F428927

General Info

Members Datasets Scaffolds Average Seq Length
381 175 762 109

Family's Representative Sequence

Representative Sequence 3300005937|Ga0081455_10011671|Ga0081455_100116715
Length 107
Sequence MGQNTKTVTDATFADEVLQADGPVLVDFWAEWCGPCKMVSPLDEIAGEYPDKITVAKVNIDENPSIARDYQIMSIPTMSVFDKGRVVKSIIGARPKAAILKELSDFI

Samples

Sample ID Description Type Environment
1 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300002872 Avena fatua rhizosphere microbial communities - H1_Bulk_Litter_5 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
4 3300003162 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
5 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
6 3300003285 Grassland soil microbial communities from Hopland, California, USA - Sample H3_Rhizo_39 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
7 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
8 3300003568 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_24 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
9 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
10 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
11 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
12 3300003611 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_27 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
13 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
14 3300003735 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
15 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
16 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
17 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
18 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
31 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
32 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
33 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
34 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
35 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
36 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
37 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
38 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
39 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
40 3300012475 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 Metagenome Rhizosphere
41 3300012485 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 Metagenome Rhizosphere
42 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
43 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
44 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
45 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
46 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
47 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
48 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
49 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
50 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
51 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
52 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
53 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
54 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
55 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
56 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
57 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
58 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
59 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
60 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
61 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
76 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
78 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
79 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
80 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
81 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
82 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
83 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
84 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
85 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
86 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
87 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
88 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
89 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
90 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
91 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
92 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
93 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
94 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
95 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
96 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
97 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
98 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
99 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
100 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
101 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
102 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
103 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
104 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
105 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
106 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
107 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
108 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
109 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
110 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
111 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
112 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
113 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
114 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
115 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
116 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
117 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
118 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
119 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
120 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
121 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
122 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
123 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
124 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
125 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
126 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
127 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
128 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
129 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
130 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
131 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
132 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
133 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
134 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
135 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
136 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
137 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
145 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
146 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
147 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
148 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
149 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
150 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
151 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
154 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
155 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
156 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
157 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
158 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
159 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
160 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
161 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
162 3300059622 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
163 3300059628 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 160R_AD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
164 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
165 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
166 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
167 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
168 2643221576 Nocardioides sp. Root614 Isolate Unclassified
169 2643221590 Nocardioides sp. Root682 Isolate Unclassified
170 2643221604 Nocardioides sp. Root190 Isolate Unclassified
171 2643221617 Nocardioides sp. Root79 Isolate Unclassified
172 2643221620 Nocardioides sp. Root240 Isolate Unclassified
173 2738541305 Nocardioides sp. CF167 Isolate Unclassified
174 2887443736 Ruania rhizosphaerae LNNU 22110 Isolate Rhizosphere
175 8057568493 Actinorhabdospora filicis NBRC 111898 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 77.43
Metatranscriptomes 20.47
Isolates 2.1

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.26
Nodule 0
Rhizoplane 6.3
Rhizosphere 90.29
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081455_10011671 3300005937 Bacteria 8812
2 JGI24735J21928_10025706 3300002067 Bacteria 1775
3 Ga0006762J43184_105303 3300002872 Bacteria 510
4 Ga0006778J45830_1007605 3300003162 Bacteria 1114
5 Ga0006759J45824_1004879 3300003163 Bacteria 516
6 Ga0007423J48922_100374 3300003285 Bacteria 6760
7 Ga0007423J48922_100376 3300003285 Bacteria 1670
8 Ga0007417J51691_1008088 3300003544 Bacteria 536
9 Ga0006781J51513_1002285 3300003568 Bacteria 622
10 Ga0006781J51513_1005428 3300003568 Bacteria 927
11 Ga0007410J51695_1004780 3300003574 Bacteria 1030
12 Ga0007409J51694_1003994 3300003575 Bacteria 736
13 Ga0007409J51694_1009882 3300003575 Bacteria 586
14 Ga0007429J51699_1002690 3300003579 Bacteria 722
15 Ga0007429J51699_1003968 3300003579 Bacteria 1400
16 Ga0007429J51699_1013313 3300003579 Bacteria 1345
17 Ga0007411J51799_105654 3300003611 Bacteria 749
18 Ga0032354_1024385 3300003693 Bacteria 521
19 Ga0032354_1024386 3300003693 Bacteria 784
20 Ga0006780_1008023 3300003735 Bacteria 711
21 JGI25405J52794_10068421 3300003911 Bacteria 773
22 Ga0058863_11429089 3300004799 Bacteria 602
23 Ga0070658_11299724 3300005327 Bacteria 632
24 Ga0070683_100628281 3300005329 Bacteria 1028
25 Ga0070683_100924035 3300005329 Bacteria 837
26 Ga0070682_100486956 3300005337 Bacteria 953
27 Ga0070682_100966054 3300005337 Bacteria 705
28 Ga0070675_100590344 3300005354 Bacteria 1007
29 Ga0070667_100011295 3300005367 Bacteria 7387
30 Ga0070714_100422414 3300005435 Bacteria 1263
31 Ga0070714_100721103 3300005435 Bacteria 963
32 Ga0070698_100214135 3300005471 Bacteria 1861
33 Ga0070665_100087273 3300005548 Bacteria 3125
34 Ga0070665_101390905 3300005548 Bacteria 711
35 Ga0068855_100020468 3300005563 Bacteria 7933
36 Ga0068855_100039916 3300005563 Bacteria 5572
37 Ga0068855_100613569 3300005563 Bacteria 1172
38 Ga0068855_101325517 3300005563 Bacteria 744
39 Ga0068857_102489816 3300005577 Bacteria 508
40 Ga0068854_100595957 3300005578 Bacteria 943
41 Ga0068854_101270120 3300005578 Bacteria 662
42 Ga0068856_100043020 3300005614 Bacteria 4444
43 Ga0068856_100415844 3300005614 Bacteria 1365
44 Ga0068856_100427814 3300005614 Bacteria 1344
45 Ga0068856_100989461 3300005614 Bacteria 859
46 Ga0068852_100558405 3300005616 Bacteria 1146
47 Ga0068852_101284159 3300005616 Bacteria 754
48 Ga0081540_1118717 3300005983 Bacteria 1102
49 Ga0105251_10341789 3300009011 Bacteria 682
50 Ga0105240_10161115 3300009093 Bacteria 2664
51 Ga0111539_10071140 3300009094 Bacteria 4105
52 Ga0105241_10584229 3300009174 Bacteria 1007
53 Ga0105237_10048362 3300009545 Bacteria 4275
54 Ga0105237_10321265 3300009545 Bacteria 1552
55 Ga0105237_10447419 3300009545 Bacteria 1298
56 Ga0105237_10800606 3300009545 Bacteria 949
57 Ga0105237_11696210 3300009545 Bacteria 639
58 Ga0105238_10532756 3300009551 Bacteria 1178
59 Ga0105238_10934456 3300009551 Bacteria 886
60 Ga0105249_10890391 3300009553 Bacteria 957
61 Ga0105239_11268597 3300010375 Bacteria 850
62 Ga0105246_11537142 3300011119 Bacteria 626
63 Ga0105246_11580080 3300011119 Bacteria 619
64 Ga0157317_1014673 3300012475 Bacteria 643
65 Ga0157325_1009982 3300012485 Bacteria 689
66 Ga0157315_1051867 3300012508 Bacteria 553
67 Ga0157316_1005311 3300012510 Bacteria 1013
68 Ga0157326_1008501 3300012513 Bacteria 1120
69 Ga0157369_10021199 3300013105 Bacteria 7266
70 Ga0157369_11191056 3300013105 Bacteria 778
71 Ga0157374_12646393 3300013296 Bacteria 529
72 Ga0163162_12525597 3300013306 Bacteria 591
73 Ga0157372_10462338 3300013307 Bacteria 1479
74 Ga0157372_10939381 3300013307 Bacteria 1003
75 Ga0157372_12645453 3300013307 Bacteria 576
76 Ga0157375_12740280 3300013308 Bacteria 589
77 Ga0197907_10164060 3300020069 Bacteria 769
78 Ga0197907_10350301 3300020069 Bacteria 1009
79 Ga0197907_11069839 3300020069 Bacteria 1246
80 Ga0197907_11094929 3300020069 Bacteria 679
81 Ga0197907_11276119 3300020069 Bacteria 540
82 Ga0197907_11498934 3300020069 Bacteria 708
83 Ga0206356_10096762 3300020070 Bacteria 903
84 Ga0206356_10693166 3300020070 Bacteria 505
85 Ga0206356_10851727 3300020070 Bacteria 568
86 Ga0206356_11484469 3300020070 Bacteria 566
87 Ga0206349_1769901 3300020075 Bacteria 612
88 Ga0206355_1073624 3300020076 Bacteria 619
89 Ga0206355_1095899 3300020076 Bacteria 757
90 Ga0206355_1363047 3300020076 Bacteria 572
91 Ga0206355_1372600 3300020076 Bacteria 972
92 Ga0206355_1446300 3300020076 Bacteria 553
93 Ga0206355_1592186 3300020076 Bacteria 529
94 Ga0206351_10789109 3300020077 Bacteria 558
95 Ga0206351_10789153 3300020077 Bacteria 946
96 Ga0206352_10484450 3300020078 Bacteria 636
97 Ga0206350_10292787 3300020080 Bacteria 1221
98 Ga0206350_10485803 3300020080 Bacteria 513
99 Ga0206350_10864987 3300020080 Bacteria 617
100 Ga0206350_11301757 3300020080 Bacteria 904
101 Ga0206350_11611108 3300020080 Bacteria 1180
102 Ga0206354_10420992 3300020081 Bacteria 662
103 Ga0206354_10695802 3300020081 Bacteria 673
104 Ga0206354_11306709 3300020081 Bacteria 714
105 Ga0206354_11441299 3300020081 Bacteria 806
106 Ga0206353_10276441 3300020082 Bacteria 1466
107 Ga0206353_11575880 3300020082 Bacteria 1416
108 Ga0206353_11873301 3300020082 Bacteria 787
109 Ga0154015_1236769 3300020610 Bacteria 579
110 Ga0154015_1252462 3300020610 Bacteria 534
111 Ga0154015_1464150 3300020610 Bacteria 969
112 Ga0154015_1661652 3300020610 Bacteria 602
113 Ga0224712_10045343 3300022467 Bacteria 1682
114 Ga0224712_10057767 3300022467 Bacteria 1534
115 Ga0224712_10061076 3300022467 Bacteria 1502
116 Ga0224712_10095503 3300022467 Bacteria 1252
117 Ga0224712_10204273 3300022467 Bacteria 899
118 Ga0224712_10222647 3300022467 Bacteria 864
119 Ga0224712_10233917 3300022467 Bacteria 844
120 Ga0224712_10571087 3300022467 Bacteria 551
121 Ga0224712_10586344 3300022467 Bacteria 544
122 Ga0224712_10615406 3300022467 Bacteria 531
123 Ga0207692_10598490 3300025898 Bacteria 709
124 Ga0207647_10044433 3300025904 Bacteria 2776
125 Ga0207654_10154112 3300025911 Bacteria 1478
126 Ga0207695_10173408 3300025913 Bacteria 2081
127 Ga0207695_10244336 3300025913 Bacteria 1695
128 Ga0207671_10037771 3300025914 Bacteria 3580
129 Ga0207671_10271838 3300025914 Bacteria 1335
130 Ga0207671_10280612 3300025914 Bacteria 1314
131 Ga0207671_10396424 3300025914 Bacteria 1097
132 Ga0207663_10896370 3300025916 Bacteria 709
133 Ga0207657_10863901 3300025919 Bacteria 698
134 Ga0207694_10090212 3300025924 Bacteria 2418
135 Ga0207694_10776680 3300025924 Bacteria 809
136 Ga0207694_10876534 3300025924 Bacteria 759
137 Ga0207664_11064215 3300025929 Bacteria 724
138 Ga0207667_10015419 3300025949 Bacteria 8684
139 Ga0207667_10031632 3300025949 Bacteria 5710
140 Ga0207667_10155400 3300025949 Bacteria 2354
141 Ga0207667_11418270 3300025949 Bacteria 668
142 Ga0207640_11949780 3300025981 Bacteria 532
143 Ga0207658_10167950 3300025986 Bacteria 1804
144 Ga0207702_10030305 3300026078 Bacteria 4508
145 Ga0207702_10089596 3300026078 Bacteria 2690
146 Ga0207702_10704339 3300026078 Bacteria 995
147 Ga0207702_10858399 3300026078 Bacteria 899
148 Ga0207702_11892599 3300026078 Bacteria 588
149 Ga0207698_10139036 3300026142 Bacteria 2089
150 Ga0207698_10470306 3300026142 Bacteria 1217
151 Ga0207428_11188239 3300027907 Bacteria 531
152 Ga0268266_11046712 3300028379 Bacteria 790
153 Ga0268266_11123799 3300028379 Bacteria 760
154 Ga0268266_11307479 3300028379 Bacteria 700
155 Ga0268266_12111351 3300028379 Bacteria 536
156 Ga0307410_10648184 3300031852 Bacteria 886
157 Ga0307407_10100098 3300031903 Bacteria 1797
158 Ga0307407_10552495 3300031903 Bacteria 851
159 Ga0373927_0091262 3300035695 Bacteria 1978
160 Ga0373937_1399567 3300036401 Bacteria 647
161 Ga0395898_1885058 3300037466 Bacteria 518
162 Ga0436365_0525519 3300039437 Bacteria 506
163 Ga0439461_0058646 3300041410 Bacteria 870
164 Ga0466969_0081879 3300044656 Bacteria 1539
165 Ga0466969_0200160 3300044656 Bacteria 911
166 Ga0466969_0299006 3300044656 Bacteria 728
167 Ga0466972_0205586 3300044658 Bacteria 922
168 Ga0466972_0210682 3300044658 Bacteria 909
169 Ga0466972_0276048 3300044658 Bacteria 785
170 Ga0466972_0297617 3300044658 Bacteria 754
171 Ga0466972_0340834 3300044658 Bacteria 701
172 Ga0466965_0245833 3300044683 Bacteria 959
173 Ga0466965_0302369 3300044683 Bacteria 868
174 Ga0466965_0396753 3300044683 Bacteria 762
175 Ga0466966_0007632 3300044684 Bacteria 7167
176 Ga0466966_0009231 3300044684 Bacteria 6532
177 Ga0466966_0028376 3300044684 Bacteria 3646
178 Ga0466966_0030655 3300044684 Bacteria 3489
179 Ga0466966_0107349 3300044684 Bacteria 1723
180 Ga0466966_0301856 3300044684 Bacteria 962
181 Ga0466966_0471622 3300044684 Bacteria 755
182 Ga0466966_0545465 3300044684 Bacteria 698
183 Ga0466966_0919217 3300044684 Bacteria 528
184 Ga0466961_0004435 3300044693 Bacteria 8790
185 Ga0466961_0012480 3300044693 Bacteria 5437
186 Ga0466961_0013609 3300044693 Bacteria 5211
187 Ga0466961_0017095 3300044693 Bacteria 4658
188 Ga0466961_0019382 3300044693 Bacteria 4375
189 Ga0466961_0083618 3300044693 Bacteria 2019
190 Ga0466961_0169532 3300044693 Bacteria 1358
191 Ga0466961_0349934 3300044693 Bacteria 899
192 Ga0466961_0690386 3300044693 Bacteria 612
193 Ga0466961_0764021 3300044693 Bacteria 578
194 Ga0466963_0001683 3300044694 Bacteria 12044
195 Ga0466963_0003953 3300044694 Bacteria 8574
196 Ga0466963_0004525 3300044694 Bacteria 8096
197 Ga0466963_0007960 3300044694 Bacteria 6345
198 Ga0466963_0029014 3300044694 Bacteria 3558
199 Ga0466963_0029888 3300044694 Bacteria 3510
200 Ga0466963_0071297 3300044694 Bacteria 2338
201 Ga0466963_0099964 3300044694 Bacteria 1985
202 Ga0466963_0139277 3300044694 Bacteria 1680
203 Ga0466963_0172445 3300044694 Bacteria 1508
204 Ga0466963_0268294 3300044694 Bacteria 1199
205 Ga0466963_0319803 3300044694 Bacteria 1092
206 Ga0466963_0395869 3300044694 Bacteria 974
207 Ga0466963_0651297 3300044694 Bacteria 744
208 Ga0466963_0747667 3300044694 Bacteria 690
209 Ga0466963_0849141 3300044694 Bacteria 644
210 Ga0466964_0006515 3300044706 Bacteria 4353
211 Ga0466964_0023536 3300044706 Bacteria 2395
212 Ga0466964_0055035 3300044706 Bacteria 1642
213 Ga0466964_0224956 3300044706 Bacteria 913
214 Ga0466964_0374945 3300044706 Bacteria 737
215 Ga0466964_0382443 3300044706 Bacteria 731
216 Ga0466964_0838099 3300044706 Bacteria 522
217 Ga0466971_0026875 3300044719 Bacteria 2575
218 Ga0466971_0031487 3300044719 Bacteria 2375
219 Ga0466971_0038531 3300044719 Bacteria 2145
220 Ga0466971_0072884 3300044719 Bacteria 1560
221 Ga0466971_0101880 3300044719 Bacteria 1320
222 Ga0466971_0215945 3300044719 Bacteria 908
223 Ga0466968_0032114 3300044735 Bacteria 2182
224 Ga0466968_0070348 3300044735 Bacteria 1522
225 Ga0466968_0151939 3300044735 Bacteria 1065
226 Ga0466968_0433007 3300044735 Bacteria 648
227 Ga0466970_0006170 3300044765 Bacteria 5973
228 Ga0466970_0134310 3300044765 Bacteria 1360
229 Ga0466957_0004410 3300044842 Bacteria 7834
230 Ga0466957_0010403 3300044842 Bacteria 5339
231 Ga0466957_0016096 3300044842 Bacteria 4370
232 Ga0466957_0029587 3300044842 Bacteria 3267
233 Ga0466957_0033140 3300044842 Bacteria 3098
234 Ga0466957_0064635 3300044842 Bacteria 2251
235 Ga0466957_0192326 3300044842 Bacteria 1337
236 Ga0466957_0325861 3300044842 Bacteria 1037
237 Ga0466957_0456359 3300044842 Bacteria 881
238 Ga0466957_0627475 3300044842 Bacteria 754
239 Ga0466957_0866399 3300044842 Bacteria 644
240 Ga0466960_0013434 3300044901 Bacteria 3479
241 Ga0466960_0166553 3300044901 Bacteria 1187
242 Ga0466960_0828137 3300044901 Bacteria 561
243 Ga0466959_0048422 3300045049 Bacteria 3123
244 Ga0466959_0064312 3300045049 Bacteria 2663
245 Ga0466959_0153339 3300045049 Bacteria 1623
246 Ga0466959_0260106 3300045049 Bacteria 1195
247 Ga0466959_0348749 3300045049 Bacteria 1009
248 Ga0466959_0446256 3300045049 Bacteria 877
249 Ga0466959_0699226 3300045049 Bacteria 679
250 Ga0466959_0817772 3300045049 Bacteria 623
251 Ga0466959_0921815 3300045049 Bacteria 583
252 Ga0466958_0011580 3300045836 Bacteria 4970
253 Ga0466958_0012758 3300045836 Bacteria 4765
254 Ga0466958_0053942 3300045836 Bacteria 2437
255 Ga0466958_0079035 3300045836 Bacteria 2022
256 Ga0466958_0091159 3300045836 Bacteria 1886
257 Ga0466958_0134550 3300045836 Bacteria 1554
258 Ga0466958_0376744 3300045836 Bacteria 915
259 Ga0466958_0405889 3300045836 Bacteria 880
260 Ga0466958_0587868 3300045836 Bacteria 724
261 Ga0466958_0682866 3300045836 Bacteria 669
262 Ga0466958_0762429 3300045836 Bacteria 631
263 Ga0466958_0938666 3300045836 Bacteria 564
264 Ga0466958_1064603 3300045836 Bacteria 528
265 Ga0466967_0000715 3300045976 Bacteria 16927
266 Ga0466967_0001724 3300045976 Bacteria 13033
267 Ga0466967_0002023 3300045976 Bacteria 12370
268 Ga0466967_0006140 3300045976 Bacteria 8456
269 Ga0466967_0009611 3300045976 Bacteria 7188
270 Ga0466967_0011786 3300045976 Bacteria 6648
271 Ga0466967_0016315 3300045976 Bacteria 5853
272 Ga0466967_0017569 3300045976 Bacteria 5685
273 Ga0466967_0025279 3300045976 Bacteria 4895
274 Ga0466967_0050660 3300045976 Bacteria 3636
275 Ga0466967_0103502 3300045976 Bacteria 2605
276 Ga0466967_0166033 3300045976 Bacteria 2075
277 Ga0466967_0171608 3300045976 Bacteria 2041
278 Ga0466967_0173726 3300045976 Bacteria 2029
279 Ga0466967_0263462 3300045976 Bacteria 1650
280 Ga0466967_0443219 3300045976 Bacteria 1268
281 Ga0466967_0585140 3300045976 Bacteria 1101
282 Ga0466967_1495857 3300045976 Bacteria 672
283 Ga0466967_1584592 3300045976 Bacteria 652
284 Ga0466967_1789670 3300045976 Bacteria 611
285 Ga0495603_0001203 3300046455 Bacteria 15116
286 Ga0495603_0012342 3300046455 Bacteria 5171
287 Ga0495603_0809794 3300046455 Bacteria 534
288 Ga0495629_0003557 3300046459 Bacteria 11767
289 Ga0495629_0207004 3300046459 Bacteria 1355
290 Ga0495638_0300956 3300046460 Bacteria 864
291 Ga0495585_0045611 3300046492 Bacteria 2446
292 Ga0495594_0000476 3300046499 Bacteria 20416
293 Ga0495607_0301965 3300046501 Bacteria 753
294 Ga0495620_0194624 3300046515 Bacteria 781
295 Ga0495622_0183037 3300046557 Bacteria 939
296 Ga0495611_0072270 3300046648 Bacteria 1578
297 Ga0495669_0004276 3300046684 Bacteria 5891
298 Ga0495613_0000812 3300046689 Bacteria 24196
299 Ga0495676_0003047 3300047321 Bacteria 15156
300 Ga0495676_0005359 3300047321 Bacteria 11746
301 Ga0495593_0279709 3300047673 Bacteria 834
302 Ga0495614_0002454 3300048089 Bacteria 8240
303 Ga0496100_0501829 3300048903 Bacteria 935
304 Ga0496101_1274954 3300048904 Bacteria 575
305 Ga0496102_0086522 3300048905 Bacteria 2895
306 Ga0496104_0043892 3300048907 Bacteria 4200
307 Ga0496104_0168988 3300048907 Bacteria 2097
308 Ga0496105_0336288 3300048908 Bacteria 1208
309 Ga0496105_0727941 3300048908 Bacteria 759
310 Ga0496105_0757270 3300048908 Bacteria 741
311 Ga0496106_0045075 3300048909 Bacteria 3312
312 Ga0496107_0233153 3300048910 Bacteria 1370
313 Ga0496108_0013749 3300048911 Bacteria 6603
314 Ga0496108_0046172 3300048911 Bacteria 3639
315 Ga0496108_0067069 3300048911 Bacteria 3027
316 Ga0496109_0017934 3300048912 Bacteria 6214
317 Ga0496109_0114162 3300048912 Bacteria 2513
318 Ga0496110_0021638 3300048913 Bacteria 5449
319 Ga0496110_0109732 3300048913 Bacteria 2478
320 Ga0496110_0323709 3300048913 Bacteria 1404
321 Ga0496110_1188711 3300048913 Bacteria 671
322 Ga0496111_0471397 3300048914 Bacteria 925
323 Ga0496113_0248651 3300048916 Bacteria 1419
324 Ga0496113_1537951 3300048916 Bacteria 513
325 Ga0496114_0038277 3300048917 Bacteria 3968
326 Ga0496115_0194264 3300048918 Bacteria 1677
327 Ga0496118_0098527 3300048921 Bacteria 1985
328 Ga0496119_0000022 3300048922 Bacteria 269878
329 Ga0496120_0001243 3300048923 Bacteria 32177
330 Ga0496124_0196301 3300048927 Bacteria 1539
331 Ga0496126_0119506 3300048929 Bacteria 2287
332 Ga0501317_035039 3300049533 Bacteria 745
333 Ga0501318_056815 3300049534 Bacteria 593
334 Ga0501321_050445 3300049537 Bacteria 607
335 Ga0501032_0216103 3300049569 Bacteria 1249
336 Ga0501033_0059392 3300049570 Bacteria 2824
337 Ga0501034_0049602 3300049571 Bacteria 4236
338 Ga0501036_0039383 3300049572 Bacteria 3999
339 Ga0501036_0163495 3300049572 Bacteria 1876
340 Ga0501038_0370178 3300049574 Bacteria 1113
341 Ga0501038_0465536 3300049574 Bacteria 970
342 Ga0501039_0073503 3300049575 Bacteria 2656
343 Ga0501040_0133602 3300049576 Bacteria 1746
344 Ga0501042_0065015 3300049578 Bacteria 2607
345 Ga0501047_0167564 3300049581 Bacteria 2067
346 Ga0501072_0207994 3300049588 Bacteria 1560
347 Ga0501074_0157953 3300049590 Bacteria 1619
348 Ga0501075_0530455 3300049591 Bacteria 898
349 Ga0501076_0205596 3300049592 Bacteria 1608
350 Ga0501077_0661917 3300049593 Bacteria 671
351 Ga0501079_1627008 3300049741 Bacteria 508
352 Ga0501080_0212658 3300049742 Bacteria 1772
353 Ga0501035_1008732 3300049822 Bacteria 654
354 Ga0501044_0176366 3300049823 Bacteria 2106
355 Ga0501045_0230073 3300049824 Bacteria 1380
356 nmdc:mga08y16_1507381_c1 3300050511 Bacteria 633
357 Ga0500636_0084026 3300053177 Bacteria 1831
358 Ga0590071_190317 3300059421 Bacteria 539
359 Ga0587093_104928 3300059478 Bacteria 514
360 Ga0587066_088152 3300059490 Bacteria 684
361 Ga0587091_055312 3300059511 Bacteria 827
362 Ga0587092_072855 3300059512 Bacteria 664
363 Ga0587106_111106 3300059605 Bacteria 571
364 Ga0587099_061355 3300059622 Bacteria 519
365 Ga0587122_007635 3300059628 Bacteria 963
366 Ga0587128_032193 3300059630 Bacteria 875
367 Ga0587075_140011 3300059644 Bacteria 516
368 Ga0587114_017267 3300059655 Bacteria 977
369 Ga0466962_0003869 3300061719 Bacteria 7152
370 Ga0466962_0033593 3300061719 Bacteria 2455
371 Ga0466962_0046369 3300061719 Bacteria 2077
372 Ga0466962_0452216 3300061719 Bacteria 647
373 Ga0466962_0752353 3300061719 Bacteria 501
374 2643891074 2643221576 Bacteria 5214352
375 2643960130 2643221590 Bacteria 5214697
376 2644035073 2643221604 Bacteria 5014917
377 2644101252 2643221617 Bacteria 5139111
378 2644119342 2643221620 Bacteria 5134593
379 2738868819 2738541305 Bacteria 4910150
380 2887445225 2887443736 Bacteria 4426037
381 8057574444 8057568493 Bacteria 7221719
382 Ga0081455_10011671
383 JGI24735J21928_10025706
384 Ga0006762J43184_105303
385 Ga0006778J45830_1007605
386 Ga0006759J45824_1004879
387 Ga0007423J48922_100374
388 Ga0007423J48922_100376
389 Ga0007417J51691_1008088
390 Ga0006781J51513_1002285
391 Ga0006781J51513_1005428
392 Ga0007410J51695_1004780
393 Ga0007409J51694_1003994
394 Ga0007409J51694_1009882
395 Ga0007429J51699_1002690
396 Ga0007429J51699_1003968
397 Ga0007429J51699_1013313
398 Ga0007411J51799_105654
399 Ga0032354_1024385
400 Ga0032354_1024386
401 Ga0006780_1008023
402 JGI25405J52794_10068421
403 Ga0058863_11429089
404 Ga0070658_11299724
405 Ga0070683_100628281
406 Ga0070683_100924035
407 Ga0070682_100486956
408 Ga0070682_100966054
409 Ga0070675_100590344
410 Ga0070667_100011295
411 Ga0070714_100422414
412 Ga0070714_100721103
413 Ga0070698_100214135
414 Ga0070665_100087273
415 Ga0070665_101390905
416 Ga0068855_100020468
417 Ga0068855_100039916
418 Ga0068855_100613569
419 Ga0068855_101325517
420 Ga0068857_102489816
421 Ga0068854_100595957
422 Ga0068854_101270120
423 Ga0068856_100043020
424 Ga0068856_100415844
425 Ga0068856_100427814
426 Ga0068856_100989461
427 Ga0068852_100558405
428 Ga0068852_101284159
429 Ga0081540_1118717
430 Ga0105251_10341789
431 Ga0105240_10161115
432 Ga0111539_10071140
433 Ga0105241_10584229
434 Ga0105237_10048362
435 Ga0105237_10321265
436 Ga0105237_10447419
437 Ga0105237_10800606
438 Ga0105237_11696210
439 Ga0105238_10532756
440 Ga0105238_10934456
441 Ga0105249_10890391
442 Ga0105239_11268597
443 Ga0105246_11537142
444 Ga0105246_11580080
445 Ga0157317_1014673
446 Ga0157325_1009982
447 Ga0157315_1051867
448 Ga0157316_1005311
449 Ga0157326_1008501
450 Ga0157369_10021199
451 Ga0157369_11191056
452 Ga0157374_12646393
453 Ga0163162_12525597
454 Ga0157372_10462338
455 Ga0157372_10939381
456 Ga0157372_12645453
457 Ga0157375_12740280
458 Ga0197907_10164060
459 Ga0197907_10350301
460 Ga0197907_11069839
461 Ga0197907_11094929
462 Ga0197907_11276119
463 Ga0197907_11498934
464 Ga0206356_10096762
465 Ga0206356_10693166
466 Ga0206356_10851727
467 Ga0206356_11484469
468 Ga0206349_1769901
469 Ga0206355_1073624
470 Ga0206355_1095899
471 Ga0206355_1363047
472 Ga0206355_1372600
473 Ga0206355_1446300
474 Ga0206355_1592186
475 Ga0206351_10789109
476 Ga0206351_10789153
477 Ga0206352_10484450
478 Ga0206350_10292787
479 Ga0206350_10485803
480 Ga0206350_10864987
481 Ga0206350_11301757
482 Ga0206350_11611108
483 Ga0206354_10420992
484 Ga0206354_10695802
485 Ga0206354_11306709
486 Ga0206354_11441299
487 Ga0206353_10276441
488 Ga0206353_11575880
489 Ga0206353_11873301
490 Ga0154015_1236769
491 Ga0154015_1252462
492 Ga0154015_1464150
493 Ga0154015_1661652
494 Ga0224712_10045343
495 Ga0224712_10057767
496 Ga0224712_10061076
497 Ga0224712_10095503
498 Ga0224712_10204273
499 Ga0224712_10222647
500 Ga0224712_10233917
501 Ga0224712_10571087
502 Ga0224712_10586344
503 Ga0224712_10615406
504 Ga0207692_10598490
505 Ga0207647_10044433
506 Ga0207654_10154112
507 Ga0207695_10173408
508 Ga0207695_10244336
509 Ga0207671_10037771
510 Ga0207671_10271838
511 Ga0207671_10280612
512 Ga0207671_10396424
513 Ga0207663_10896370
514 Ga0207657_10863901
515 Ga0207694_10090212
516 Ga0207694_10776680
517 Ga0207694_10876534
518 Ga0207664_11064215
519 Ga0207667_10015419
520 Ga0207667_10031632
521 Ga0207667_10155400
522 Ga0207667_11418270
523 Ga0207640_11949780
524 Ga0207658_10167950
525 Ga0207702_10030305
526 Ga0207702_10089596
527 Ga0207702_10704339
528 Ga0207702_10858399
529 Ga0207702_11892599
530 Ga0207698_10139036
531 Ga0207698_10470306
532 Ga0207428_11188239
533 Ga0268266_11046712
534 Ga0268266_11123799
535 Ga0268266_11307479
536 Ga0268266_12111351
537 Ga0307410_10648184
538 Ga0307407_10100098
539 Ga0307407_10552495
540 Ga0373927_0091262
541 Ga0373937_1399567
542 Ga0395898_1885058
543 Ga0436365_0525519
544 Ga0439461_0058646
545 Ga0466969_0081879
546 Ga0466969_0200160
547 Ga0466969_0299006
548 Ga0466972_0205586
549 Ga0466972_0210682
550 Ga0466972_0276048
551 Ga0466972_0297617
552 Ga0466972_0340834
553 Ga0466965_0245833
554 Ga0466965_0302369
555 Ga0466965_0396753
556 Ga0466966_0007632
557 Ga0466966_0009231
558 Ga0466966_0028376
559 Ga0466966_0030655
560 Ga0466966_0107349
561 Ga0466966_0301856
562 Ga0466966_0471622
563 Ga0466966_0545465
564 Ga0466966_0919217
565 Ga0466961_0004435
566 Ga0466961_0012480
567 Ga0466961_0013609
568 Ga0466961_0017095
569 Ga0466961_0019382
570 Ga0466961_0083618
571 Ga0466961_0169532
572 Ga0466961_0349934
573 Ga0466961_0690386
574 Ga0466961_0764021
575 Ga0466963_0001683
576 Ga0466963_0003953
577 Ga0466963_0004525
578 Ga0466963_0007960
579 Ga0466963_0029014
580 Ga0466963_0029888
581 Ga0466963_0071297
582 Ga0466963_0099964
583 Ga0466963_0139277
584 Ga0466963_0172445
585 Ga0466963_0268294
586 Ga0466963_0319803
587 Ga0466963_0395869
588 Ga0466963_0651297
589 Ga0466963_0747667
590 Ga0466963_0849141
591 Ga0466964_0006515
592 Ga0466964_0023536
593 Ga0466964_0055035
594 Ga0466964_0224956
595 Ga0466964_0374945
596 Ga0466964_0382443
597 Ga0466964_0838099
598 Ga0466971_0026875
599 Ga0466971_0031487
600 Ga0466971_0038531
601 Ga0466971_0072884
602 Ga0466971_0101880
603 Ga0466971_0215945
604 Ga0466968_0032114
605 Ga0466968_0070348
606 Ga0466968_0151939
607 Ga0466968_0433007
608 Ga0466970_0006170
609 Ga0466970_0134310
610 Ga0466957_0004410
611 Ga0466957_0010403
612 Ga0466957_0016096
613 Ga0466957_0029587
614 Ga0466957_0033140
615 Ga0466957_0064635
616 Ga0466957_0192326
617 Ga0466957_0325861
618 Ga0466957_0456359
619 Ga0466957_0627475
620 Ga0466957_0866399
621 Ga0466960_0013434
622 Ga0466960_0166553
623 Ga0466960_0828137
624 Ga0466959_0048422
625 Ga0466959_0064312
626 Ga0466959_0153339
627 Ga0466959_0260106
628 Ga0466959_0348749
629 Ga0466959_0446256
630 Ga0466959_0699226
631 Ga0466959_0817772
632 Ga0466959_0921815
633 Ga0466958_0011580
634 Ga0466958_0012758
635 Ga0466958_0053942
636 Ga0466958_0079035
637 Ga0466958_0091159
638 Ga0466958_0134550
639 Ga0466958_0376744
640 Ga0466958_0405889
641 Ga0466958_0587868
642 Ga0466958_0682866
643 Ga0466958_0762429
644 Ga0466958_0938666
645 Ga0466958_1064603
646 Ga0466967_0000715
647 Ga0466967_0001724
648 Ga0466967_0002023
649 Ga0466967_0006140
650 Ga0466967_0009611
651 Ga0466967_0011786
652 Ga0466967_0016315
653 Ga0466967_0017569
654 Ga0466967_0025279
655 Ga0466967_0050660
656 Ga0466967_0103502
657 Ga0466967_0166033
658 Ga0466967_0171608
659 Ga0466967_0173726
660 Ga0466967_0263462
661 Ga0466967_0443219
662 Ga0466967_0585140
663 Ga0466967_1495857
664 Ga0466967_1584592
665 Ga0466967_1789670
666 Ga0495603_0001203
667 Ga0495603_0012342
668 Ga0495603_0809794
669 Ga0495629_0003557
670 Ga0495629_0207004
671 Ga0495638_0300956
672 Ga0495585_0045611
673 Ga0495594_0000476
674 Ga0495607_0301965
675 Ga0495620_0194624
676 Ga0495622_0183037
677 Ga0495611_0072270
678 Ga0495669_0004276
679 Ga0495613_0000812
680 Ga0495676_0003047
681 Ga0495676_0005359
682 Ga0495593_0279709
683 Ga0495614_0002454
684 Ga0496100_0501829
685 Ga0496101_1274954
686 Ga0496102_0086522
687 Ga0496104_0043892
688 Ga0496104_0168988
689 Ga0496105_0336288
690 Ga0496105_0727941
691 Ga0496105_0757270
692 Ga0496106_0045075
693 Ga0496107_0233153
694 Ga0496108_0013749
695 Ga0496108_0046172
696 Ga0496108_0067069
697 Ga0496109_0017934
698 Ga0496109_0114162
699 Ga0496110_0021638
700 Ga0496110_0109732
701 Ga0496110_0323709
702 Ga0496110_1188711
703 Ga0496111_0471397
704 Ga0496113_0248651
705 Ga0496113_1537951
706 Ga0496114_0038277
707 Ga0496115_0194264
708 Ga0496118_0098527
709 Ga0496119_0000022
710 Ga0496120_0001243
711 Ga0496124_0196301
712 Ga0496126_0119506
713 Ga0501317_035039
714 Ga0501318_056815
715 Ga0501321_050445
716 Ga0501032_0216103
717 Ga0501033_0059392
718 Ga0501034_0049602
719 Ga0501036_0039383
720 Ga0501036_0163495
721 Ga0501038_0370178
722 Ga0501038_0465536
723 Ga0501039_0073503
724 Ga0501040_0133602
725 Ga0501042_0065015
726 Ga0501047_0167564
727 Ga0501072_0207994
728 Ga0501074_0157953
729 Ga0501075_0530455
730 Ga0501076_0205596
731 Ga0501077_0661917
732 Ga0501079_1627008
733 Ga0501080_0212658
734 Ga0501035_1008732
735 Ga0501044_0176366
736 Ga0501045_0230073
737 nmdc:mga08y16_1507381_c1
738 Ga0500636_0084026
739 Ga0590071_190317
740 Ga0587093_104928
741 Ga0587066_088152
742 Ga0587091_055312
743 Ga0587092_072855
744 Ga0587106_111106
745 Ga0587099_061355
746 Ga0587122_007635
747 Ga0587128_032193
748 Ga0587075_140011
749 Ga0587114_017267
750 Ga0466962_0003869
751 Ga0466962_0033593
752 Ga0466962_0046369
753 Ga0466962_0452216
754 Ga0466962_0752353
755 2643891074
756 2643960130
757 2644035073
758 2644101252
759 2644119342
760 2738868819
761 2887445225
762 8057574444

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00085

Thioredoxin

Thioredoxin

4

105

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2i1u-assembly1.cif.gz_A mycobacterium tuberculosis thioredoxin c 0.9915 4 103
3nof-assembly1.cif.gz_A mycobacterium tuberculosis thioredoxin c c40s mutant 0.9883 4 107
5hr1-assembly7.cif.gz_G crystal structure of thioredoxin l107a mutant 0.9873 28 103
4pob-assembly1.cif.gz_B crystal structure of a thioredoxin rv1471 ortholog from mycobacterium abscessus 0.9871 3 107
4wxt-assembly1.cif.gz_A x-ray crystal structure of thioredoxin from mycobacterium avium 0.9864 3 103
ID Description Score Start End Superfamily
5hr1G00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9873 28 103 3.40.30.10
af_Q9SEU7_68_173_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9758 4 106 3.40.30.10
4ulxA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9748 3 107 3.40.30.10
5hr1G00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9746 28 103 3.40.30.10
4ulxA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9657 3 107 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A7W3JUB2-F1-model_v4 Thioredoxin 1.005 4 106 GO:0005829
GO:0015035
GO:0045454
AF-A0A2K8PIR8-F1-model_v4 Thioredoxin 1.004 3 107 GO:0005829
GO:0015035
GO:0045454
AF-A0A0M8V7W5-F1-model_v4 Thioredoxin 1.004 4 107 GO:0005829
GO:0015035
GO:0045454
AF-A0A0M8UXE3-F1-model_v4 Thioredoxin 1.004 4 106 GO:0005829
GO:0015035
GO:0045454
AF-A0A3N0E5Y9-F1-model_v4 Thioredoxin 1.004 4 106 GO:0005829
GO:0015035
GO:0045454

Map