ga0496100_0002372
659 Ga0496100_0004442
660 Ga0496100_0006094
661 Ga0496100_0014470
662 Ga0496100_0025025
663 Ga0496101_0000031
664 Ga0496101_0000462
665 Ga0496101_0004267
666 Ga0496101_0024169
667 Ga0496102_0000065
668 Ga0496102_0000387
669 Ga0496102_0004258
670 Ga0496102_0033307
671 Ga0496102_0110407
672 Ga0496102_0163161
673 Ga0496103_0000048
674 Ga0496103_0000292
675 Ga0496103_0008169
676 Ga0496103_0037103
677 Ga0496103_0144361
678 Ga0496104_0043139
679 Ga0496104_0066382
680 Ga0496104_0218974
681 Ga0496105_0004783
682 Ga0496105_0036301
683 Ga0496106_0014170
684 Ga0496106_0021865
685 Ga0496106_0024285
686 Ga0496107_0000521
687 Ga0496107_0012739
688 Ga0496107_0036367
689 Ga0496107_0128730
690 Ga0496108_0018250
691 Ga0496108_0079023
692 Ga0496109_0003239
693 Ga0496109_0055463
694 Ga0496109_0113572
695 Ga0496109_0434803
696 Ga0496110_0012823
697 Ga0496110_0025582
698 Ga0496111_0021874
699 Ga0496112_0005299
700 Ga0496112_0019057
701 Ga0496112_0032478
702 Ga0496112_0077919
703 Ga0496112_0172227
704 Ga0496113_0235163
705 Ga0496114_0007157
706 Ga0496114_0070756
707 Ga0496115_0001385
708 Ga0496115_0006246
709 Ga0496116_0000125
710 Ga0496116_0007305
711 Ga0496117_0000111
712 Ga0496117_0001572
713 Ga0496117_0157292
714 Ga0496118_0000083
715 Ga0496118_0000272
716 Ga0496118_0001353
717 Ga0496119_0002640
718 Ga0496119_0027667
719 Ga0496119_0060815
720 Ga0496120_0013212
721 Ga0496120_0015070
722 Ga0496121_0000728
723 Ga0496124_0085384
724 Ga0496125_0031000
725 Ga0496125_0092316
726 Ga0496126_0000220
727 Ga0496126_0001476
728 Ga0496126_0095751
729 Ga0501034_0046887
730 Ga0501034_0338218
731 Ga0501069_0175020
732 nmdc:mga03n38_15549_c1
733 nmdc:mga03n38_84882_c1
734 nmdc:mga00v17_161227_c1
735 nmdc:mga00v17_26858_c1
736 nmdc:mga00v17_2758_c1
737 nmdc:mga0yw44_14775_c1
738 nmdc:mga0yw44_19636_c1
739 nmdc:mga06z11_3182_c1
740 nmdc:mga07m45_18539_c1
741 nmdc:mga07m45_9460_c1
742 nmdc:mga05p37_68519_c1
743 nmdc:mga0qj67_16380_c1
744 nmdc:mga08y16_105645_c1
745 nmdc:mga0sz30_29227_c1
746 nmdc:mga0sz30_83198_c1
747 Ga0495655_0038740
748 Ga0500643_003235
749 Ga0500643_016362
750 Ga0500562_015948
751 Ga0500652_003572
752 Ga0500559_0102452
753 Ga0500616_0002138
754 Ga0500645_000056
755 Ga0466962_0006764
756 Ga0466962_0046047
757 2738706329
758 2739328819
759 2842139515
760 2902797214
761 2902804109
762 2939585109

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01571

GCV_T

Aminomethyltransferase folate-binding domain

27

246

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
5uw8-assembly1.cif.gz_C structure of e. coli mce protein mlad, core mce domain 0.7157 264 316
6zy4-assembly1.cif.gz_A cryo-em structure of mlafedb in complex with adp 0.7053 265 315
1vrq-assembly1.cif.gz_C crystal structure of heterotetrameric sarcosine oxidase from corynebacterium sp. u-96 in complex with folinic acid 0.6514 11 196
2gah-assembly1.cif.gz_C heterotetrameric sarcosine: structure of a diflavin metaloenzyme at 1.85 a resolution 0.6239 18 196
1vrq-assembly1.cif.gz_C crystal structure of heterotetrameric sarcosine oxidase from corynebacterium sp. u-96 in complex with folinic acid 0.6028 11 196
ID Description Score Start End Superfamily
1wosA02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Aminomethyltransferase beta-barrel domains 0.8919 40 124 3.30.70.1400
1wsvB02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Aminomethyltransferase beta-barrel domains 0.8905 43 124 3.30.70.1400
4paaA04 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Aminomethyltransferase beta-barrel domains 0.8851 42 125 3.30.70.1400
3girA02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Aminomethyltransferase beta-barrel domains 0.8785 43 123 3.30.70.1400
1yx2B02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Aminomethyltransferase beta-barrel domains 0.8736 43 124 3.30.70.1400
ID Description Score Start End GO Terms
AF-A0A3D5Y0V4-F1-model_v4 Aminomethyltransferase folate-binding domain-containing protein 0.9232 38 122 GO:0016226
AF-A0A7C7CQ33-F1-model_v4 Glycine cleavage system aminomethyltransferase GcvT 0.9226 23 136 GO:0005829
GO:0008168
GO:0032259
AF-A0A2V9D826-F1-model_v4 Aminomethyltransferase folate-binding domain-containing protein 0.922 21 124
AF-A0A523LA96-F1-model_v4 deleted 0.9206 23 136
AF-A0A847HZ31-F1-model_v4 Aminomethyltransferase folate-binding domain-containing protein 0.9193 23 136 GO:0016226

Map