F428680

General Info

Members Datasets Scaffolds Average Seq Length
380 225 760 163

Family's Representative Sequence

Representative Sequence 3300025916|Ga0207663_10015498|Ga0207663_100154984
Length 181
Sequence VSMTAHGITPCLWFDTQAEEAAKFYASVFKDAKIGKTSRYGKEGVEVHGKQPGTVMTVAFEIAGQKFLALNGGPHFKFNEAVSFQVHCETQEEIDYFWSRLAEGGEEGPCGWLKDKFGLSWQVIPTALPQMLMDENSDKAQRVMRSMLQMRKIDLAALKRAGRLNAGSFNIENPERRESCQ

Samples

Sample ID Description Type Environment
1 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
4 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
5 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
6 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
7 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
8 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
9 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
10 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
11 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
12 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
13 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
54 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
55 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
56 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
57 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
58 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
59 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
60 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
64 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
65 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
66 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
69 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
74 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
81 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
82 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
92 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
93 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
131 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
132 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
133 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
134 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
135 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
136 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
137 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
138 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
139 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
140 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
141 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
142 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
143 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
144 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
145 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
146 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
147 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
148 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
149 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
150 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
151 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
152 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
153 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
154 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
155 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
156 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
157 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
158 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
159 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
160 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
161 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
162 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
163 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
164 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
165 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
166 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
167 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
168 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
169 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
170 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
171 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
172 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
173 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
174 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
175 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
176 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
177 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
178 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
192 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
193 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
194 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
195 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
196 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
197 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
198 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
199 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
200 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
201 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
202 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
203 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
204 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
205 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
206 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
209 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
210 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
211 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
212 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
213 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
214 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
215 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
216 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
217 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
218 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
219 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
220 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
221 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
222 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
223 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
224 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
225 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 99.21
Metatranscriptomes 0.53
Isolates 0.26

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.63
Nodule 0.26
Rhizoplane 8.42
Rhizosphere 87.63
Stem 0
Stem Tuber 0
Unclassified 6.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207663_10015498 3300025916 Bacteria 4206
2 MRS1b_contig_6211957 2162886011 Archaea 1107
3 ARcpr5oldR_c011621 3300000041 Bacteria 752
4 ARcpr5yngRDRAFT_c009505 3300000043 Bacteria 831
5 ARSoilOldRDRAFT_c000544 3300000044 Bacteria 4186
6 JGI24743J22301_10017914 3300001991 Bacteria 1334
7 JGI24033J26618_1029417 3300002155 Bacteria 734
8 JGI25404J52841_10063745 3300003659 Bacteria 771
9 Ga0055536_1009886 3300003781 Bacteria 3873
10 JGI25405J52794_10000053 3300003911 Archaea 12847
11 JGI25405J52794_10026329 3300003911 Bacteria 1194
12 Ga0065704_10006431 3300005289 Archaea 3753
13 Ga0065704_10075401 3300005289 Archaea 5614
14 Ga0065704_10154121 3300005289 Bacteria 1405
15 Ga0065704_10242077 3300005289 Archaea 1009
16 Ga0065712_10163482 3300005290 Archaea 1287
17 Ga0065715_10002719 3300005293 Archaea 4521
18 Ga0070683_100049252 3300005329 Unclassified 3896
19 Ga0070690_101321481 3300005330 Bacteria 578
20 Ga0070670_100032682 3300005331 Bacteria 4482
21 Ga0068869_100209371 3300005334 Archaea 1541
22 Ga0068868_100117739 3300005338 Unclassified 2164
23 Ga0070660_100885875 3300005339 Bacteria 752
24 Ga0070687_100053695 3300005343 Bacteria 2096
25 Ga0070661_100240451 3300005344 Bacteria 1394
26 Ga0070668_100417788 3300005347 Bacteria 1148
27 Ga0070668_100478433 3300005347 Bacteria 1075
28 Ga0070668_100992810 3300005347 Bacteria 754
29 Ga0070671_101493532 3300005355 Bacteria 598
30 Ga0070674_100145021 3300005356 Bacteria 1786
31 Ga0070674_101056234 3300005356 Bacteria 715
32 Ga0070709_10005087 3300005434 Archaea 7106
33 Ga0070709_10006008 3300005434 Bacteria 6599
34 Ga0070714_100016686 3300005435 Bacteria 5936
35 Ga0070714_100867603 3300005435 Bacteria 876
36 Ga0070714_101403001 3300005435 Bacteria 682
37 Ga0070714_101765740 3300005435 Bacteria 604
38 Ga0070713_100004910 3300005436 Bacteria 9075
39 Ga0070713_100032584 3300005436 Archaea 4164
40 Ga0070713_100102438 3300005436 Bacteria 2483
41 Ga0070713_100858443 3300005436 Bacteria 872
42 Ga0070710_10027674 3300005437 Bacteria 3025
43 Ga0070710_10029730 3300005437 Bacteria 2933
44 Ga0070711_100114556 3300005439 Bacteria 1984
45 Ga0070705_100308390 3300005440 Archaea 1137
46 Ga0070705_101602576 3300005440 Bacteria 548
47 Ga0070694_101664033 3300005444 Archaea 542
48 Ga0070708_100095872 3300005445 Archaea 2709
49 Ga0070663_100112489 3300005455 Bacteria 2048
50 Ga0070663_100583639 3300005455 Bacteria 938
51 Ga0070678_101100900 3300005456 Bacteria 733
52 Ga0070706_100084009 3300005467 Bacteria 2950
53 Ga0070706_100595581 3300005467 Bacteria 1027
54 Ga0070706_100684490 3300005467 Bacteria 951
55 Ga0070706_100851804 3300005467 Archaea 843
56 Ga0070707_100220346 3300005468 Archaea 1848
57 Ga0070707_100273692 3300005468 Bacteria 1641
58 Ga0070707_100509051 3300005468 Bacteria 1166
59 Ga0070698_100124907 3300005471 Archaea 2530
60 Ga0070699_100005972 3300005518 Bacteria 10635
61 Ga0070699_100089934 3300005518 Archaea 2683
62 Ga0070699_100268814 3300005518 Bacteria 1525
63 Ga0070699_100413416 3300005518 Bacteria 1220
64 Ga0070679_100384439 3300005530 Archaea 1350
65 Ga0070684_100366863 3300005535 Bacteria 1325
66 Ga0070697_100017030 3300005536 Bacteria 5715
67 Ga0070697_100056248 3300005536 Archaea 3200
68 Ga0070697_100056653 3300005536 Bacteria 3188
69 Ga0070697_100242414 3300005536 Bacteria 1540
70 Ga0070686_100384170 3300005544 Bacteria 1064
71 Ga0070693_100036435 3300005547 Unclassified 2735
72 Ga0070693_101083230 3300005547 Archaea 610
73 Ga0070704_100858174 3300005549 Archaea 814
74 Ga0070664_100196237 3300005564 Bacteria 1799
75 Ga0070664_101221929 3300005564 Bacteria 709
76 Ga0068854_100702568 3300005578 Unclassified 873
77 Ga0068856_101057512 3300005614 Bacteria 829
78 Ga0070702_100063675 3300005615 Archaea 2154
79 Ga0068864_100269525 3300005618 Bacteria 1586
80 Ga0068864_100847222 3300005618 Bacteria 901
81 Ga0068861_101105578 3300005719 Bacteria 762
82 Ga0068870_10525945 3300005840 Bacteria 792
83 Ga0068858_100591142 3300005842 Bacteria 1076
84 Ga0081455_10003119 3300005937 Bacteria 19301
85 Ga0081455_10011663 3300005937 Archaea 8815
86 Ga0081455_10021375 3300005937 Bacteria 6071
87 Ga0081455_10022034 3300005937 Bacteria 5964
88 Ga0081538_10018588 3300005981 Bacteria 5210
89 Ga0081538_10167294 3300005981 Bacteria 966
90 Ga0081540_1018941 3300005983 Bacteria 4204
91 Ga0081540_1038397 3300005983 Bacteria 2524
92 Ga0070717_10002089 3300006028 Bacteria 13994
93 Ga0070717_10018640 3300006028 Bacteria 5426
94 Ga0070717_10069743 3300006028 Bacteria 2928
95 Ga0070717_10074814 3300006028 Bacteria 2832
96 Ga0070717_10703719 3300006028 Bacteria 918
97 Ga0075365_10044120 3300006038 Bacteria 2920
98 Ga0070715_10001190 3300006163 Bacteria 7481
99 Ga0070715_10009869 3300006163 Unclassified 3381
100 Ga0070716_100000468 3300006173 Archaea 16701
101 Ga0070716_100088435 3300006173 Bacteria 1869
102 Ga0070712_100166783 3300006175 Bacteria 1705
103 Ga0070712_100393198 3300006175 Bacteria 1143
104 Ga0097621_100090585 3300006237 Bacteria 2559
105 Ga0068871_100297572 3300006358 Bacteria 1416
106 Ga0075428_100069473 3300006844 Bacteria 3851
107 Ga0075428_100134379 3300006844 Bacteria 2690
108 Ga0075430_100065222 3300006846 Bacteria 3059
109 Ga0075430_100274190 3300006846 Bacteria 1396
110 Ga0075430_100568055 3300006846 Archaea 936
111 Ga0075430_100883478 3300006846 Bacteria 736
112 Ga0075431_100128953 3300006847 Bacteria 2610
113 Ga0075433_11443481 3300006852 Bacteria 595
114 Ga0075434_100072446 3300006871 Unclassified 3437
115 Ga0075434_100176750 3300006871 Bacteria 2155
116 Ga0075434_100445186 3300006871 Bacteria 1317
117 Ga0075434_100561759 3300006871 Bacteria 1161
118 Ga0075429_100067908 3300006880 Bacteria 3103
119 Ga0075435_100199652 3300007076 Bacteria 1694
120 Ga0075435_100632525 3300007076 Bacteria 928
121 Ga0075435_101027468 3300007076 Bacteria 720
122 Ga0105240_11160631 3300009093 Bacteria 819
123 Ga0111539_10395932 3300009094 Bacteria 1609
124 Ga0111539_10414644 3300009094 Bacteria 1569
125 Ga0111539_11091939 3300009094 Archaea 927
126 Ga0105245_10183999 3300009098 Bacteria 1998
127 Ga0105247_10048883 3300009101 Bacteria 2599
128 Ga0105247_10515015 3300009101 Bacteria 874
129 Ga0114129_10028347 3300009147 Bacteria 7934
130 Ga0114129_10433420 3300009147 Bacteria 1727
131 Ga0114129_10440480 3300009147 Archaea 1710
132 Ga0114129_11172301 3300009147 Bacteria 958
133 Ga0114129_11278036 3300009147 Unclassified 910
134 Ga0114129_12403668 3300009147 Bacteria 631
135 Ga0105243_10615279 3300009148 Bacteria 1048
136 Ga0105248_10967448 3300009177 Bacteria 961
137 Ga0105237_10120902 3300009545 Unclassified 2613
138 Ga0105249_10717788 3300009553 Archaea 1060
139 Ga0105249_10865751 3300009553 Bacteria 970
140 Ga0105239_10309378 3300010375 Bacteria 1780
141 Ga0105239_10396777 3300010375 Archaea 1561
142 Ga0105239_10718805 3300010375 Archaea 1142
143 Ga0105239_10895059 3300010375 Bacteria 1019
144 Ga0105246_10067334 3300011119 Bacteria 2509
145 Ga0105246_10110831 3300011119 Bacteria 2016
146 Ga0105246_10254132 3300011119 Bacteria 1396
147 Ga0105246_10669343 3300011119 Archaea 906
148 Ga0157371_10084327 3300013102 Bacteria 2251
149 Ga0157369_10136242 3300013105 Bacteria 2599
150 Ga0157378_10016216 3300013297 Archaea 6526
151 Ga0157378_10054175 3300013297 Bacteria 3572
152 Ga0157378_10531390 3300013297 Archaea 1179
153 Ga0163162_10838915 3300013306 Bacteria 1035
154 Ga0163162_11750164 3300013306 Archaea 710
155 Ga0157372_10149515 3300013307 Unclassified 2695
156 Ga0157375_10122540 3300013308 Unclassified 2712
157 Ga0157375_11347302 3300013308 Bacteria 840
158 Ga0163163_10168330 3300014325 Bacteria 2238
159 Ga0163163_10749447 3300014325 Bacteria 1040
160 Ga0157377_10106331 3300014745 Bacteria 1680
161 Ga0157379_10214585 3300014968 Unclassified 1743
162 Ga0157379_10569296 3300014968 Bacteria 1055
163 Ga0157376_10249463 3300014969 Bacteria 1657
164 Ga0157376_10637404 3300014969 Bacteria 1065
165 Ga0206355_1628059 3300020076 Bacteria 518
166 Ga0206354_11454247 3300020081 Bacteria 652
167 Ga0209676_1000197 3300025292 Bacteria 135043
168 Ga0209050_1010336 3300025298 Bacteria 4610
169 Ga0207692_10004484 3300025898 Bacteria 5534
170 Ga0207692_10009879 3300025898 Bacteria 4000
171 Ga0207710_10265654 3300025900 Bacteria 861
172 Ga0207647_10435984 3300025904 Archaea 735
173 Ga0207685_10000161 3300025905 Archaea 10171
174 Ga0207685_10016438 3300025905 Bacteria 2369
175 Ga0207699_10012140 3300025906 Bacteria 4374
176 Ga0207684_10037347 3300025910 Bacteria 4121
177 Ga0207684_10063925 3300025910 Bacteria 3124
178 Ga0207684_10126735 3300025910 Archaea 2191
179 Ga0207684_10253224 3300025910 Bacteria 1519
180 Ga0207654_10624760 3300025911 Bacteria 770
181 Ga0207695_10863874 3300025913 Bacteria 784
182 Ga0207693_10022932 3300025915 Bacteria 4956
183 Ga0207663_10001072 3300025916 Archaea 12546
184 Ga0207662_10020265 3300025918 Bacteria 3793
185 Ga0207657_10755430 3300025919 Bacteria 753
186 Ga0207649_10391120 3300025920 Bacteria 1038
187 Ga0207646_10314189 3300025922 Unclassified 1416
188 Ga0207646_10598028 3300025922 Bacteria 990
189 Ga0207650_10003762 3300025925 Bacteria 10377
190 Ga0207700_10015023 3300025928 Bacteria 5092
191 Ga0207700_10397270 3300025928 Bacteria 1208
192 Ga0207664_10013610 3300025929 Bacteria 5848
193 Ga0207664_10559034 3300025929 Bacteria 1027
194 Ga0207686_10039946 3300025934 Archaea 2850
195 Ga0207709_10922104 3300025935 Bacteria 711
196 Ga0207670_10207623 3300025936 Bacteria 1492
197 Ga0207665_10003255 3300025939 Unclassified 10875
198 Ga0207665_10003519 3300025939 Bacteria 10459
199 Ga0207711_10331312 3300025941 Bacteria 1408
200 Ga0207661_10614138 3300025944 Bacteria 998
201 Ga0207679_10129327 3300025945 Bacteria 2023
202 Ga0207679_11250734 3300025945 Bacteria 681
203 Ga0207712_10625262 3300025961 Bacteria 934
204 Ga0207668_10483757 3300025972 Bacteria 1062
205 Ga0207640_10617696 3300025981 Archaea 920
206 Ga0207677_10129984 3300026023 Unclassified 1910
207 Ga0207703_10863857 3300026035 Bacteria 865
208 Ga0207678_10090644 3300026067 Bacteria 2613
209 Ga0207678_10620625 3300026067 Bacteria 949
210 Ga0207678_10875874 3300026067 Bacteria 794
211 Ga0207708_10117749 3300026075 Bacteria 2068
212 Ga0207708_11250620 3300026075 Bacteria 650
213 Ga0207702_10249821 3300026078 Bacteria 1665
214 Ga0207702_10590511 3300026078 Bacteria 1089
215 Ga0207676_10179962 3300026095 Bacteria 1850
216 Ga0207676_10752978 3300026095 Bacteria 947
217 Ga0207683_10067001 3300026121 Bacteria 3167
218 Ga0207698_11335830 3300026142 Bacteria 732
219 Ga0209974_10212953 3300027876 Archaea 717
220 Ga0207428_10370409 3300027907 Bacteria 1052
221 Ga0307517_10318464 3300028786 Bacteria 862
222 Ga0307513_10063272 3300031456 Bacteria 3905
223 Ga0307408_101146688 3300031548 Bacteria 723
224 Ga0316576_10797229 3300031727 Bacteria 680
225 Ga0307516_10307471 3300031730 Bacteria 1259
226 Ga0316577_10308993 3300031733 Bacteria 896
227 Ga0307413_10718481 3300031824 Bacteria 832
228 Ga0307410_10320362 3300031852 Bacteria 1230
229 Ga0307409_100241174 3300031995 Bacteria 1646
230 Ga0307416_100554332 3300032002 Bacteria 1223
231 Ga0307416_102148500 3300032002 Bacteria 660
232 Ga0307411_11083987 3300032005 Bacteria 721
233 Ga0373961_0003793 3300035241 Archaea 3694
234 Ga0316574_0123850 3300035398 Bacteria 1661
235 Ga0373931_0202652 3300035691 Bacteria 1186
236 Ga0373947_0491141 3300035725 Bacteria 834
237 Ga0316584_0031473 3300036712 Bacteria 3923
238 Ga0373925_0705766 3300037068 Bacteria 832
239 Ga0395900_0116564 3300037418 Bacteria 2741
240 Ga0395905_0562856 3300037471 Bacteria 1041
241 Ga0395901_0477466 3300038443 Bacteria 1272
242 Ga0436365_0553804 3300039437 Bacteria 1922
243 Ga0436360_0467598 3300039438 Bacteria 1275
244 Ga0439450_037167 3300042008 Archaea 1118
245 Ga0466968_0189592 3300044735 Bacteria 959
246 Ga0451576_1591546 3300045051 Archaea 678
247 Ga0495627_000058 3300046453 Bacteria 143802
248 Ga0495638_0134888 3300046460 Bacteria 1447
249 Ga0495582_0275894 3300046473 Bacteria 965
250 Ga0495605_0347001 3300046474 Bacteria 623
251 Ga0495632_0342782 3300046519 Bacteria 658
252 Ga0495593_0072433 3300047673 Bacteria 1789
253 Ga0496100_0056867 3300048903 Bacteria 2560
254 Ga0496100_0238290 3300048903 Bacteria 1341
255 Ga0496101_0059875 3300048904 Bacteria 2761
256 Ga0496102_0007259 3300048905 Bacteria 9459
257 Ga0496102_0582475 3300048905 Archaea 1042
258 Ga0496103_0006622 3300048906 Bacteria 6910
259 Ga0496103_0089866 3300048906 Archaea 1938
260 Ga0496103_0271319 3300048906 Bacteria 1091
261 Ga0496104_0008242 3300048907 Bacteria 9255
262 Ga0496104_0490812 3300048907 Bacteria 1139
263 Ga0496105_0004906 3300048908 Bacteria 10114
264 Ga0496106_0032237 3300048909 Bacteria 3906
265 Ga0496106_0102678 3300048909 Unclassified 2218
266 Ga0496106_0256212 3300048909 Archaea 1400
267 Ga0496107_0033773 3300048910 Bacteria 3661
268 Ga0496107_0040834 3300048910 Bacteria 3331
269 Ga0496107_0044629 3300048910 Bacteria 3187
270 Ga0496108_0015959 3300048911 Bacteria 6121
271 Ga0496108_0120864 3300048911 Bacteria 2246
272 Ga0496108_1293950 3300048911 Bacteria 613
273 Ga0496109_0004895 3300048912 Bacteria 11183
274 Ga0496110_0011909 3300048913 Bacteria 7145
275 Ga0496110_0323614 3300048913 Bacteria 1404
276 Ga0496110_0612593 3300048913 Bacteria 987
277 Ga0496111_0010319 3300048914 Bacteria 6262
278 Ga0496111_0150201 3300048914 Bacteria 1728
279 Ga0496111_0255721 3300048914 Bacteria 1299
280 Ga0496112_0000931 3300048915 Bacteria 21177
281 Ga0496113_0000165 3300048916 Bacteria 29345
282 Ga0496113_0599057 3300048916 Bacteria 882
283 Ga0496114_0509756 3300048917 Bacteria 1064
284 Ga0496115_0089778 3300048918 Unclassified 2510
285 Ga0501031_0009404 3300049568 Archaea 6351
286 Ga0501031_0454830 3300049568 Bacteria 827
287 Ga0501032_0103707 3300049569 Archaea 1884
288 Ga0501033_0003282 3300049570 Archaea 13384
289 Ga0501036_0001241 3300049572 Archaea 19513
290 Ga0501037_0015637 3300049573 Bacteria 5586
291 Ga0501038_0022090 3300049574 Bacteria 5704
292 Ga0501038_0149118 3300049574 Archaea 1907
293 Ga0501038_0386589 3300049574 Bacteria 1085
294 Ga0501039_0000627 3300049575 Archaea 25590
295 Ga0501039_0003541 3300049575 Bacteria 11699
296 Ga0501039_0239167 3300049575 Bacteria 1428
297 Ga0501040_0000393 3300049576 Archaea 25864
298 Ga0501040_0001593 3300049576 Bacteria 14460
299 Ga0501041_0000004 3300049577 Archaea 79389
300 Ga0501041_0003041 3300049577 Bacteria 9621
301 Ga0501041_0869775 3300049577 Bacteria 579
302 Ga0501042_0012537 3300049578 Bacteria 5744
303 Ga0501043_0133027 3300049579 Unclassified 1949
304 Ga0501046_0007219 3300049580 Bacteria 9766
305 Ga0501048_0241251 3300049582 Unclassified 1283
306 Ga0501068_0098588 3300049584 Archaea 1810
307 Ga0501068_0104780 3300049584 Bacteria 1755
308 Ga0501071_0000224 3300049587 Archaea 26106
309 Ga0501071_0007897 3300049587 Bacteria 7015
310 Ga0501071_0860111 3300049587 Bacteria 699
311 Ga0501072_0000222 3300049588 Archaea 41727
312 Ga0501072_0003614 3300049588 Bacteria 11639
313 Ga0501072_0648755 3300049588 Bacteria 831
314 Ga0501074_0003785 3300049590 Bacteria 10748
315 Ga0501075_0002953 3300049591 Bacteria 11376
316 Ga0501075_0013585 3300049591 Bacteria 5814
317 Ga0501075_0185205 3300049591 Bacteria 1588
318 Ga0501076_0000527 3300049592 Archaea 24320
319 Ga0501076_0014603 3300049592 Bacteria 5920
320 Ga0501076_0074086 3300049592 Bacteria 2727
321 Ga0501076_0662776 3300049592 Bacteria 861
322 Ga0501077_0000195 3300049593 Bacteria 34941
323 Ga0501077_0003090 3300049593 Unclassified 10011
324 Ga0501077_0124404 3300049593 Bacteria 1635
325 Ga0501243_037482 3300049675 Bacteria 843
326 Ga0501256_042533 3300049685 Bacteria 543
327 Ga0501225_0161224 3300049705 Archaea 690
328 Ga0501079_0000550 3300049741 Bacteria 24508
329 Ga0501079_0218679 3300049741 Bacteria 1488
330 Ga0501079_0328605 3300049741 Archaea 1197
331 Ga0501080_0068736 3300049742 Archaea 3295
332 Ga0501081_0003163 3300049743 Bacteria 10472
333 Ga0501081_0012512 3300049743 Archaea 5579
334 Ga0501081_0127838 3300049743 Bacteria 1814
335 Ga0501083_0033959 3300049744 Bacteria 3490
336 Ga0501083_0042095 3300049744 Unclassified 3098
337 Ga0501241_135480 3300049758 Unclassified 558
338 Ga0501035_0100870 3300049822 Bacteria 2534
339 Ga0501035_0125929 3300049822 Unclassified 2236
340 Ga0501044_0367845 3300049823 Bacteria 1355
341 Ga0501045_0000793 3300049824 Archaea 20343
342 Ga0501045_0004294 3300049824 Bacteria 9831
343 Ga0501045_0356441 3300049824 Bacteria 1089
344 nmdc:mga0yw44_10100_c1 3300050492 Bacteria 4806
345 nmdc:mga0yw44_122181_c1 3300050492 Bacteria 1678
346 nmdc:mga05p37_1528_c1 3300050507 Bacteria 7154
347 nmdc:mga05p37_158329_c1 3300050507 Bacteria 2767
348 nmdc:mga05p37_362533_c1 3300050507 Archaea 1703
349 nmdc:mga05p37_54023_c1 3300050507 Bacteria 4942
350 nmdc:mga0qj67_254315_c1 3300050509 Bacteria 1425
351 nmdc:mga0qj67_284307_c1 3300050509 Archaea 1340
352 nmdc:mga06r32_1379692_c1 3300050510 Bacteria 647
353 nmdc:mga06r32_191423_c1 3300050510 Bacteria 2033
354 nmdc:mga06r32_459992_c1 3300050510 Bacteria 1251
355 nmdc:mga06r32_77839_c1 3300050510 Bacteria 3222
356 nmdc:mga0n895_245546_c1 3300050512 Bacteria 1817
357 nmdc:mga0n895_305723_c1 3300050512 Bacteria 1612
358 nmdc:mga0n895_760612_c1 3300050512 Bacteria 961
359 nmdc:mga0rr50_128677_c1 3300050513 Unclassified 2025
360 nmdc:mga0rr50_332977_c1 3300050513 Bacteria 1275
361 nmdc:mga0rr50_387002_c1 3300050513 Bacteria 1180
362 nmdc:mga0rr50_807127_c1 3300050513 Bacteria 800
363 nmdc:mga08x19_380308_c1 3300050514 Bacteria 989
364 nmdc:mga08x19_478059_c1 3300050514 Bacteria 878
365 nmdc:mga08x19_875030_c1 3300050514 Bacteria 638
366 nmdc:mga0a205_405718_c1 3300050515 Bacteria 1226
367 Ga0495619_0099242 3300053085 Bacteria 1980
368 Ga0500556_0000032 3300053104 Bacteria 150774
369 Ga0500562_039014 3300053108 Bacteria 1262
370 Ga0500658_0416365 3300053134 Bacteria 614
371 Ga0500573_0000926 3300053140 Bacteria 13363
372 Ga0501084_0001686 3300054114 Bacteria 17565
373 Ga0501084_0021915 3300054114 Archaea 5328
374 Ga0501082_0000473 3300060353 Archaea 35519
375 Ga0501082_0006761 3300060353 Bacteria 9912
376 Ga0501082_0684348 3300060353 Unclassified 898
377 Ga0501082_1237799 3300060353 Bacteria 652
378 Ga0530510_0008140 3300061734 Bacteria 7314
379 Ga0530510_0105142 3300061734 Bacteria 2066
380 2513887534 2513237141 Bacteria 8496279
381 Ga0207663_10015498
382 MRS1b_contig_6211957
383 ARcpr5oldR_c011621
384 ARcpr5yngRDRAFT_c009505
385 ARSoilOldRDRAFT_c000544
386 JGI24743J22301_10017914
387 JGI24033J26618_1029417
388 JGI25404J52841_10063745
389 Ga0055536_1009886
390 JGI25405J52794_10000053
391 JGI25405J52794_10026329
392 Ga0065704_10006431
393 Ga0065704_10075401
394 Ga0065704_10154121
395 Ga0065704_10242077
396 Ga0065712_10163482
397 Ga0065715_10002719
398 Ga0070683_100049252
399 Ga0070690_101321481
400 Ga0070670_100032682
401 Ga0068869_100209371
402 Ga0068868_100117739
403 Ga0070660_100885875
404 Ga0070687_100053695
405 Ga0070661_100240451
406 Ga0070668_100417788
407 Ga0070668_100478433
408 Ga0070668_100992810
409 Ga0070671_101493532
410 Ga0070674_100145021
411 Ga0070674_101056234
412 Ga0070709_10005087
413 Ga0070709_10006008
414 Ga0070714_100016686
415 Ga0070714_100867603
416 Ga0070714_101403001
417 Ga0070714_101765740
418 Ga0070713_100004910
419 Ga0070713_100032584
420 Ga0070713_100102438
421 Ga0070713_100858443
422 Ga0070710_10027674
423 Ga0070710_10029730
424 Ga0070711_100114556
425 Ga0070705_100308390
426 Ga0070705_101602576
427 Ga0070694_101664033
428 Ga0070708_100095872
429 Ga0070663_100112489
430 Ga0070663_100583639
431 Ga0070678_101100900
432 Ga0070706_100084009
433 Ga0070706_100595581
434 Ga0070706_100684490
435 Ga0070706_100851804
436 Ga0070707_100220346
437 Ga0070707_100273692
438 Ga0070707_100509051
439 Ga0070698_100124907
440 Ga0070699_100005972
441 Ga0070699_100089934
442 Ga0070699_100268814
443 Ga0070699_100413416
444 Ga0070679_100384439
445 Ga0070684_100366863
446 Ga0070697_100017030
447 Ga0070697_100056248
448 Ga0070697_100056653
449 Ga0070697_100242414
450 Ga0070686_100384170
451 Ga0070693_100036435
452 Ga0070693_101083230
453 Ga0070704_100858174
454 Ga0070664_100196237
455 Ga0070664_101221929
456 Ga0068854_100702568
457 Ga0068856_101057512
458 Ga0070702_100063675
459 Ga0068864_100269525
460 Ga0068864_100847222
461 Ga0068861_101105578
462 Ga0068870_10525945
463 Ga0068858_100591142
464 Ga0081455_10003119
465 Ga0081455_10011663
466 Ga0081455_10021375
467 Ga0081455_10022034
468 Ga0081538_10018588
469 Ga0081538_10167294
470 Ga0081540_1018941
471 Ga0081540_1038397
472 Ga0070717_10002089
473 Ga0070717_10018640
474 Ga0070717_10069743
475 Ga0070717_10074814
476 Ga0070717_10703719
477 Ga0075365_10044120
478 Ga0070715_10001190
479 Ga0070715_10009869
480 Ga0070716_100000468
481 Ga0070716_100088435
482 Ga0070712_100166783
483 Ga0070712_100393198
484 Ga0097621_100090585
485 Ga0068871_100297572
486 Ga0075428_100069473
487 Ga0075428_100134379
488 Ga0075430_100065222
489 Ga0075430_100274190
490 Ga0075430_100568055
491 Ga0075430_100883478
492 Ga0075431_100128953
493 Ga0075433_11443481
494 Ga0075434_100072446
495 Ga0075434_100176750
496 Ga0075434_100445186
497 Ga0075434_100561759
498 Ga0075429_100067908
499 Ga0075435_100199652
500 Ga0075435_100632525
501 Ga0075435_101027468
502 Ga0105240_11160631
503 Ga0111539_10395932
504 Ga0111539_10414644
505 Ga0111539_11091939
506 Ga0105245_10183999
507 Ga0105247_10048883
508 Ga0105247_10515015
509 Ga0114129_10028347
510 Ga0114129_10433420
511 Ga0114129_10440480
512 Ga0114129_11172301
513 Ga0114129_11278036
514 Ga0114129_12403668
515 Ga0105243_10615279
516 Ga0105248_10967448
517 Ga0105237_10120902
518 Ga0105249_10717788
519 Ga0105249_10865751
520 Ga0105239_10309378
521 Ga0105239_10396777
522 Ga0105239_10718805
523 Ga0105239_10895059
524 Ga0105246_10067334
525 Ga0105246_10110831
526 Ga0105246_10254132
527 Ga0105246_10669343
528 Ga0157371_10084327
529 Ga0157369_10136242
530 Ga0157378_10016216
531 Ga0157378_10054175
532 Ga0157378_10531390
533 Ga0163162_10838915
534 Ga0163162_11750164
535 Ga0157372_10149515
536 Ga0157375_10122540
537 Ga0157375_11347302
538 Ga0163163_10168330
539 Ga0163163_10749447
540 Ga0157377_10106331
541 Ga0157379_10214585
542 Ga0157379_10569296
543 Ga0157376_10249463
544 Ga0157376_10637404
545 Ga0206355_1628059
546 Ga0206354_11454247
547 Ga0209676_1000197
548 Ga0209050_1010336
549 Ga0207692_10004484
550 Ga0207692_10009879
551 Ga0207710_10265654
552 Ga0207647_10435984
553 Ga0207685_10000161
554 Ga0207685_10016438
555 Ga0207699_10012140
556 Ga0207684_10037347
557 Ga0207684_10063925
558 Ga0207684_10126735
559 Ga0207684_10253224
560 Ga0207654_10624760
561 Ga0207695_10863874
562 Ga0207693_10022932
563 Ga0207663_10001072
564 Ga0207662_10020265
565 Ga0207657_10755430
566 Ga0207649_10391120
567 Ga0207646_10314189
568 Ga0207646_10598028
569 Ga0207650_10003762
570 Ga0207700_10015023
571 Ga0207700_10397270
572 Ga0207664_10013610
573 Ga0207664_10559034
574 Ga0207686_10039946
575 Ga0207709_10922104
576 Ga0207670_10207623
577 Ga0207665_10003255
578 Ga0207665_10003519
579 Ga0207711_10331312
580 Ga0207661_10614138
581 Ga0207679_10129327
582 Ga0207679_11250734
583 Ga0207712_10625262
584 Ga0207668_10483757
585 Ga0207640_10617696
586 Ga0207677_10129984
587 Ga0207703_10863857
588 Ga0207678_10090644
589 Ga0207678_10620625
590 Ga0207678_10875874
591 Ga0207708_10117749
592 Ga0207708_11250620
593 Ga0207702_10249821
594 Ga0207702_10590511
595 Ga0207676_10179962
596 Ga0207676_10752978
597 Ga0207683_10067001
598 Ga0207698_11335830
599 Ga0209974_10212953
600 Ga0207428_10370409
601 Ga0307517_10318464
602 Ga0307513_10063272
603 Ga0307408_101146688
604 Ga0316576_10797229
605 Ga0307516_10307471
606 Ga0316577_10308993
607 Ga0307413_10718481
608 Ga0307410_10320362
609 Ga0307409_100241174
610 Ga0307416_100554332
611 Ga0307416_102148500
612 Ga0307411_11083987
613 Ga0373961_0003793
614 Ga0316574_0123850
615 Ga0373931_0202652
616 Ga0373947_0491141
617 Ga0316584_0031473
618 Ga0373925_0705766
619 Ga0395900_0116564
620 Ga0395905_0562856
621 Ga0395901_0477466
622 Ga0436365_0553804
623 Ga0436360_0467598
624 Ga0439450_037167
625 Ga0466968_0189592
626 Ga0451576_1591546
627 Ga0495627_000058
628 Ga0495638_0134888
629 Ga0495582_0275894
630 Ga0495605_0347001
631 Ga0495632_0342782
632 Ga0495593_0072433
633 Ga0496100_0056867
634 Ga0496100_0238290
635 Ga0496101_0059875
636 Ga0496102_0007259
637 Ga0496102_0582475
638 Ga0496103_0006622
639 Ga0496103_0089866
640 Ga0496103_0271319
641 Ga0496104_0008242
642 Ga0496104_0490812
643 Ga0496105_0004906
644 Ga0496106_0032237
645 Ga0496106_0102678
646 Ga0496106_0256212
647 Ga0496107_0033773
648 Ga0496107_0040834
649 Ga0496107_0044629
650 Ga0496108_0015959
651 Ga0496108_0120864
652 Ga0496108_1293950
653 Ga0496109_0004895
654 Ga0496110_0011909
655 Ga0496110_0323614
656 Ga0496110_0612593
657 Ga0496111_0010319
658 Ga0496111_0150201
659 Ga0496111_0255721
660 Ga0496112_0000931
661 Ga0496113_0000165
662 Ga0496113_0599057
663 Ga0496114_0509756
664 Ga0496115_0089778
665 Ga0501031_0009404
666 Ga0501031_0454830
667 Ga0501032_0103707
668 Ga0501033_0003282
669 Ga0501036_0001241
670 Ga0501037_0015637
671 Ga0501038_0022090
672 Ga0501038_0149118
673 Ga0501038_0386589
674 Ga0501039_0000627
675 Ga0501039_0003541
676 Ga0501039_0239167
677 Ga0501040_0000393
678 Ga0501040_0001593
679 Ga0501041_0000004
680 Ga0501041_0003041
681 Ga0501041_0869775
682 Ga0501042_0012537
683 Ga0501043_0133027
684 Ga0501046_0007219
685 Ga0501048_0241251
686 Ga0501068_0098588
687 Ga0501068_0104780
688 Ga0501071_0000224
689 Ga0501071_0007897
690 Ga0501071_0860111
691 Ga0501072_0000222
692 Ga0501072_0003614
693 Ga0501072_0648755
694 Ga0501074_0003785
695 Ga0501075_0002953
696 Ga0501075_0013585
697 Ga0501075_0185205
698 Ga0501076_0000527
699 Ga0501076_0014603
700 Ga0501076_0074086
701 Ga0501076_0662776
702 Ga0501077_0000195
703 Ga0501077_0003090
704 Ga0501077_0124404
705 Ga0501243_037482
706 Ga0501256_042533
707 Ga0501225_0161224
708 Ga0501079_0000550
709 Ga0501079_0218679
710 Ga0501079_0328605
711 Ga0501080_0068736
712 Ga0501081_0003163
713 Ga0501081_0012512
714 Ga0501081_0127838
715 Ga0501083_0033959
716 Ga0501083_0042095
717 Ga0501241_135480
718 Ga0501035_0100870
719 Ga0501035_0125929
720 Ga0501044_0367845
721 Ga0501045_0000793
722 Ga0501045_0004294
723 Ga0501045_0356441
724 nmdc:mga0yw44_10100_c1
725 nmdc:mga0yw44_122181_c1
726 nmdc:mga05p37_1528_c1
727 nmdc:mga05p37_158329_c1
728 nmdc:mga05p37_362533_c1
729 nmdc:mga05p37_54023_c1
730 nmdc:mga0qj67_254315_c1
731 nmdc:mga0qj67_284307_c1
732 nmdc:mga06r32_1379692_c1
733 nmdc:mga06r32_191423_c1
734 nmdc:mga06r32_459992_c1
735 nmdc:mga06r32_77839_c1
736 nmdc:mga0n895_245546_c1
737 nmdc:mga0n895_305723_c1
738 nmdc:mga0n895_760612_c1
739 nmdc:mga0rr50_128677_c1
740 nmdc:mga0rr50_332977_c1
741 nmdc:mga0rr50_387002_c1
742 nmdc:mga0rr50_807127_c1
743 nmdc:mga08x19_380308_c1
744 nmdc:mga08x19_478059_c1
745 nmdc:mga08x19_875030_c1
746 nmdc:mga0a205_405718_c1
747 Ga0495619_0099242
748 Ga0500556_0000032
749 Ga0500562_039014
750 Ga0500658_0416365
751 Ga0500573_0000926
752 Ga0501084_0001686
753 Ga0501084_0021915
754 Ga0501082_0000473
755 Ga0501082_0006761
756 Ga0501082_0684348
757 Ga0501082_1237799
758 Ga0530510_0008140
759 Ga0530510_0105142
760 2513887534

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06983

3-dmu-9_3-mt

3-demethylubiquinone-9 3-methyltransferase

6

124

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
1u69-assembly1.cif.gz_A crystal structure of pa2721 protein of unknown function from pseudomonas aeruginosa pao1 0.9223 2 160
1u69-assembly2.cif.gz_D crystal structure of pa2721 protein of unknown function from pseudomonas aeruginosa pao1 0.9209 2 160
1u69-assembly3.cif.gz_C crystal structure of pa2721 protein of unknown function from pseudomonas aeruginosa pao1 0.9196 2 160
1u69-assembly1.cif.gz_A crystal structure of pa2721 protein of unknown function from pseudomonas aeruginosa pao1 0.9111 2 160
1u69-assembly2.cif.gz_D crystal structure of pa2721 protein of unknown function from pseudomonas aeruginosa pao1 0.9095 2 160
ID Description Score Start End Superfamily
1u69D00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9155 2 160 3.10.180.10
1u69D00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9043 2 160 3.10.180.10
3omsA01 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8433 8 67 3.30.720.100
3omsA01 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.7368 8 67 3.30.720.100
af_P16681_7_147_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.6988 8 119 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A423H0W3-F1-model_v4 PhnB-like domain-containing protein 0.9979 78 161
AF-I7ZHF7-F1-model_v4 Putative 3-demethylubiquinone-93-methyltransferase protein 0.9928 107 161 GO:0008168
GO:0032259
AF-A0A533ULV1-F1-model_v4 VOC family protein 0.9903 74 162
AF-A0A4V1SQP6-F1-model_v4 VOC family protein 0.9875 107 162
AF-A0A537CIB8-F1-model_v4 VOC family protein 0.9861 86 161

Map