F428915

General Info

Members Datasets Scaffolds Average Seq Length
381 179 762 271

Family's Representative Sequence

Representative Sequence 3300005549|Ga0070704_100191737|Ga0070704_1001917371
Length 301
Sequence MLNARCTTLQYSIRRRGSRIGRAEAAVSGIEHLALSIVPFFSPRPQVFAHRGGCDLGPENTIAAFDIGMSTGADGLELDVHLSADNVLVVHHDRTLDRTTDATGPVAARTADELARVDAGYRFARGGDFPFRGRGIGVPTLREVLARYRGVPTIIEIKVYTPAMGRAVAEEIRRAGAIDSACVAGYGLASATAARAELPGVAASAAQPEVRLAVYRSWLRWPVRRAAYHTYQVPERAEATRIVSRRFIRDAHAAGLKVQVWTVDEEADMRRLLEWGVDGLISNRPDTAVRVRDEFLATRGA

Samples

Sample ID Description Type Environment
1 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
50 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
51 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
52 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
53 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
54 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
58 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
69 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
70 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
71 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
72 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
73 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
74 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
75 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
105 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
109 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
110 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
111 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
112 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
113 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
114 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
115 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
116 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
117 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
118 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
119 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
120 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
121 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
122 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
123 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
124 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
125 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
126 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
127 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
128 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
129 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
130 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
131 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
132 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
133 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
134 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
135 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
136 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
137 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
138 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
139 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
154 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
155 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
156 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
157 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
158 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
159 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
160 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
161 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
162 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
163 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
164 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
165 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
166 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
167 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
170 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
171 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
172 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
173 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
174 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
175 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
176 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
177 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
178 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
179 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.26
Nodule 0
Rhizoplane 0.79
Rhizosphere 98.69
Stem 0
Stem Tuber 0
Unclassified 6.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070704_100191737 3300005549 Bacteria 1643
2 Ga0065712_10197701 3300005290 Bacteria 1121
3 Ga0065715_10250171 3300005293 Bacteria 1170
4 Ga0065707_10007202 3300005295 Bacteria 3544
5 Ga0065707_10088685 3300005295 Bacteria 4580
6 Ga0070676_10031373 3300005328 Bacteria 3036
7 Ga0070690_100037653 3300005330 Bacteria 3050
8 Ga0070670_100010713 3300005331 Bacteria 7834
9 Ga0070670_100072452 3300005331 Bacteria 2958
10 Ga0070677_10124770 3300005333 Bacteria 1167
11 Ga0068869_100000553 3300005334 Bacteria 20938
12 Ga0070666_10158844 3300005335 Bacteria 1580
13 Ga0070680_100130519 3300005336 Bacteria 2102
14 Ga0070680_100286543 3300005336 Bacteria 1396
15 Ga0070689_100066820 3300005340 Bacteria 2801
16 Ga0070687_100004456 3300005343 Bacteria 5587
17 Ga0070687_100076784 3300005343 Bacteria 1810
18 Ga0070687_100087164 3300005343 Unclassified 1718
19 Ga0070687_100118127 3300005343 Bacteria 1512
20 Ga0070692_10085342 3300005345 Bacteria 1708
21 Ga0070692_10091267 3300005345 Unclassified 1656
22 Ga0070669_100103195 3300005353 Bacteria 2154
23 Ga0070669_100129606 3300005353 Bacteria 1933
24 Ga0070669_100248518 3300005353 Unclassified 1416
25 Ga0070675_100001400 3300005354 Bacteria 17695
26 Ga0070675_100002390 3300005354 Bacteria 13982
27 Ga0070675_100004078 3300005354 Bacteria 11088
28 Ga0070675_100010187 3300005354 Bacteria 7333
29 Ga0070675_100060205 3300005354 Bacteria 3135
30 Ga0070675_100154364 3300005354 Bacteria 1970
31 Ga0070675_100278930 3300005354 Bacteria 1468
32 Ga0070675_100301552 3300005354 Bacteria 1412
33 Ga0070671_100013191 3300005355 Bacteria 6656
34 Ga0070671_100221462 3300005355 Bacteria 1605
35 Ga0070673_100014428 3300005364 Bacteria 5504
36 Ga0070673_100045639 3300005364 Unclassified 3399
37 Ga0070673_100080441 3300005364 Unclassified 2640
38 Ga0070673_100204906 3300005364 Bacteria 1700
39 Ga0070673_100301000 3300005364 Bacteria 1412
40 Ga0070667_100231811 3300005367 Bacteria 1646
41 Ga0070701_10017823 3300005438 Bacteria 3326
42 Ga0070701_10025467 3300005438 Bacteria 2873
43 Ga0070705_100002096 3300005440 Bacteria 10159
44 Ga0070705_100085973 3300005440 Bacteria 1946
45 Ga0070705_100212360 3300005440 Bacteria 1335
46 Ga0070700_100003861 3300005441 Bacteria 7775
47 Ga0070700_100156807 3300005441 Bacteria 1563
48 Ga0070700_100533581 3300005441 Bacteria 909
49 Ga0070694_100001141 3300005444 Bacteria 15231
50 Ga0070694_100271816 3300005444 Bacteria 1289
51 Ga0070678_100195872 3300005456 Bacteria 1664
52 Ga0070662_100023028 3300005457 Bacteria 4274
53 Ga0070681_10078750 3300005458 Bacteria 3252
54 Ga0070681_10387026 3300005458 Unclassified 1309
55 Ga0068867_100008035 3300005459 Bacteria 7455
56 Ga0068867_100056077 3300005459 Bacteria 2914
57 Ga0070685_10002713 3300005466 Bacteria 9067
58 Ga0070685_10012816 3300005466 Bacteria 4410
59 Ga0070707_100175387 3300005468 Bacteria 2089
60 Ga0070707_100341369 3300005468 Bacteria 1455
61 Ga0070699_100029895 3300005518 Bacteria 4699
62 Ga0070697_100156038 3300005536 Bacteria 1926
63 Ga0068853_100089093 3300005539 Bacteria 2710
64 Ga0070672_100014205 3300005543 Bacteria 5636
65 Ga0070672_100014440 3300005543 Bacteria 5597
66 Ga0070672_100112635 3300005543 Bacteria 2220
67 Ga0070672_100205330 3300005543 Bacteria 1648
68 Ga0070672_100243671 3300005543 Bacteria 1512
69 Ga0070686_100021952 3300005544 Bacteria 3799
70 Ga0070686_100135587 3300005544 Bacteria 1708
71 Ga0070686_100410001 3300005544 Unclassified 1033
72 Ga0070695_100000442 3300005545 Bacteria 21598
73 Ga0070695_100033162 3300005545 Bacteria 3230
74 Ga0070695_100088717 3300005545 Bacteria 2060
75 Ga0070695_100210288 3300005545 Bacteria 1396
76 Ga0070696_100005003 3300005546 Bacteria 8856
77 Ga0070696_100017869 3300005546 Bacteria 4788
78 Ga0070704_100003587 3300005549 Bacteria 8920
79 Ga0070704_100047913 3300005549 Bacteria 2989
80 Ga0070704_100134233 3300005549 Unclassified 1923
81 Ga0070704_100224819 3300005549 Bacteria 1528
82 Ga0070664_100393539 3300005564 Bacteria 1266
83 Ga0070664_100461151 3300005564 Bacteria 1168
84 Ga0068857_100202405 3300005577 Bacteria 1810
85 Ga0068857_100404989 3300005577 Unclassified 1270
86 Ga0068854_100043174 3300005578 Bacteria 3194
87 Ga0068859_100035193 3300005617 Bacteria 5024
88 Ga0068859_100114366 3300005617 Bacteria 2762
89 Ga0068859_100137389 3300005617 Bacteria 2518
90 Ga0068859_101026838 3300005617 Bacteria 906
91 Ga0068864_100354443 3300005618 Bacteria 1385
92 Ga0068864_100459654 3300005618 Bacteria 1218
93 Ga0068861_100022215 3300005719 Bacteria 4568
94 Ga0068861_100201098 3300005719 Bacteria 1672
95 Ga0068870_10038883 3300005840 Bacteria 2459
96 Ga0068870_10249475 3300005840 Bacteria 1100
97 Ga0068858_100010313 3300005842 Bacteria 8855
98 Ga0068858_100028698 3300005842 Bacteria 5167
99 Ga0068858_100548536 3300005842 Unclassified 1119
100 Ga0068858_100598392 3300005842 Bacteria 1069
101 Ga0068860_100004004 3300005843 Bacteria 15121
102 Ga0068860_100267911 3300005843 Bacteria 1666
103 Ga0068862_100023033 3300005844 Bacteria 5215
104 Ga0075366_10155324 3300006195 Bacteria 1386
105 Ga0097621_100419670 3300006237 Bacteria 1201
106 Ga0068871_100157460 3300006358 Unclassified 1940
107 Ga0075428_100003745 3300006844 Bacteria 16666
108 Ga0075428_100014112 3300006844 Bacteria 8890
109 Ga0075428_100681901 3300006844 Bacteria 1095
110 Ga0075430_100057698 3300006846 Bacteria 3265
111 Ga0075430_100307055 3300006846 Bacteria 1312
112 Ga0075433_10012301 3300006852 Bacteria 6905
113 Ga0075433_10012958 3300006852 Bacteria 6760
114 Ga0075433_10069162 3300006852 Bacteria 3100
115 Ga0075433_10177417 3300006852 Bacteria 1896
116 Ga0075434_100164151 3300006871 Bacteria 2241
117 Ga0075434_100248819 3300006871 Bacteria 1797
118 Ga0075434_100591819 3300006871 Bacteria 1128
119 Ga0075429_100141384 3300006880 Bacteria 2107
120 Ga0068865_100061420 3300006881 Bacteria 2634
121 Ga0097620_100035191 3300006931 Bacteria 5024
122 Ga0097620_100114359 3300006931 Bacteria 2762
123 Ga0097620_100137391 3300006931 Bacteria 2518
124 Ga0097620_101026995 3300006931 Bacteria 906
125 Ga0075435_100116727 3300007076 Bacteria 2224
126 Ga0111539_10000991 3300009094 Bacteria 37208
127 Ga0111539_10027009 3300009094 Bacteria 7011
128 Ga0111539_10028206 3300009094 Bacteria 6851
129 Ga0111539_10028448 3300009094 Bacteria 6818
130 Ga0111539_10089964 3300009094 Bacteria 3607
131 Ga0111539_10133521 3300009094 Bacteria 2906
132 Ga0111539_10200522 3300009094 Bacteria 2327
133 Ga0111539_10511740 3300009094 Bacteria 1398
134 Ga0111539_10779865 3300009094 Bacteria 1112
135 Ga0114129_10003128 3300009147 Bacteria 23220
136 Ga0114129_10006326 3300009147 Bacteria 16793
137 Ga0114129_10017610 3300009147 Bacteria 10169
138 Ga0114129_10024446 3300009147 Bacteria 8559
139 Ga0114129_10201696 3300009147 Bacteria 2694
140 Ga0114129_10436334 3300009147 Bacteria 1720
141 Ga0114129_10631202 3300009147 Bacteria 1385
142 Ga0105243_10023834 3300009148 Bacteria 4664
143 Ga0105243_10327772 3300009148 Bacteria 1398
144 Ga0105243_10499013 3300009148 Bacteria 1153
145 Ga0105242_10005206 3300009176 Bacteria 10039
146 Ga0105248_10142447 3300009177 Bacteria 2704
147 Ga0105248_10368922 3300009177 Bacteria 1616
148 Ga0105248_10395170 3300009177 Unclassified 1557
149 Ga0105237_10082505 3300009545 Bacteria 3205
150 Ga0105238_10000078 3300009551 Bacteria 109783
151 Ga0105249_10074352 3300009553 Bacteria 3145
152 Ga0105249_10098114 3300009553 Bacteria 2751
153 Ga0105239_10430355 3300010375 Bacteria 1496
154 Ga0163162_10123075 3300013306 Bacteria 2699
155 Ga0157375_10002870 3300013308 Bacteria 14932
156 Ga0157375_10209723 3300013308 Bacteria 2105
157 Ga0157375_10400766 3300013308 Bacteria 1539
158 Ga0163163_10040219 3300014325 Bacteria 4565
159 Ga0157380_10024671 3300014326 Bacteria 4553
160 Ga0157380_10108303 3300014326 Bacteria 2329
161 Ga0157377_10025237 3300014745 Bacteria 3168
162 Ga0157377_10073159 3300014745 Bacteria 1985
163 Ga0157377_10076905 3300014745 Bacteria 1942
164 Ga0157379_10257880 3300014968 Unclassified 1584
165 Ga0157376_10140981 3300014969 Bacteria 2162
166 Ga0163161_10118634 3300017792 Bacteria 1986
167 Ga0163161_10185604 3300017792 Bacteria 1596
168 Ga0207682_10031641 3300025893 Bacteria 2124
169 Ga0207682_10036434 3300025893 Unclassified 1991
170 Ga0207680_10117474 3300025903 Bacteria 1735
171 Ga0207680_10285315 3300025903 Unclassified 1148
172 Ga0207645_10003917 3300025907 Bacteria 11116
173 Ga0207643_10006246 3300025908 Bacteria 6374
174 Ga0207707_10082463 3300025912 Bacteria 2808
175 Ga0207660_10161882 3300025917 Unclassified 1727
176 Ga0207660_10502272 3300025917 Unclassified 984
177 Ga0207662_10010099 3300025918 Bacteria 5202
178 Ga0207662_10039174 3300025918 Bacteria 2779
179 Ga0207662_10104540 3300025918 Bacteria 1759
180 Ga0207662_10122835 3300025918 Bacteria 1630
181 Ga0207662_10284812 3300025918 Unclassified 1094
182 Ga0207646_10282582 3300025922 Bacteria 1500
183 Ga0207681_10048710 3300025923 Bacteria 2861
184 Ga0207681_10057948 3300025923 Bacteria 2650
185 Ga0207681_10064466 3300025923 Bacteria 2530
186 Ga0207681_10161563 3300025923 Bacteria 1689
187 Ga0207694_10000027 3300025924 Bacteria 248544
188 Ga0207650_10030552 3300025925 Bacteria 3882
189 Ga0207650_10077854 3300025925 Bacteria 2507
190 Ga0207659_10000911 3300025926 Bacteria 17618
191 Ga0207659_10004182 3300025926 Bacteria 8716
192 Ga0207659_10017114 3300025926 Bacteria 4731
193 Ga0207659_10156246 3300025926 Bacteria 1786
194 Ga0207700_10074038 3300025928 Bacteria 2633
195 Ga0207644_10009743 3300025931 Bacteria 6317
196 Ga0207644_10122274 3300025931 Bacteria 1983
197 Ga0207706_10025347 3300025933 Bacteria 5314
198 Ga0207670_10052535 3300025936 Bacteria 2740
199 Ga0207670_10054802 3300025936 Bacteria 2692
200 Ga0207670_10449931 3300025936 Bacteria 1038
201 Ga0207704_10011898 3300025938 Bacteria 4303
202 Ga0207691_10017998 3300025940 Bacteria 6690
203 Ga0207691_10023054 3300025940 Bacteria 5864
204 Ga0207691_10067304 3300025940 Bacteria 3238
205 Ga0207691_10089054 3300025940 Bacteria 2768
206 Ga0207691_10291177 3300025940 Bacteria 1404
207 Ga0207691_10421835 3300025940 Bacteria 1137
208 Ga0207689_10000699 3300025942 Bacteria 32122
209 Ga0207689_10231007 3300025942 Bacteria 1529
210 Ga0207679_10317999 3300025945 Bacteria 1347
211 Ga0207679_10420387 3300025945 Bacteria 1180
212 Ga0207651_10005403 3300025960 Bacteria 6552
213 Ga0207651_10048413 3300025960 Bacteria 2873
214 Ga0207651_10185388 3300025960 Bacteria 1655
215 Ga0207712_10012072 3300025961 Bacteria 5516
216 Ga0207703_10011091 3300026035 Bacteria 7021
217 Ga0207703_10014158 3300026035 Bacteria 6220
218 Ga0207703_10015880 3300026035 Bacteria 5873
219 Ga0207708_10007509 3300026075 Bacteria 8059
220 Ga0207708_10023236 3300026075 Bacteria 4684
221 Ga0207708_10028715 3300026075 Bacteria 4212
222 Ga0207708_10136048 3300026075 Bacteria 1924
223 Ga0207708_10152420 3300026075 Bacteria 1821
224 Ga0207708_10271487 3300026075 Bacteria 1372
225 Ga0207648_10000406 3300026089 Bacteria 47912
226 Ga0207648_10004662 3300026089 Bacteria 14028
227 Ga0207676_10065072 3300026095 Bacteria 2902
228 Ga0207676_10134340 3300026095 Bacteria 2108
229 Ga0207676_10230679 3300026095 Bacteria 1655
230 Ga0207674_10011011 3300026116 Bacteria 10173
231 Ga0207674_10029458 3300026116 Bacteria 5779
232 Ga0207674_10182751 3300026116 Bacteria 2048
233 Ga0207675_100002212 3300026118 Bacteria 19320
234 Ga0207675_100275929 3300026118 Bacteria 1632
235 Ga0207675_100411166 3300026118 Unclassified 1335
236 Ga0207683_10064461 3300026121 Bacteria 3229
237 Ga0207683_10369002 3300026121 Bacteria 1319
238 Ga0207428_10008184 3300027907 Bacteria 9463
239 Ga0207428_10017666 3300027907 Bacteria 6117
240 Ga0207428_10045992 3300027907 Bacteria 3512
241 Ga0207428_10285533 3300027907 Bacteria 1224
242 Ga0268266_10248481 3300028379 Bacteria 1645
243 Ga0268265_10017419 3300028380 Bacteria 4956
244 Ga0268265_10075734 3300028380 Bacteria 2637
245 Ga0268264_10005563 3300028381 Bacteria 10671
246 Ga0268264_10052468 3300028381 Bacteria 3399
247 Ga0307413_10206068 3300031824 Bacteria 1424
248 Ga0307410_10027315 3300031852 Bacteria 3606
249 Ga0307412_10073042 3300031911 Bacteria 2346
250 Ga0373959_0000499 3300034820 Bacteria 7098
251 Ga0373939_0084437 3300035114 Unclassified 1061
252 Ga0316574_0010127 3300035398 Bacteria 5311
253 Ga0373924_0038490 3300035410 Bacteria 1951
254 Ga0373937_0014790 3300036401 Bacteria 6891
255 Ga0395898_0153485 3300037466 Bacteria 2203
256 Ga0436364_0356722 3300037853 Bacteria 1595
257 Ga0395901_0167760 3300038443 Bacteria 2304
258 Ga0439453_0018276 3300041408 Bacteria 1238
259 Ga0439435_0029986 3300042436 Bacteria 1472
260 Ga0439460_0040296 3300042461 Bacteria 1368
261 Ga0451577_0383641 3300042876 Bacteria 1275
262 Ga0451576_0035026 3300045051 Bacteria 5328
263 Ga0451576_0051530 3300045051 Bacteria 4315
264 Ga0495603_0088109 3300046455 Bacteria 1816
265 Ga0495603_0097019 3300046455 Bacteria 1722
266 Ga0495629_0169327 3300046459 Bacteria 1516
267 Ga0495584_0020658 3300046491 Bacteria 3344
268 Ga0495594_0007282 3300046499 Bacteria 5690
269 Ga0495643_0000173 3300046522 Bacteria 102549
270 Ga0495643_0001948 3300046522 Bacteria 17369
271 Ga0495598_0022503 3300046537 Bacteria 1688
272 Ga0495659_0008395 3300046664 Bacteria 3286
273 Ga0495588_0004341 3300046674 Bacteria 6259
274 Ga0495670_0326736 3300046691 Bacteria 824
275 Ga0495636_0016933 3300047318 Bacteria 2914
276 Ga0495676_0045085 3300047321 Bacteria 3593
277 Ga0495677_0056336 3300047445 Bacteria 1452
278 Ga0495685_034433 3300047447 Bacteria 1740
279 Ga0496104_0436545 3300048907 Bacteria 1221
280 Ga0496104_0628299 3300048907 Bacteria 983
281 Ga0496113_0176661 3300048916 Bacteria 1692
282 Ga0501031_0038940 3300049568 Bacteria 3101
283 Ga0501031_0137844 3300049568 Bacteria 1594
284 Ga0501032_0125884 3300049569 Bacteria 1692
285 Ga0501033_0001214 3300049570 Bacteria 23154
286 Ga0501033_0008799 3300049570 Bacteria 7804
287 Ga0501034_0021155 3300049571 Bacteria 6635
288 Ga0501034_0188968 3300049571 Bacteria 2022
289 Ga0501034_0630154 3300049571 Bacteria 975
290 Ga0501036_0005065 3300049572 Bacteria 10668
291 Ga0501036_0013376 3300049572 Bacteria 6818
292 Ga0501036_0017005 3300049572 Bacteria 6077
293 Ga0501036_0083660 3300049572 Bacteria 2698
294 Ga0501037_0000981 3300049573 Bacteria 21210
295 Ga0501037_0001564 3300049573 Bacteria 16694
296 Ga0501038_0002352 3300049574 Bacteria 17622
297 Ga0501038_0088489 3300049574 Bacteria 2599
298 Ga0501038_0166499 3300049574 Bacteria 1787
299 Ga0501040_0045055 3300049576 Bacteria 3008
300 Ga0501041_0009055 3300049577 Bacteria 5857
301 Ga0501042_0004410 3300049578 Bacteria 8977
302 Ga0501042_0310997 3300049578 Bacteria 1138
303 Ga0501043_0097173 3300049579 Bacteria 2315
304 Ga0501046_0024023 3300049580 Bacteria 5005
305 Ga0501046_0060255 3300049580 Bacteria 2970
306 Ga0501046_0065292 3300049580 Bacteria 2839
307 Ga0501046_0330908 3300049580 Unclassified 1108
308 Ga0501047_0064458 3300049581 Bacteria 3533
309 Ga0501047_0270312 3300049581 Bacteria 1546
310 Ga0501047_0307785 3300049581 Bacteria 1425
311 Ga0501048_0008789 3300049582 Bacteria 7612
312 Ga0501048_0043657 3300049582 Bacteria 3208
313 Ga0501048_0056126 3300049582 Bacteria 2794
314 Ga0501048_0137751 3300049582 Bacteria 1725
315 Ga0501067_0058897 3300049583 Bacteria 2127
316 Ga0501068_0004005 3300049584 Bacteria 8016
317 Ga0501068_0015928 3300049584 Bacteria 4329
318 Ga0501068_0126513 3300049584 Unclassified 1596
319 Ga0501069_0000253 3300049585 Bacteria 24180
320 Ga0501070_0037912 3300049586 Bacteria 4022
321 Ga0501070_0180626 3300049586 Bacteria 1736
322 Ga0501071_0064171 3300049587 Bacteria 2664
323 Ga0501071_0098816 3300049587 Bacteria 2150
324 Ga0501071_0250552 3300049587 Unclassified 1337
325 Ga0501072_0119681 3300049588 Bacteria 2098
326 Ga0501073_0001332 3300049589 Bacteria 18200
327 Ga0501073_0026474 3300049589 Bacteria 4155
328 Ga0501074_0013402 3300049590 Bacteria 5960
329 Ga0501075_0089236 3300049591 Bacteria 2338
330 Ga0501076_0043696 3300049592 Bacteria 3532
331 Ga0501076_0126923 3300049592 Bacteria 2068
332 Ga0501076_0146800 3300049592 Bacteria 1918
333 Ga0501076_0415439 3300049592 Bacteria 1107
334 Ga0501079_0001795 3300049741 Bacteria 15322
335 Ga0501079_0004571 3300049741 Bacteria 10260
336 Ga0501079_0208196 3300049741 Bacteria 1527
337 Ga0501079_0245388 3300049741 Bacteria 1399
338 Ga0501079_0248584 3300049741 Bacteria 1390
339 Ga0501080_0023366 3300049742 Bacteria 5731
340 Ga0501080_0117393 3300049742 Bacteria 2466
341 Ga0501080_0553590 3300049742 Bacteria 1024
342 Ga0501081_0059917 3300049743 Bacteria 2636
343 Ga0501083_0196522 3300049744 Bacteria 1316
344 Ga0501035_0004242 3300049822 Bacteria 13615
345 Ga0501035_0009801 3300049822 Bacteria 8898
346 Ga0501035_0042214 3300049822 Bacteria 4114
347 Ga0501044_0047097 3300049823 Bacteria 4460
348 Ga0501044_0061096 3300049823 Bacteria 3855
349 Ga0501044_0132145 3300049823 Bacteria 2489
350 Ga0501045_0010298 3300049824 Bacteria 6551
351 Ga0501045_0406739 3300049824 Bacteria 1013
352 nmdc:mga05p37_19511_c1 3300050507 Bacteria 8201
353 nmdc:mga05p37_2014_c1 3300050507 Bacteria 23707
354 nmdc:mga05p37_4956_c1 3300050507 Bacteria 15599
355 nmdc:mga09592_214923_c1 3300050508 Bacteria 1666
356 nmdc:mga09592_85104_c1 3300050508 Bacteria 2697
357 nmdc:mga0qj67_185226_c1 3300050509 Bacteria 1691
358 nmdc:mga06r32_396741_c1 3300050510 Unclassified 1362
359 nmdc:mga08y16_12483_c1 3300050511 Bacteria 8938
360 nmdc:mga08y16_138100_c1 3300050511 Bacteria 2534
361 nmdc:mga08y16_189206_c1 3300050511 Bacteria 2135
362 nmdc:mga08y16_191058_c1 3300050511 Bacteria 2124
363 nmdc:mga08y16_196304_c1 3300050511 Bacteria 2092
364 nmdc:mga08y16_273_c1 3300050511 Bacteria 47089
365 nmdc:mga08y16_30366_c1 3300050511 Bacteria 5689
366 nmdc:mga08y16_390765_c1 3300050511 Bacteria 1425
367 nmdc:mga0n895_27697_c1 3300050512 Bacteria 5386
368 nmdc:mga0n895_429924_c1 3300050512 Bacteria 1334
369 nmdc:mga0a205_14106_c1 3300050515 Bacteria 3166
370 nmdc:mga0a205_186710_c1 3300050515 Bacteria 1966
371 nmdc:mga0a205_18989_c1 3300050515 Bacteria 6476
372 Ga0501084_0002762 3300054114 Bacteria 14170
373 Ga0501084_0016452 3300054114 Bacteria 6143
374 Ga0501084_0073127 3300054114 Bacteria 2871
375 Ga0501084_0546334 3300054114 Bacteria 979
376 Ga0501082_0003901 3300060353 Bacteria 13030
377 Ga0501082_0041709 3300060353 Bacteria 3957
378 Ga0501082_0198458 3300060353 Bacteria 1745
379 Ga0501082_0562500 3300060353 Bacteria 997
380 Ga0530510_0121596 3300061734 Bacteria 1917
381 Ga0530510_0128417 3300061734 Bacteria 1864
382 Ga0070704_100191737
383 Ga0065712_10197701
384 Ga0065715_10250171
385 Ga0065707_10007202
386 Ga0065707_10088685
387 Ga0070676_10031373
388 Ga0070690_100037653
389 Ga0070670_100010713
390 Ga0070670_100072452
391 Ga0070677_10124770
392 Ga0068869_100000553
393 Ga0070666_10158844
394 Ga0070680_100130519
395 Ga0070680_100286543
396 Ga0070689_100066820
397 Ga0070687_100004456
398 Ga0070687_100076784
399 Ga0070687_100087164
400 Ga0070687_100118127
401 Ga0070692_10085342
402 Ga0070692_10091267
403 Ga0070669_100103195
404 Ga0070669_100129606
405 Ga0070669_100248518
406 Ga0070675_100001400
407 Ga0070675_100002390
408 Ga0070675_100004078
409 Ga0070675_100010187
410 Ga0070675_100060205
411 Ga0070675_100154364
412 Ga0070675_100278930
413 Ga0070675_100301552
414 Ga0070671_100013191
415 Ga0070671_100221462
416 Ga0070673_100014428
417 Ga0070673_100045639
418 Ga0070673_100080441
419 Ga0070673_100204906
420 Ga0070673_100301000
421 Ga0070667_100231811
422 Ga0070701_10017823
423 Ga0070701_10025467
424 Ga0070705_100002096
425 Ga0070705_100085973
426 Ga0070705_100212360
427 Ga0070700_100003861
428 Ga0070700_100156807
429 Ga0070700_100533581
430 Ga0070694_100001141
431 Ga0070694_100271816
432 Ga0070678_100195872
433 Ga0070662_100023028
434 Ga0070681_10078750
435 Ga0070681_10387026
436 Ga0068867_100008035
437 Ga0068867_100056077
438 Ga0070685_10002713
439 Ga0070685_10012816
440 Ga0070707_100175387
441 Ga0070707_100341369
442 Ga0070699_100029895
443 Ga0070697_100156038
444 Ga0068853_100089093
445 Ga0070672_100014205
446 Ga0070672_100014440
447 Ga0070672_100112635
448 Ga0070672_100205330
449 Ga0070672_100243671
450 Ga0070686_100021952
451 Ga0070686_100135587
452 Ga0070686_100410001
453 Ga0070695_100000442
454 Ga0070695_100033162
455 Ga0070695_100088717
456 Ga0070695_100210288
457 Ga0070696_100005003
458 Ga0070696_100017869
459 Ga0070704_100003587
460 Ga0070704_100047913
461 Ga0070704_100134233
462 Ga0070704_100224819
463 Ga0070664_100393539
464 Ga0070664_100461151
465 Ga0068857_100202405
466 Ga0068857_100404989
467 Ga0068854_100043174
468 Ga0068859_100035193
469 Ga0068859_100114366
470 Ga0068859_100137389
471 Ga0068859_101026838
472 Ga0068864_100354443
473 Ga0068864_100459654
474 Ga0068861_100022215
475 Ga0068861_100201098
476 Ga0068870_10038883
477 Ga0068870_10249475
478 Ga0068858_100010313
479 Ga0068858_100028698
480 Ga0068858_100548536
481 Ga0068858_100598392
482 Ga0068860_100004004
483 Ga0068860_100267911
484 Ga0068862_100023033
485 Ga0075366_10155324
486 Ga0097621_100419670
487 Ga0068871_100157460
488 Ga0075428_100003745
489 Ga0075428_100014112
490 Ga0075428_100681901
491 Ga0075430_100057698
492 Ga0075430_100307055
493 Ga0075433_10012301
494 Ga0075433_10012958
495 Ga0075433_10069162
496 Ga0075433_10177417
497 Ga0075434_100164151
498 Ga0075434_100248819
499 Ga0075434_100591819
500 Ga0075429_100141384
501 Ga0068865_100061420
502 Ga0097620_100035191
503 Ga0097620_100114359
504 Ga0097620_100137391
505 Ga0097620_101026995
506 Ga0075435_100116727
507 Ga0111539_10000991
508 Ga0111539_10027009
509 Ga0111539_10028206
510 Ga0111539_10028448
511 Ga0111539_10089964
512 Ga0111539_10133521
513 Ga0111539_10200522
514 Ga0111539_10511740
515 Ga0111539_10779865
516 Ga0114129_10003128
517 Ga0114129_10006326
518 Ga0114129_10017610
519 Ga0114129_10024446
520 Ga0114129_10201696
521 Ga0114129_10436334
522 Ga0114129_10631202
523 Ga0105243_10023834
524 Ga0105243_10327772
525 Ga0105243_10499013
526 Ga0105242_10005206
527 Ga0105248_10142447
528 Ga0105248_10368922
529 Ga0105248_10395170
530 Ga0105237_10082505
531 Ga0105238_10000078
532 Ga0105249_10074352
533 Ga0105249_10098114
534 Ga0105239_10430355
535 Ga0163162_10123075
536 Ga0157375_10002870
537 Ga0157375_10209723
538 Ga0157375_10400766
539 Ga0163163_10040219
540 Ga0157380_10024671
541 Ga0157380_10108303
542 Ga0157377_10025237
543 Ga0157377_10073159
544 Ga0157377_10076905
545 Ga0157379_10257880
546 Ga0157376_10140981
547 Ga0163161_10118634
548 Ga0163161_10185604
549 Ga0207682_10031641
550 Ga0207682_10036434
551 Ga0207680_10117474
552 Ga0207680_10285315
553 Ga0207645_10003917
554 Ga0207643_10006246
555 Ga0207707_10082463
556 Ga0207660_10161882
557 Ga0207660_10502272
558 Ga0207662_10010099
559 Ga0207662_10039174
560 Ga0207662_10104540
561 Ga0207662_10122835
562 Ga0207662_10284812
563 Ga0207646_10282582
564 Ga0207681_10048710
565 Ga0207681_10057948
566 Ga0207681_10064466
567 Ga0207681_10161563
568 Ga0207694_10000027
569 Ga0207650_10030552
570 Ga0207650_10077854
571 Ga0207659_10000911
572 Ga0207659_10004182
573 Ga0207659_10017114
574 Ga0207659_10156246
575 Ga0207700_10074038
576 Ga0207644_10009743
577 Ga0207644_10122274
578 Ga0207706_10025347
579 Ga0207670_10052535
580 Ga0207670_10054802
581 Ga0207670_10449931
582 Ga0207704_10011898
583 Ga0207691_10017998
584 Ga0207691_10023054
585 Ga0207691_10067304
586 Ga0207691_10089054
587 Ga0207691_10291177
588 Ga0207691_10421835
589 Ga0207689_10000699
590 Ga0207689_10231007
591 Ga0207679_10317999
592 Ga0207679_10420387
593 Ga0207651_10005403
594 Ga0207651_10048413
595 Ga0207651_10185388
596 Ga0207712_10012072
597 Ga0207703_10011091
598 Ga0207703_10014158
599 Ga0207703_10015880
600 Ga0207708_10007509
601 Ga0207708_10023236
602 Ga0207708_10028715
603 Ga0207708_10136048
604 Ga0207708_10152420
605 Ga0207708_10271487
606 Ga0207648_10000406
607 Ga0207648_10004662
608 Ga0207676_10065072
609 Ga0207676_10134340
610 Ga0207676_10230679
611 Ga0207674_10011011
612 Ga0207674_10029458
613 Ga0207674_10182751
614 Ga0207675_100002212
615 Ga0207675_100275929
616 Ga0207675_100411166
617 Ga0207683_10064461
618 Ga0207683_10369002
619 Ga0207428_10008184
620 Ga0207428_10017666
621 Ga0207428_10045992
622 Ga0207428_10285533
623 Ga0268266_10248481
624 Ga0268265_10017419
625 Ga0268265_10075734
626 Ga0268264_10005563
627 Ga0268264_10052468
628 Ga0307413_10206068
629 Ga0307410_10027315
630 Ga0307412_10073042
631 Ga0373959_0000499
632 Ga0373939_0084437
633 Ga0316574_0010127
634 Ga0373924_0038490
635 Ga0373937_0014790
636 Ga0395898_0153485
637 Ga0436364_0356722
638 Ga0395901_0167760
639 Ga0439453_0018276
640 Ga0439435_0029986
641 Ga0439460_0040296
642 Ga0451577_0383641
643 Ga0451576_0035026
644 Ga0451576_0051530
645 Ga0495603_0088109
646 Ga0495603_0097019
647 Ga0495629_0169327
648 Ga0495584_0020658
649 Ga0495594_0007282
650 Ga0495643_0000173
651 Ga0495643_0001948
652 Ga0495598_0022503
653 Ga0495659_0008395
654 Ga0495588_0004341
655 Ga0495670_0326736
656 Ga0495636_0016933
657 Ga0495676_0045085
658 Ga0495677_0056336
659 Ga0495685_034433
660 Ga0496104_0436545
661 Ga0496104_0628299
662 Ga0496113_0176661
663 Ga0501031_0038940
664 Ga0501031_0137844
665 Ga0501032_0125884
666 Ga0501033_0001214
667 Ga0501033_0008799
668 Ga0501034_0021155
669 Ga0501034_0188968
670 Ga0501034_0630154
671 Ga0501036_0005065
672 Ga0501036_0013376
673 Ga0501036_0017005
674 Ga0501036_0083660
675 Ga0501037_0000981
676 Ga0501037_0001564
677 Ga0501038_0002352
678 Ga0501038_0088489
679 Ga0501038_0166499
680 Ga0501040_0045055
681 Ga0501041_0009055
682 Ga0501042_0004410
683 Ga0501042_0310997
684 Ga0501043_0097173
685 Ga0501046_0024023
686 Ga0501046_0060255
687 Ga0501046_0065292
688 Ga0501046_0330908
689 Ga0501047_0064458
690 Ga0501047_0270312
691 Ga0501047_0307785
692 Ga0501048_0008789
693 Ga0501048_0043657
694 Ga0501048_0056126
695 Ga0501048_0137751
696 Ga0501067_0058897
697 Ga0501068_0004005
698 Ga0501068_0015928
699 Ga0501068_0126513
700 Ga0501069_0000253
701 Ga0501070_0037912
702 Ga0501070_0180626
703 Ga0501071_0064171
704 Ga0501071_0098816
705 Ga0501071_0250552
706 Ga0501072_0119681
707 Ga0501073_0001332
708 Ga0501073_0026474
709 Ga0501074_0013402
710 Ga0501075_0089236
711 Ga0501076_0043696
712 Ga0501076_0126923
713 Ga0501076_0146800
714 Ga0501076_0415439
715 Ga0501079_0001795
716 Ga0501079_0004571
717 Ga0501079_0208196
718 Ga0501079_0245388
719 Ga0501079_0248584
720 Ga0501080_0023366
721 Ga0501080_0117393
722 Ga0501080_0553590
723 Ga0501081_0059917
724 Ga0501083_0196522
725 Ga0501035_0004242
726 Ga0501035_0009801
727 Ga0501035_0042214
728 Ga0501044_0047097
729 Ga0501044_0061096
730 Ga0501044_0132145
731 Ga0501045_0010298
732 Ga0501045_0406739
733 nmdc:mga05p37_19511_c1
734 nmdc:mga05p37_2014_c1
735 nmdc:mga05p37_4956_c1
736 nmdc:mga09592_214923_c1
737 nmdc:mga09592_85104_c1
738 nmdc:mga0qj67_185226_c1
739 nmdc:mga06r32_396741_c1
740 nmdc:mga08y16_12483_c1
741 nmdc:mga08y16_138100_c1
742 nmdc:mga08y16_189206_c1
743 nmdc:mga08y16_191058_c1
744 nmdc:mga08y16_196304_c1
745 nmdc:mga08y16_273_c1
746 nmdc:mga08y16_30366_c1
747 nmdc:mga08y16_390765_c1
748 nmdc:mga0n895_27697_c1
749 nmdc:mga0n895_429924_c1
750 nmdc:mga0a205_14106_c1
751 nmdc:mga0a205_186710_c1
752 nmdc:mga0a205_18989_c1
753 Ga0501084_0002762
754 Ga0501084_0016452
755 Ga0501084_0073127
756 Ga0501084_0546334
757 Ga0501082_0003901
758 Ga0501082_0041709
759 Ga0501082_0198458
760 Ga0501082_0562500
761 Ga0530510_0121596
762 Ga0530510_0128417

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13653

GDPD_2

Glycerophosphoryl diester phosphodiesterase family

257

286

0.92

PF03009

GDPD

Glycerophosphoryl diester phosphodiesterase family

50

287

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
8ghi-assembly1.cif.gz_A crystal structure of staphylococcus aureus lysophosphatidylglycerol phospholipase d 0.9071 2 249
8ghi-assembly1.cif.gz_A crystal structure of staphylococcus aureus lysophosphatidylglycerol phospholipase d 0.8583 2 249
7ymp-assembly1.cif.gz_A crystal structure of lysoplasmalogen specific phospholipase d 0.8581 2 262
1zcc-assembly1.cif.gz_B crystal structure of glycerophosphodiester phosphodiesterase from agrobacterium tumefaciens str.c58 0.856 2 243
3qvq-assembly1.cif.gz_D the structure of an oleispira antarctica phosphodiesterase olei02445 in complex with the product sn-glycerol-3-phosphate 0.8523 2 248
ID Description Score Start End Superfamily
af_Q2FZF9_25_304_3.20.20.190 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphatidylinositol (PI) phosphodiesterase 0.9549 2 248 3.20.20.190
af_Q55BE9_41_333_3.20.20.190 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphatidylinositol (PI) phosphodiesterase 0.9219 2 254 3.20.20.190
af_Q2FZF9_25_304_3.20.20.190 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphatidylinositol (PI) phosphodiesterase 0.8984 2 248 3.20.20.190
af_Q55BE9_41_333_3.20.20.190 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphatidylinositol (PI) phosphodiesterase 0.8881 2 254 3.20.20.190
af_P9WLF1_25_300_3.20.20.190 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphatidylinositol (PI) phosphodiesterase 0.8771 2 247 3.20.20.190
ID Description Score Start End GO Terms
AF-A0A3N5GPP4-F1-model_v4 Glycerophosphodiester phosphodiesterase 0.9901 93 255 GO:0006629
GO:0008081
AF-A0A7V9CLH3-F1-model_v4 Glycerophosphodiester phosphodiesterase 0.9846 1 114 GO:0006629
GO:0008081
AF-A0A143PT12-F1-model_v4 Glycerophosphoryl diester phosphodiesterase (EC 3.1.4.46) 0.9835 1 253 GO:0006629
GO:0008889
AF-A0A7R8AX71-F1-model_v4 deleted 0.9834 2 252
AF-A0A7W0R914-F1-model_v4 Glycerophosphodiester phosphodiesterase 0.9813 45 249 GO:0006629
GO:0008081

Map