F428844

General Info

Members Datasets Scaffolds Average Seq Length
381 200 762 221

Family's Representative Sequence

Representative Sequence 3300000549|LJQas_1002074|LJQas_10020742
Length 258
Sequence MLNILLPQRPADRPCSPLPSRYGGAARQTPSADRRRTTQEAAITTPIKPASWSYAEGFVPEDDVLAAARARAEEVGVVPIGPGGGAALRFLASVLDARAVVEIGTGTGVSGLWLLRGMRSDGVLTTVDIEAEHQRLARQSFAEAGIPSQRVRTISGSALDVLPRLTDGHYDLVFADGDKAEYPAYLKEALRLLRPGGVVAFDNALWHDRVADPAQRDEDTVSIRELGRTIAEHDGLVPVLLPVGDGLLVAKKEWSPEA

Samples

Sample ID Description Type Environment
1 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
13 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
14 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
15 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
16 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
17 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
18 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
19 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
20 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
21 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
22 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
23 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
24 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
25 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
26 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
27 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
28 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
29 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
30 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
31 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
32 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
33 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
34 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
35 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
36 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
37 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
38 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
39 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
40 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
41 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
42 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
43 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
44 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
45 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
46 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
47 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
48 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
49 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
50 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
51 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
52 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
53 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
54 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
55 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
56 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
85 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
88 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
89 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
90 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
91 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
92 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
93 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
94 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
95 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
96 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
97 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
98 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
99 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
100 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
101 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
102 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
103 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
104 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
105 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
106 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
107 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
108 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
109 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
110 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
111 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
112 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
113 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
114 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
115 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
116 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
117 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
118 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
119 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
120 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
121 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
122 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
123 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
124 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
125 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
126 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
127 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
128 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
129 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
130 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
131 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
132 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
133 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
134 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
135 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
136 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
137 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
153 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
154 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
155 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
156 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
157 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
158 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
159 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
160 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
161 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
162 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
163 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
164 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
165 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
166 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
169 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
170 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
171 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
172 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
173 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
174 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
175 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
176 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
177 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
178 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
179 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
180 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
181 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
182 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
183 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
184 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
185 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
186 2643221561 Nocardioides sp. Root151 Isolate Unclassified
187 2643221576 Nocardioides sp. Root614 Isolate Unclassified
188 2643221590 Nocardioides sp. Root682 Isolate Unclassified
189 2643221604 Nocardioides sp. Root190 Isolate Unclassified
190 2643221615 Nocardioides sp. Root224 Isolate Unclassified
191 2643221617 Nocardioides sp. Root79 Isolate Unclassified
192 2643221620 Nocardioides sp. Root240 Isolate Unclassified
193 2643221641 Nocardioides sp. Root122 Isolate Unclassified
194 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
195 2643221696 Nocardioides sp. Root140 Isolate Unclassified
196 2738541305 Nocardioides sp. CF167 Isolate Unclassified
197 2739367898 Nocardioides sp. CF479 Isolate Unclassified
198 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
199 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
200 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 95.8
Metatranscriptomes 0
Isolates 4.2

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.64
Nodule 0.26
Rhizoplane 9.45
Rhizosphere 66.93
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJQas_1002074 3300000549 Bacteria 2856
2 JGI24737J22298_10021808 3300001990 Bacteria 2038
3 Ga0070658_10011488 3300005327 Bacteria 7102
4 Ga0070683_100000566 3300005329 Bacteria 26326
5 Ga0070683_100266693 3300005329 Bacteria 1629
6 Ga0070683_100562198 3300005329 Bacteria 1091
7 Ga0070677_10138923 3300005333 Bacteria 1118
8 Ga0070682_100013923 3300005337 Bacteria 4639
9 Ga0070682_100121242 3300005337 Bacteria 1756
10 Ga0068868_100106079 3300005338 Bacteria 2279
11 Ga0070660_100250795 3300005339 Bacteria 1443
12 Ga0070661_100039207 3300005344 Bacteria 3452
13 Ga0070692_10076545 3300005345 Bacteria 1794
14 Ga0070667_100138085 3300005367 Bacteria 2132
15 Ga0070667_100204012 3300005367 Bacteria 1755
16 Ga0070663_100096373 3300005455 Bacteria 2200
17 Ga0070685_10031990 3300005466 Bacteria 2944
18 Ga0070684_100001014 3300005535 Bacteria 20027
19 Ga0070684_100146333 3300005535 Bacteria 2139
20 Ga0068853_100172125 3300005539 Bacteria 1960
21 Ga0070693_100259784 3300005547 Bacteria 1155
22 Ga0070665_100000560 3300005548 Bacteria 51879
23 Ga0070664_100092306 3300005564 Bacteria 2621
24 Ga0068854_100542582 3300005578 Bacteria 985
25 Ga0068856_100247636 3300005614 Bacteria 1797
26 Ga0070702_100064257 3300005615 Bacteria 2146
27 Ga0068852_100449322 3300005616 Bacteria 1276
28 Ga0068852_100827034 3300005616 Bacteria 941
29 Ga0068864_100263169 3300005618 Bacteria 1605
30 Ga0068861_100104182 3300005719 Bacteria 2263
31 Ga0068851_10399815 3300005834 Bacteria 808
32 Ga0068870_10497661 3300005840 Bacteria 812
33 Ga0068863_100093531 3300005841 Bacteria 2853
34 Ga0068858_100176333 3300005842 Bacteria 2017
35 Ga0068860_100002397 3300005843 Bacteria 19677
36 Ga0068860_100129125 3300005843 Bacteria 2424
37 Ga0081539_10070328 3300005985 Bacteria 1879
38 Ga0075365_10015254 3300006038 Bacteria 4643
39 Ga0075365_10020645 3300006038 Bacteria 4089
40 Ga0075365_10055887 3300006038 Bacteria 2623
41 Ga0075365_10063784 3300006038 Bacteria 2467
42 Ga0075365_10082952 3300006038 Bacteria 2174
43 Ga0075365_10120445 3300006038 Bacteria 1810
44 Ga0075365_10152408 3300006038 Bacteria 1608
45 Ga0075365_10276447 3300006038 Bacteria 1181
46 Ga0075365_10328974 3300006038 Bacteria 1076
47 Ga0075365_10354337 3300006038 Bacteria 1034
48 Ga0075368_10001391 3300006042 Bacteria 7717
49 Ga0075368_10004783 3300006042 Bacteria 4612
50 Ga0075368_10016936 3300006042 Bacteria 2721
51 Ga0075368_10084226 3300006042 Bacteria 1296
52 Ga0075363_100001828 3300006048 Bacteria 8355
53 Ga0075363_100003844 3300006048 Bacteria 6474
54 Ga0075363_100010184 3300006048 Bacteria 4448
55 Ga0075363_100016785 3300006048 Bacteria 3620
56 Ga0075363_100095600 3300006048 Bacteria 1639
57 Ga0075363_100107716 3300006048 Bacteria 1547
58 Ga0075364_10013448 3300006051 Bacteria 5032
59 Ga0075364_10027414 3300006051 Bacteria 3639
60 Ga0075364_10038297 3300006051 Bacteria 3106
61 Ga0075364_10070538 3300006051 Bacteria 2300
62 Ga0075362_10321664 3300006177 Bacteria 771
63 Ga0075367_10000758 3300006178 Bacteria 12606
64 Ga0075367_10027436 3300006178 Bacteria 3240
65 Ga0075367_10072417 3300006178 Bacteria 2074
66 Ga0075367_10075308 3300006178 Bacteria 2036
67 Ga0075370_10009736 3300006353 Bacteria 5003
68 Ga0075370_10018640 3300006353 Bacteria 3766
69 Ga0075370_10069857 3300006353 Bacteria 2008
70 Ga0068871_100615517 3300006358 Bacteria 989
71 Ga0068865_100042624 3300006881 Bacteria 3096
72 Ga0105245_10007713 3300009098 Bacteria 9425
73 Ga0105243_10057765 3300009148 Bacteria 3090
74 Ga0105243_10139715 3300009148 Bacteria 2065
75 Ga0105242_10383270 3300009176 Bacteria 1307
76 Ga0105248_10345686 3300009177 Bacteria 1675
77 Ga0105238_10652778 3300009551 Bacteria 1062
78 Ga0105239_10001058 3300010375 Bacteria 38262
79 Ga0105239_10240525 3300010375 Bacteria 2032
80 Ga0105239_10544129 3300010375 Bacteria 1322
81 Ga0105239_10694076 3300010375 Bacteria 1164
82 Ga0105246_10000393 3300011119 Bacteria 23439
83 Ga0157371_10145605 3300013102 Bacteria 1688
84 Ga0157369_10022310 3300013105 Bacteria 7066
85 Ga0157369_10472772 3300013105 Bacteria 1297
86 Ga0163162_10037076 3300013306 Bacteria 4863
87 Ga0163162_10704391 3300013306 Bacteria 1131
88 Ga0157372_10002293 3300013307 Bacteria 20744
89 Ga0157372_10282565 3300013307 Bacteria 1930
90 Ga0157375_10104276 3300013308 Bacteria 2924
91 Ga0157375_10222386 3300013308 Bacteria 2046
92 Ga0157375_10453303 3300013308 Bacteria 1448
93 Ga0157375_10503166 3300013308 Bacteria 1376
94 Ga0157375_10669241 3300013308 Bacteria 1193
95 Ga0163163_10133442 3300014325 Bacteria 2523
96 Ga0163163_10284997 3300014325 Bacteria 1704
97 Ga0157379_10125068 3300014968 Bacteria 2314
98 Ga0157376_10094240 3300014969 Bacteria 2601
99 Ga0157376_10402675 3300014969 Bacteria 1324
100 Ga0163161_10052511 3300017792 Bacteria 2955
101 Ga0163161_10347856 3300017792 Bacteria 1178
102 Ga0207682_10115317 3300025893 Bacteria 1186
103 Ga0207642_10154057 3300025899 Bacteria 1227
104 Ga0207688_10055093 3300025901 Bacteria 2231
105 Ga0207647_10204071 3300025904 Bacteria 1143
106 Ga0207643_10059765 3300025908 Bacteria 2175
107 Ga0207643_10160057 3300025908 Bacteria 1354
108 Ga0207705_10190262 3300025909 Bacteria 1551
109 Ga0207662_10087726 3300025918 Bacteria 1909
110 Ga0207657_10016920 3300025919 Bacteria 7017
111 Ga0207649_10081563 3300025920 Bacteria 2095
112 Ga0207650_10727817 3300025925 Bacteria 839
113 Ga0207687_10281180 3300025927 Bacteria 1334
114 Ga0207687_10532011 3300025927 Bacteria 984
115 Ga0207686_10119138 3300025934 Bacteria 1794
116 Ga0207711_10222880 3300025941 Bacteria 1725
117 Ga0207661_10013241 3300025944 Bacteria 6023
118 Ga0207661_10202375 3300025944 Bacteria 1746
119 Ga0207661_10419836 3300025944 Bacteria 1215
120 Ga0207667_10203299 3300025949 Bacteria 2031
121 Ga0207668_10359961 3300025972 Bacteria 1219
122 Ga0207640_10284540 3300025981 Bacteria 1300
123 Ga0207658_10017987 3300025986 Bacteria 4872
124 Ga0207658_10329241 3300025986 Bacteria 1324
125 Ga0207677_10094312 3300026023 Bacteria 2184
126 Ga0207703_10142892 3300026035 Bacteria 2079
127 Ga0207639_10222605 3300026041 Bacteria 1631
128 Ga0207678_10285517 3300026067 Bacteria 1417
129 Ga0207678_10485316 3300026067 Bacteria 1076
130 Ga0207702_10224395 3300026078 Bacteria 1752
131 Ga0207648_10118208 3300026089 Bacteria 2330
132 Ga0207676_11191138 3300026095 Bacteria 755
133 Ga0207675_100051454 3300026118 Bacteria 3843
134 Ga0207675_100088852 3300026118 Bacteria 2903
135 Ga0207683_10028735 3300026121 Bacteria 4810
136 Ga0207698_10433100 3300026142 Bacteria 1265
137 Ga0209813_10001322 3300027866 Bacteria 5544
138 Ga0209813_10026460 3300027866 Bacteria 1678
139 Ga0268266_10000794 3300028379 Bacteria 42029
140 Ga0268264_10004635 3300028381 Bacteria 11678
141 Ga0268264_10192382 3300028381 Bacteria 1861
142 Ga0307410_10173950 3300031852 Bacteria 1625
143 Ga0307406_10344529 3300031901 Bacteria 1162
144 Ga0307407_10024938 3300031903 Bacteria 3145
145 Ga0307407_10054864 3300031903 Bacteria 2300
146 Ga0307407_10628955 3300031903 Bacteria 802
147 Ga0307412_10177118 3300031911 Bacteria 1600
148 Ga0307409_100068394 3300031995 Bacteria 2809
149 Ga0307409_100257753 3300031995 Bacteria 1599
150 Ga0307409_100817601 3300031995 Bacteria 940
151 Ga0307416_100231875 3300032002 Bacteria 1781
152 Ga0307414_10221452 3300032004 Bacteria 1554
153 Ga0307415_100039605 3300032126 Bacteria 3116
154 Ga0307415_100163705 3300032126 Bacteria 1727
155 Ga0307415_100266458 3300032126 Bacteria 1401
156 Ga0395899_0169192 3300037312 Bacteria 1540
157 Ga0395898_0366540 3300037466 Bacteria 1374
158 Ga0395898_0460447 3300037466 Bacteria 1211
159 Ga0395905_0215717 3300037471 Bacteria 1797
160 Ga0395905_0305189 3300037471 Bacteria 1480
161 Ga0395901_0172652 3300038443 Bacteria 2268
162 Ga0439438_037274 3300041405 Bacteria 1272
163 Ga0451797_0922648 3300041453 Bacteria 913
164 Ga0451839_0105273 3300041496 Bacteria 940
165 Ga0451843_1438165 3300041509 Bacteria 1098
166 Ga0451853_0492762 3300041512 Bacteria 1855
167 Ga0439434_0108301 3300042435 Bacteria 899
168 Ga0466972_0091146 3300044658 Bacteria 1445
169 Ga0466965_0043559 3300044683 Bacteria 2216
170 Ga0466965_0077623 3300044683 Bacteria 1677
171 Ga0466966_0046378 3300044684 Bacteria 2775
172 Ga0466961_0089564 3300044693 Bacteria 1943
173 Ga0466961_0346650 3300044693 Bacteria 904
174 Ga0466963_0093898 3300044694 Bacteria 2046
175 Ga0466963_0230034 3300044694 Bacteria 1299
176 Ga0466963_0401632 3300044694 Bacteria 966
177 Ga0466964_0005332 3300044706 Bacteria 4775
178 Ga0466964_0018585 3300044706 Bacteria 2668
179 Ga0466971_0181270 3300044719 Bacteria 990
180 Ga0466970_0015378 3300044765 Bacteria 3934
181 Ga0466970_0015767 3300044765 Bacteria 3890
182 Ga0466957_0117099 3300044842 Bacteria 1695
183 Ga0466960_0002271 3300044901 Bacteria 7189
184 Ga0466960_0010349 3300044901 Bacteria 3870
185 Ga0466960_0228497 3300044901 Bacteria 1026
186 Ga0466959_0061658 3300045049 Bacteria 2727
187 Ga0466959_0066204 3300045049 Bacteria 2621
188 Ga0466959_0174200 3300045049 Bacteria 1508
189 Ga0466958_0005675 3300045836 Bacteria 6742
190 Ga0466958_0144374 3300045836 Bacteria 1499
191 Ga0466967_0004663 3300045976 Bacteria 9301
192 Ga0466967_0012152 3300045976 Bacteria 6569
193 Ga0466967_0019593 3300045976 Bacteria 5445
194 Ga0466967_0055498 3300045976 Bacteria 3489
195 Ga0466967_0914809 3300045976 Bacteria 872
196 Ga0495641_0047276 3300046461 Bacteria 1976
197 Ga0495653_0315066 3300046463 Bacteria 1016
198 Ga0495635_0058080 3300046663 Bacteria 2662
199 Ga0495657_0160793 3300046675 Bacteria 1390
200 Ga0496100_0311579 3300048903 Bacteria 1180
201 Ga0496100_0432047 3300048903 Bacteria 1007
202 Ga0496101_0044805 3300048904 Bacteria 3167
203 Ga0496101_0166661 3300048904 Bacteria 1692
204 Ga0496102_0014823 3300048905 Bacteria 6779
205 Ga0496102_0242793 3300048905 Bacteria 1698
206 Ga0496102_0391684 3300048905 Bacteria 1307
207 Ga0496103_0274436 3300048906 Bacteria 1085
208 Ga0496104_0011860 3300048907 Bacteria 7823
209 Ga0496104_0755339 3300048907 Bacteria 879
210 Ga0496104_0910583 3300048907 Bacteria 784
211 Ga0496105_0000345 3300048908 Bacteria 30539
212 Ga0496105_0135632 3300048908 Bacteria 2028
213 Ga0496105_0354769 3300048908 Bacteria 1171
214 Ga0496105_0627765 3300048908 Bacteria 831
215 Ga0496106_0093899 3300048909 Bacteria 2319
216 Ga0496106_0197509 3300048909 Bacteria 1600
217 Ga0496106_0587235 3300048909 Bacteria 893
218 Ga0496107_0027972 3300048910 Bacteria 4005
219 Ga0496108_0027646 3300048911 Bacteria 4688
220 Ga0496108_0115304 3300048911 Bacteria 2301
221 Ga0496108_0213762 3300048911 Bacteria 1674
222 Ga0496108_0934721 3300048911 Bacteria 743
223 Ga0496109_0026203 3300048912 Bacteria 5198
224 Ga0496109_0043347 3300048912 Bacteria 4078
225 Ga0496109_0095084 3300048912 Bacteria 2758
226 Ga0496109_0816537 3300048912 Bacteria 870
227 Ga0496109_1059732 3300048912 Bacteria 748
228 Ga0496110_0139878 3300048913 Bacteria 2188
229 Ga0496111_0013979 3300048914 Bacteria 5474
230 Ga0496112_0387151 3300048915 Bacteria 1339
231 Ga0496114_0014696 3300048917 Bacteria 6290
232 Ga0496114_0022233 3300048917 Bacteria 5167
233 Ga0496114_0246163 3300048917 Bacteria 1573
234 Ga0496114_0797955 3300048917 Bacteria 823
235 Ga0496124_0017718 3300048927 Bacteria 6702
236 Ga0501031_0005350 3300049568 Bacteria 8361
237 Ga0501031_0186082 3300049568 Bacteria 1356
238 Ga0501032_0004586 3300049569 Bacteria 10396
239 Ga0501032_0025755 3300049569 Bacteria 4054
240 Ga0501033_0075285 3300049570 Bacteria 2478
241 Ga0501034_0042304 3300049571 Bacteria 4612
242 Ga0501034_0260687 3300049571 Bacteria 1676
243 Ga0501034_1027940 3300049571 Bacteria 707
244 Ga0501036_0001242 3300049572 Bacteria 19500
245 Ga0501036_0003724 3300049572 Bacteria 12224
246 Ga0501037_0021493 3300049573 Bacteria 4770
247 Ga0501037_0081586 3300049573 Bacteria 2344
248 Ga0501037_0384191 3300049573 Bacteria 965
249 Ga0501037_0468801 3300049573 Bacteria 857
250 Ga0501038_0005380 3300049574 Bacteria 11893
251 Ga0501038_0027429 3300049574 Bacteria 5067
252 Ga0501038_0177002 3300049574 Bacteria 1723
253 Ga0501039_0048124 3300049575 Bacteria 3296
254 Ga0501039_0133279 3300049575 Bacteria 1950
255 Ga0501039_0450471 3300049575 Bacteria 1011
256 Ga0501040_0634057 3300049576 Bacteria 772
257 Ga0501041_0095839 3300049577 Bacteria 1834
258 Ga0501042_0008182 3300049578 Bacteria 6889
259 Ga0501042_0010289 3300049578 Bacteria 6263
260 Ga0501042_0234291 3300049578 Bacteria 1324
261 Ga0501043_0002310 3300049579 Bacteria 16147
262 Ga0501043_0089048 3300049579 Bacteria 2426
263 Ga0501043_0582926 3300049579 Bacteria 828
264 Ga0501046_0001277 3300049580 Bacteria 24381
265 Ga0501046_0001519 3300049580 Bacteria 22127
266 Ga0501046_0100630 3300049580 Bacteria 2218
267 Ga0501047_0083677 3300049581 Bacteria 3066
268 Ga0501047_0107040 3300049581 Bacteria 2677
269 Ga0501048_0002851 3300049582 Bacteria 13195
270 Ga0501048_0006158 3300049582 Bacteria 9134
271 Ga0501048_0038333 3300049582 Bacteria 3439
272 Ga0501067_0009688 3300049583 Bacteria 5332
273 Ga0501067_0013411 3300049583 Bacteria 4539
274 Ga0501067_0018233 3300049583 Bacteria 3887
275 Ga0501068_0054594 3300049584 Bacteria 2420
276 Ga0501068_0065496 3300049584 Bacteria 2212
277 Ga0501069_0022742 3300049585 Bacteria 3414
278 Ga0501069_0043103 3300049585 Bacteria 2497
279 Ga0501069_0110235 3300049585 Bacteria 1567
280 Ga0501069_0428576 3300049585 Bacteria 784
281 Ga0501070_0000826 3300049586 Bacteria 28120
282 Ga0501070_0003960 3300049586 Bacteria 12749
283 Ga0501070_0005442 3300049586 Bacteria 10871
284 Ga0501070_0037019 3300049586 Bacteria 4073
285 Ga0501071_0045647 3300049587 Bacteria 3145
286 Ga0501071_0152151 3300049587 Bacteria 1726
287 Ga0501071_0179913 3300049587 Bacteria 1584
288 Ga0501072_0052666 3300049588 Bacteria 3204
289 Ga0501072_0084818 3300049588 Bacteria 2512
290 Ga0501072_0149047 3300049588 Bacteria 1865
291 Ga0501072_0579800 3300049588 Bacteria 885
292 Ga0501073_0019805 3300049589 Bacteria 4855
293 Ga0501073_0026880 3300049589 Bacteria 4120
294 Ga0501073_0035950 3300049589 Bacteria 3520
295 Ga0501073_0046646 3300049589 Bacteria 3046
296 Ga0501074_0019496 3300049590 Bacteria 4925
297 Ga0501074_0101386 3300049590 Bacteria 2061
298 Ga0501074_0126414 3300049590 Bacteria 1829
299 Ga0501074_0282322 3300049590 Bacteria 1180
300 Ga0501075_0063136 3300049591 Bacteria 2792
301 Ga0501076_0171978 3300049592 Bacteria 1766
302 Ga0501076_0278218 3300049592 Bacteria 1371
303 Ga0501077_0007235 3300049593 Bacteria 6846
304 Ga0501077_0046561 3300049593 Bacteria 2755
305 Ga0501079_0064551 3300049741 Bacteria 2824
306 Ga0501080_0033931 3300049742 Bacteria 4764
307 Ga0501080_0036855 3300049742 Bacteria 4565
308 Ga0501080_0147736 3300049742 Bacteria 2173
309 Ga0501083_0115407 3300049744 Bacteria 1763
310 Ga0501035_0014584 3300049822 Bacteria 7253
311 Ga0501035_0178396 3300049822 Bacteria 1831
312 Ga0501044_0006086 3300049823 Bacteria 13314
313 Ga0501044_0059146 3300049823 Bacteria 3927
314 Ga0501044_0342168 3300049823 Bacteria 1417
315 Ga0501045_0015698 3300049824 Bacteria 5373
316 Ga0501045_0092226 3300049824 Bacteria 2240
317 Ga0501045_0349814 3300049824 Bacteria 1100
318 Ga0501045_0655955 3300049824 Bacteria 775
319 nmdc:mga03n38_118582_c1 3300050490 Bacteria 1298
320 nmdc:mga03n38_29549_c1 3300050490 Bacteria 2296
321 nmdc:mga03n38_4106_c1 3300050490 Bacteria 4779
322 nmdc:mga00v17_138305_c1 3300050491 Bacteria 1561
323 nmdc:mga00v17_148772_c1 3300050491 Bacteria 1504
324 nmdc:mga00v17_16712_c1 3300050491 Bacteria 4138
325 nmdc:mga00v17_267845_c1 3300050491 Bacteria 1109
326 nmdc:mga00v17_28966_c1 3300050491 Bacteria 3247
327 nmdc:mga00v17_319010_c1 3300050491 Bacteria 1010
328 nmdc:mga00v17_5829_c1 3300050491 Bacteria 6505
329 nmdc:mga00v17_87143_c1 3300050491 Bacteria 1957
330 nmdc:mga00v17_95016_c1 3300050491 Bacteria 1876
331 nmdc:mga0yw44_104294_c1 3300050492 Bacteria 1810
332 nmdc:mga0yw44_137230_c1 3300050492 Bacteria 1587
333 nmdc:mga0yw44_146619_c1 3300050492 Bacteria 1537
334 nmdc:mga0yw44_15013_c1 3300050492 Bacteria 4134
335 nmdc:mga0yw44_19383_c1 3300050492 Bacteria 3751
336 nmdc:mga0yw44_24250_c1 3300050492 Bacteria 3430
337 nmdc:mga0yw44_26990_c1 3300050492 Bacteria 3285
338 nmdc:mga0yw44_31741_c1 3300050492 Bacteria 3074
339 nmdc:mga0yw44_41321_c1 3300050492 Bacteria 2745
340 nmdc:mga0yw44_483584_c1 3300050492 Bacteria 840
341 nmdc:mga0yw44_5834_c1 3300050492 Bacteria 5877
342 nmdc:mga0yw44_594291_c1 3300050492 Bacteria 752
343 nmdc:mga0yw44_62384_c1 3300050492 Bacteria 2289
344 nmdc:mga06z11_2762_c1 3300050494 Bacteria 6728
345 nmdc:mga06z11_53808_c1 3300050494 Bacteria 2072
346 nmdc:mga06z11_78587_c1 3300050494 Bacteria 1764
347 nmdc:mga04h51_1024_c1 3300050495 Bacteria 6448
348 nmdc:mga04h51_60819_c1 3300050495 Bacteria 1294
349 nmdc:mga07m45_22246_c1 3300050496 Bacteria 3460
350 nmdc:mga07m45_311792_c1 3300050496 Bacteria 915
351 nmdc:mga07m45_52056_c1 3300050496 Bacteria 2311
352 Ga0495595_0013040 3300053084 Bacteria 3507
353 Ga0495619_0003818 3300053085 Bacteria 9697
354 Ga0500644_0001927 3300053088 Bacteria 5324
355 Ga0500556_0000182 3300053104 Bacteria 51372
356 Ga0500593_000495 3300053117 Bacteria 15558
357 Ga0500573_0022433 3300053140 Bacteria 3623
358 Ga0501084_0003691 3300054114 Bacteria 12428
359 Ga0501084_0017236 3300054114 Bacteria 6000
360 Ga0501084_0178633 3300054114 Bacteria 1792
361 Ga0501084_0307147 3300054114 Bacteria 1340
362 Ga0501082_0301982 3300060353 Bacteria 1394
363 Ga0501082_0632604 3300060353 Bacteria 936
364 Ga0466962_0001949 3300061719 Bacteria 9731
365 Ga0530510_0263530 3300061734 Bacteria 1286
366 2515852777 2515154155 Bacteria 7985436
367 2643823865 2643221561 Bacteria 4984412
368 2643893310 2643221576 Bacteria 5214352
369 2643961631 2643221590 Bacteria 5214697
370 2644035236 2643221604 Bacteria 5014917
371 2644091647 2643221615 Bacteria 5487866
372 2644099367 2643221617 Bacteria 5139111
373 2644116439 2643221620 Bacteria 5134593
374 2644231104 2643221641 Bacteria 4490190
375 2644321450 2643221657 Bacteria 5490246
376 2644533141 2643221696 Bacteria 5431823
377 2738867657 2738541305 Bacteria 4910150
378 2740166454 2739367898 Bacteria 4367674
379 2812331912 2811994874 Bacteria 5367947
380 2857482728 2857481737 Bacteria 4761446
381 8054610404 8054609563 Bacteria 5170090
382 LJQas_1002074
383 JGI24737J22298_10021808
384 Ga0070658_10011488
385 Ga0070683_100000566
386 Ga0070683_100266693
387 Ga0070683_100562198
388 Ga0070677_10138923
389 Ga0070682_100013923
390 Ga0070682_100121242
391 Ga0068868_100106079
392 Ga0070660_100250795
393 Ga0070661_100039207
394 Ga0070692_10076545
395 Ga0070667_100138085
396 Ga0070667_100204012
397 Ga0070663_100096373
398 Ga0070685_10031990
399 Ga0070684_100001014
400 Ga0070684_100146333
401 Ga0068853_100172125
402 Ga0070693_100259784
403 Ga0070665_100000560
404 Ga0070664_100092306
405 Ga0068854_100542582
406 Ga0068856_100247636
407 Ga0070702_100064257
408 Ga0068852_100449322
409 Ga0068852_100827034
410 Ga0068864_100263169
411 Ga0068861_100104182
412 Ga0068851_10399815
413 Ga0068870_10497661
414 Ga0068863_100093531
415 Ga0068858_100176333
416 Ga0068860_100002397
417 Ga0068860_100129125
418 Ga0081539_10070328
419 Ga0075365_10015254
420 Ga0075365_10020645
421 Ga0075365_10055887
422 Ga0075365_10063784
423 Ga0075365_10082952
424 Ga0075365_10120445
425 Ga0075365_10152408
426 Ga0075365_10276447
427 Ga0075365_10328974
428 Ga0075365_10354337
429 Ga0075368_10001391
430 Ga0075368_10004783
431 Ga0075368_10016936
432 Ga0075368_10084226
433 Ga0075363_100001828
434 Ga0075363_100003844
435 Ga0075363_100010184
436 Ga0075363_100016785
437 Ga0075363_100095600
438 Ga0075363_100107716
439 Ga0075364_10013448
440 Ga0075364_10027414
441 Ga0075364_10038297
442 Ga0075364_10070538
443 Ga0075362_10321664
444 Ga0075367_10000758
445 Ga0075367_10027436
446 Ga0075367_10072417
447 Ga0075367_10075308
448 Ga0075370_10009736
449 Ga0075370_10018640
450 Ga0075370_10069857
451 Ga0068871_100615517
452 Ga0068865_100042624
453 Ga0105245_10007713
454 Ga0105243_10057765
455 Ga0105243_10139715
456 Ga0105242_10383270
457 Ga0105248_10345686
458 Ga0105238_10652778
459 Ga0105239_10001058
460 Ga0105239_10240525
461 Ga0105239_10544129
462 Ga0105239_10694076
463 Ga0105246_10000393
464 Ga0157371_10145605
465 Ga0157369_10022310
466 Ga0157369_10472772
467 Ga0163162_10037076
468 Ga0163162_10704391
469 Ga0157372_10002293
470 Ga0157372_10282565
471 Ga0157375_10104276
472 Ga0157375_10222386
473 Ga0157375_10453303
474 Ga0157375_10503166
475 Ga0157375_10669241
476 Ga0163163_10133442
477 Ga0163163_10284997
478 Ga0157379_10125068
479 Ga0157376_10094240
480 Ga0157376_10402675
481 Ga0163161_10052511
482 Ga0163161_10347856
483 Ga0207682_10115317
484 Ga0207642_10154057
485 Ga0207688_10055093
486 Ga0207647_10204071
487 Ga0207643_10059765
488 Ga0207643_10160057
489 Ga0207705_10190262
490 Ga0207662_10087726
491 Ga0207657_10016920
492 Ga0207649_10081563
493 Ga0207650_10727817
494 Ga0207687_10281180
495 Ga0207687_10532011
496 Ga0207686_10119138
497 Ga0207711_10222880
498 Ga0207661_10013241
499 Ga0207661_10202375
500 Ga0207661_10419836
501 Ga0207667_10203299
502 Ga0207668_10359961
503 Ga0207640_10284540
504 Ga0207658_10017987
505 Ga0207658_10329241
506 Ga0207677_10094312
507 Ga0207703_10142892
508 Ga0207639_10222605
509 Ga0207678_10285517
510 Ga0207678_10485316
511 Ga0207702_10224395
512 Ga0207648_10118208
513 Ga0207676_11191138
514 Ga0207675_100051454
515 Ga0207675_100088852
516 Ga0207683_10028735
517 Ga0207698_10433100
518 Ga0209813_10001322
519 Ga0209813_10026460
520 Ga0268266_10000794
521 Ga0268264_10004635
522 Ga0268264_10192382
523 Ga0307410_10173950
524 Ga0307406_10344529
525 Ga0307407_10024938
526 Ga0307407_10054864
527 Ga0307407_10628955
528 Ga0307412_10177118
529 Ga0307409_100068394
530 Ga0307409_100257753
531 Ga0307409_100817601
532 Ga0307416_100231875
533 Ga0307414_10221452
534 Ga0307415_100039605
535 Ga0307415_100163705
536 Ga0307415_100266458
537 Ga0395899_0169192
538 Ga0395898_0366540
539 Ga0395898_0460447
540 Ga0395905_0215717
541 Ga0395905_0305189
542 Ga0395901_0172652
543 Ga0439438_037274
544 Ga0451797_0922648
545 Ga0451839_0105273
546 Ga0451843_1438165
547 Ga0451853_0492762
548 Ga0439434_0108301
549 Ga0466972_0091146
550 Ga0466965_0043559
551 Ga0466965_0077623
552 Ga0466966_0046378
553 Ga0466961_0089564
554 Ga0466961_0346650
555 Ga0466963_0093898
556 Ga0466963_0230034
557 Ga0466963_0401632
558 Ga0466964_0005332
559 Ga0466964_0018585
560 Ga0466971_0181270
561 Ga0466970_0015378
562 Ga0466970_0015767
563 Ga0466957_0117099
564 Ga0466960_0002271
565 Ga0466960_0010349
566 Ga0466960_0228497
567 Ga0466959_0061658
568 Ga0466959_0066204
569 Ga0466959_0174200
570 Ga0466958_0005675
571 Ga0466958_0144374
572 Ga0466967_0004663
573 Ga0466967_0012152
574 Ga0466967_0019593
575 Ga0466967_0055498
576 Ga0466967_0914809
577 Ga0495641_0047276
578 Ga0495653_0315066
579 Ga0495635_0058080
580 Ga0495657_0160793
581 Ga0496100_0311579
582 Ga0496100_0432047
583 Ga0496101_0044805
584 Ga0496101_0166661
585 Ga0496102_0014823
586 Ga0496102_0242793
587 Ga0496102_0391684
588 Ga0496103_0274436
589 Ga0496104_0011860
590 Ga0496104_0755339
591 Ga0496104_0910583
592 Ga0496105_0000345
593 Ga0496105_0135632
594 Ga0496105_0354769
595 Ga0496105_0627765
596 Ga0496106_0093899
597 Ga0496106_0197509
598 Ga0496106_0587235
599 Ga0496107_0027972
600 Ga0496108_0027646
601 Ga0496108_0115304
602 Ga0496108_0213762
603 Ga0496108_0934721
604 Ga0496109_0026203
605 Ga0496109_0043347
606 Ga0496109_0095084
607 Ga0496109_0816537
608 Ga0496109_1059732
609 Ga0496110_0139878
610 Ga0496111_0013979
611 Ga0496112_0387151
612 Ga0496114_0014696
613 Ga0496114_0022233
614 Ga0496114_0246163
615 Ga0496114_0797955
616 Ga0496124_0017718
617 Ga0501031_0005350
618 Ga0501031_0186082
619 Ga0501032_0004586
620 Ga0501032_0025755
621 Ga0501033_0075285
622 Ga0501034_0042304
623 Ga0501034_0260687
624 Ga0501034_1027940
625 Ga0501036_0001242
626 Ga0501036_0003724
627 Ga0501037_0021493
628 Ga0501037_0081586
629 Ga0501037_0384191
630 Ga0501037_0468801
631 Ga0501038_0005380
632 Ga0501038_0027429
633 Ga0501038_0177002
634 Ga0501039_0048124
635 Ga0501039_0133279
636 Ga0501039_0450471
637 Ga0501040_0634057
638 Ga0501041_0095839
639 Ga0501042_0008182
640 Ga0501042_0010289
641 Ga0501042_0234291
642 Ga0501043_0002310
643 Ga0501043_0089048
644 Ga0501043_0582926
645 Ga0501046_0001277
646 Ga0501046_0001519
647 Ga0501046_0100630
648 Ga0501047_0083677
649 Ga0501047_0107040
650 Ga0501048_0002851
651 Ga0501048_0006158
652 Ga0501048_0038333
653 Ga0501067_0009688
654 Ga0501067_0013411
655 Ga0501067_0018233
656 Ga0501068_0054594
657 Ga0501068_0065496
658 Ga0501069_0022742
659 Ga0501069_0043103
660 Ga0501069_0110235
661 Ga0501069_0428576
662 Ga0501070_0000826
663 Ga0501070_0003960
664 Ga0501070_0005442
665 Ga0501070_0037019
666 Ga0501071_0045647
667 Ga0501071_0152151
668 Ga0501071_0179913
669 Ga0501072_0052666
670 Ga0501072_0084818
671 Ga0501072_0149047
672 Ga0501072_0579800
673 Ga0501073_0019805
674 Ga0501073_0026880
675 Ga0501073_0035950
676 Ga0501073_0046646
677 Ga0501074_0019496
678 Ga0501074_0101386
679 Ga0501074_0126414
680 Ga0501074_0282322
681 Ga0501075_0063136
682 Ga0501076_0171978
683 Ga0501076_0278218
684 Ga0501077_0007235
685 Ga0501077_0046561
686 Ga0501079_0064551
687 Ga0501080_0033931
688 Ga0501080_0036855
689 Ga0501080_0147736
690 Ga0501083_0115407
691 Ga0501035_0014584
692 Ga0501035_0178396
693 Ga0501044_0006086
694 Ga0501044_0059146
695 Ga0501044_0342168
696 Ga0501045_0015698
697 Ga0501045_0092226
698 Ga0501045_0349814
699 Ga0501045_0655955
700 nmdc:mga03n38_118582_c1
701 nmdc:mga03n38_29549_c1
702 nmdc:mga03n38_4106_c1
703 nmdc:mga00v17_138305_c1
704 nmdc:mga00v17_148772_c1
705 nmdc:mga00v17_16712_c1
706 nmdc:mga00v17_267845_c1
707 nmdc:mga00v17_28966_c1
708 nmdc:mga00v17_319010_c1
709 nmdc:mga00v17_5829_c1
710 nmdc:mga00v17_87143_c1
711 nmdc:mga00v17_95016_c1
712 nmdc:mga0yw44_104294_c1
713 nmdc:mga0yw44_137230_c1
714 nmdc:mga0yw44_146619_c1
715 nmdc:mga0yw44_15013_c1
716 nmdc:mga0yw44_19383_c1
717 nmdc:mga0yw44_24250_c1
718 nmdc:mga0yw44_26990_c1
719 nmdc:mga0yw44_31741_c1
720 nmdc:mga0yw44_41321_c1
721 nmdc:mga0yw44_483584_c1
722 nmdc:mga0yw44_5834_c1
723 nmdc:mga0yw44_594291_c1
724 nmdc:mga0yw44_62384_c1
725 nmdc:mga06z11_2762_c1
726 nmdc:mga06z11_53808_c1
727 nmdc:mga06z11_78587_c1
728 nmdc:mga04h51_1024_c1
729 nmdc:mga04h51_60819_c1
730 nmdc:mga07m45_22246_c1
731 nmdc:mga07m45_311792_c1
732 nmdc:mga07m45_52056_c1
733 Ga0495595_0013040
734 Ga0495619_0003818
735 Ga0500644_0001927
736 Ga0500556_0000182
737 Ga0500593_000495
738 Ga0500573_0022433
739 Ga0501084_0003691
740 Ga0501084_0017236
741 Ga0501084_0178633
742 Ga0501084_0307147
743 Ga0501082_0301982
744 Ga0501082_0632604
745 Ga0466962_0001949
746 Ga0530510_0263530
747 2515852777
748 2643823865
749 2643893310
750 2643961631
751 2644035236
752 2644091647
753 2644099367
754 2644116439
755 2644231104
756 2644321450
757 2644533141
758 2738867657
759 2740166454
760 2812331912
761 2857482728
762 8054610404

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01596

Methyltransf_3

O-methyltransferase

62

253

0.95

PF13649

Methyltransf_25

Methyltransferase domain

100

197

0.93

PF08241

Methyltransf_11

Methyltransferase domain

101

201

0.91

PF13578

Methyltransf_24

Methyltransferase domain

101

204

0.88

PF13847

Methyltransf_31

Methyltransferase domain

94

252

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
5x7f-assembly1.cif.gz_A-2 structure of a o-methyltransferase from mycobacterium tuberculosis at 2.0 resolution 0.9686 50 253
5x7f-assembly1.cif.gz_A-2 structure of a o-methyltransferase from mycobacterium tuberculosis at 2.0 resolution 0.959 50 253
3tr6-assembly1.cif.gz_A-2 structure of a o-methyltransferase from coxiella burnetii 0.9403 41 254
5lhm-assembly1.cif.gz_A crystal structure of safc from myxococcus xanthus apo-form 0.9371 50 255
5log-assembly1.cif.gz_A crystal structure of safc from myxococcus xanthus bound to sam 0.9364 44 255
ID Description Score Start End Superfamily
5x7fA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9686 50 253 3.40.50.150
5x7fA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.959 50 253 3.40.50.150
af_A0A1D6EFY7_537_616_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9411 99 163 3.40.50.150
5lhmA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9371 50 255 3.40.50.150
af_Q9M266_77_290_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9357 43 253 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A7K0CVF0-F1-model_v4 Putative O-methyltransferase (EC 2.1.1.-) 0.9981 66 253 GO:0008171
GO:0008757
GO:0032259
AF-A0A1P8TFY4-F1-model_v4 deleted 0.9954 80 253
AF-A0A1D8G618-F1-model_v4 Putative O-methyltransferase/MSMEI_4947 (EC 2.1.1.-) 0.9953 77 254 GO:0008171
GO:0008757
GO:0032259
AF-A0A1I5DN64-F1-model_v4 Predicted O-methyltransferase YrrM 0.9948 80 253 GO:0008171
GO:0008757
GO:0032259
AF-A0A6N7HZH6-F1-model_v4 Methyltransferase domain-containing protein 0.9943 85 255 GO:0008171
GO:0008757
GO:0032259

Map