F428649

General Info

Members Datasets Scaffolds Average Seq Length
380 212 377 155

Family's Representative Sequence

Representative Sequence 3300013102|Ga0157371_10758055|Ga0157371_107580552
Length 177
Sequence MAALTRLALSNFRNHADALIAPGPGFVILTGENGAGKTNILEAVSLLTPGRGLRGATLSDMARSDGPGGFAIGARLGEDVDLELGARAARACGLMILAQLNAALGSLDRVGRVVKLGAFVNSAAGFTDQPKVANGASDLMVEVFGDAGRHARSAVGVPVLPLGAAVEVDAIVALVEA

Samples

Sample ID Description Type Environment
1 2510917021 Novosphingobium sp. AP12 Isolate Rhizosphere
2 2882806704 Pelagerythrobacter rhizovicinus AY-3R Isolate Rhizosphere
3 2896184354 Aurantiacibacter suaedae GH3-15 Isolate Rhizosphere
4 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
45 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
46 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
47 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
48 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
49 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
50 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
51 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
52 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
53 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
55 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
59 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
63 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
64 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
65 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
66 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
71 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
72 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
73 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
112 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
117 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
118 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
119 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
120 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
121 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
122 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
123 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
124 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
125 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
126 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
127 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
128 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
129 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
130 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
131 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
132 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
133 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
134 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
135 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
136 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
137 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
138 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
139 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
140 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
141 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
142 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
143 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
144 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
145 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
146 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
147 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
148 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
149 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
150 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
151 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
152 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
153 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
154 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
155 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
156 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
157 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
158 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
159 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
160 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
161 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
162 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
163 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
164 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
165 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
166 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
167 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
168 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
169 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
170 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
171 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
172 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
173 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
174 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
175 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
176 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
177 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
178 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
179 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
180 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
181 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
192 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
194 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
195 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
196 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
197 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
198 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
199 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
200 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
201 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
202 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
203 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
204 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
205 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
206 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
207 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
208 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
209 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
210 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
211 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
212 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.95
Metatranscriptomes 0.26
Isolates 0.79

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.21
Nodule 0.26
Rhizoplane 3.95
Rhizosphere 75.26
Stem 0
Stem Tuber 0
Unclassified 6.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24738J21930_10010148 3300002075 Bacteria 2101
2 Ga0070658_10002481 3300005327 Bacteria 15415
3 Ga0070658_10002641 3300005327 Bacteria 14923
4 Ga0070658_10028651 3300005327 Bacteria 4472
5 Ga0070658_10120376 3300005327 Bacteria 2181
6 Ga0070683_100035800 3300005329 Bacteria 4538
7 Ga0070683_100155357 3300005329 Bacteria 2170
8 Ga0070683_100677911 3300005329 Bacteria 987
9 Ga0070690_100014897 3300005330 Bacteria 4624
10 Ga0070670_100016957 3300005331 Bacteria 6253
11 Ga0070670_101362734 3300005331 Bacteria 650
12 Ga0070666_10004871 3300005335 Bacteria 8205
13 Ga0070666_10361241 3300005335 Bacteria 1040
14 Ga0070680_100012761 3300005336 Bacteria 6533
15 Ga0070680_100281094 3300005336 Bacteria 1410
16 Ga0070682_101516675 3300005337 Bacteria 577
17 Ga0070660_100002885 3300005339 Bacteria 11827
18 Ga0070660_100015622 3300005339 Bacteria 5486
19 Ga0070691_10494619 3300005341 Bacteria 706
20 Ga0070661_100000507 3300005344 Bacteria 29896
21 Ga0070661_100238469 3300005344 Bacteria 1400
22 Ga0070668_100009192 3300005347 Bacteria 7328
23 Ga0070668_100045573 3300005347 Bacteria 3365
24 Ga0070669_100000266 3300005353 Bacteria 42790
25 Ga0070669_100000393 3300005353 Bacteria 33445
26 Ga0070671_100000005 3300005355 Bacteria 256547
27 Ga0070671_100003556 3300005355 Bacteria 12184
28 Ga0070659_100004145 3300005366 Bacteria 10335
29 Ga0070659_100067766 3300005366 Bacteria 2830
30 Ga0070667_100010228 3300005367 Bacteria 7751
31 Ga0070667_100010790 3300005367 Bacteria 7549
32 Ga0070713_100719703 3300005436 Bacteria 954
33 Ga0070663_100015997 3300005455 Bacteria 4858
34 Ga0070678_100234577 3300005456 Bacteria 1531
35 Ga0070662_100002012 3300005457 Bacteria 12451
36 Ga0070662_100006536 3300005457 Bacteria 7521
37 Ga0070662_100014552 3300005457 Bacteria 5260
38 Ga0070681_10014179 3300005458 Bacteria 7933
39 Ga0070685_11090112 3300005466 Bacteria 603
40 Ga0070679_100006615 3300005530 Bacteria 10802
41 Ga0070679_101383171 3300005530 Bacteria 650
42 Ga0070684_100161985 3300005535 Bacteria 2030
43 Ga0068853_100000191 3300005539 Bacteria 43207
44 Ga0068853_100185045 3300005539 Bacteria 1890
45 Ga0068853_100259122 3300005539 Bacteria 1598
46 Ga0070686_100029070 3300005544 Bacteria 3358
47 Ga0070665_100000150 3300005548 Bacteria 127885
48 Ga0070665_101739065 3300005548 Bacteria 631
49 Ga0068855_100008151 3300005563 Bacteria 12663
50 Ga0068855_100018010 3300005563 Bacteria 8488
51 Ga0068855_100021457 3300005563 Bacteria 7745
52 Ga0068855_100082676 3300005563 Bacteria 3721
53 Ga0070664_100007691 3300005564 Bacteria 8703
54 Ga0070664_100008974 3300005564 Bacteria 8107
55 Ga0068857_100044374 3300005577 Bacteria 3943
56 Ga0068857_100062982 3300005577 Bacteria 3297
57 Ga0068857_100224031 3300005577 Bacteria 1718
58 Ga0068854_100005234 3300005578 Bacteria 8184
59 Ga0068854_100035461 3300005578 Bacteria 3491
60 Ga0068854_100113624 3300005578 Bacteria 2046
61 Ga0068854_100656912 3300005578 Bacteria 901
62 Ga0068856_100002668 3300005614 Bacteria 18296
63 Ga0068856_100310060 3300005614 Bacteria 1596
64 Ga0068852_100000122 3300005616 Bacteria 52368
65 Ga0068852_100375189 3300005616 Bacteria 1394
66 Ga0068852_100408749 3300005616 Bacteria 1337
67 Ga0068859_100177232 3300005617 Bacteria 2214
68 Ga0068864_100019038 3300005618 Bacteria 5739
69 Ga0068864_100029172 3300005618 Bacteria 4668
70 Ga0068851_10090843 3300005834 Bacteria 1607
71 Ga0068863_100004376 3300005841 Bacteria 13926
72 Ga0068858_100038346 3300005842 Bacteria 4445
73 Ga0068858_100082270 3300005842 Bacteria 2992
74 Ga0068860_100021929 3300005843 Bacteria 6180
75 Ga0068860_100025975 3300005843 Bacteria 5650
76 Ga0068860_100275089 3300005843 Bacteria 1644
77 Ga0068862_100013509 3300005844 Bacteria 6763
78 Ga0075368_10000111 3300006042 Bacteria 21282
79 Ga0075363_100043258 3300006048 Bacteria 2382
80 Ga0075364_10029010 3300006051 Bacteria 3546
81 Ga0075364_10110339 3300006051 Bacteria 1835
82 Ga0075362_10000011 3300006177 Bacteria 108953
83 Ga0075362_10003732 3300006177 Bacteria 5383
84 Ga0075367_10030503 3300006178 Bacteria 3092
85 Ga0075367_10048742 3300006178 Bacteria 2496
86 Ga0075369_10019547 3300006186 Bacteria 2766
87 Ga0075369_10022365 3300006186 Bacteria 2607
88 Ga0075366_10000295 3300006195 Bacteria 22453
89 Ga0075366_10346431 3300006195 Bacteria 911
90 Ga0075366_10477551 3300006195 Bacteria 770
91 Ga0075370_10000004 3300006353 Bacteria 121166
92 Ga0075370_10042623 3300006353 Bacteria 2564
93 Ga0075370_10071458 3300006353 Bacteria 1985
94 Ga0075370_10457675 3300006353 Bacteria 768
95 Ga0075436_100093322 3300006914 Bacteria 2092
96 Ga0097620_100177247 3300006931 Bacteria 2214
97 Ga0079104_1036604 3300006946 Bacteria 1176
98 Ga0105251_10000694 3300009011 Bacteria 31101
99 Ga0105240_10017045 3300009093 Bacteria 9809
100 Ga0105240_10604894 3300009093 Bacteria 1206
101 Ga0111539_10295976 3300009094 Bacteria 1883
102 Ga0105247_10068931 3300009101 Bacteria 2206
103 Ga0105241_10684559 3300009174 Bacteria 935
104 Ga0105248_10016340 3300009177 Bacteria 8168
105 Ga0105248_10031840 3300009177 Bacteria 5892
106 Ga0105248_10155509 3300009177 Bacteria 2580
107 Ga0105238_10020313 3300009551 Bacteria 6761
108 Ga0105246_10000896 3300011119 Bacteria 17101
109 Ga0157373_10007639 3300013100 Bacteria 8031
110 Ga0157373_10019279 3300013100 Bacteria 4968
111 Ga0157371_10000938 3300013102 Bacteria 32583
112 Ga0157371_10758055 3300013102 Bacteria 729
113 Ga0157370_10000762 3300013104 Bacteria 40264
114 Ga0157370_10679665 3300013104 Bacteria 940
115 Ga0157369_10018279 3300013105 Bacteria 7863
116 Ga0163162_10253028 3300013306 Bacteria 1893
117 Ga0157372_10001396 3300013307 Bacteria 26027
118 Ga0157375_10063191 3300013308 Bacteria 3682
119 Ga0163163_10518378 3300014325 Bacteria 1254
120 Ga0163163_11039795 3300014325 Bacteria 882
121 Ga0157377_10164053 3300014745 Bacteria 1384
122 Ga0206356_10487225 3300020070 Bacteria 615
123 Ga0209050_1001670 3300025298 Bacteria 22344
124 Ga0207656_10341847 3300025321 Bacteria 746
125 Ga0207713_1001943 3300025735 Bacteria 15628
126 Ga0207710_10051875 3300025900 Bacteria 1843
127 Ga0207680_10067512 3300025903 Bacteria 2203
128 Ga0207647_10002569 3300025904 Bacteria 13734
129 Ga0207645_10555495 3300025907 Bacteria 779
130 Ga0207705_10000037 3300025909 Bacteria 197951
131 Ga0207705_10006653 3300025909 Bacteria 8552
132 Ga0207705_10147052 3300025909 Bacteria 1764
133 Ga0207705_10323211 3300025909 Bacteria 1186
134 Ga0207707_10013289 3300025912 Bacteria 7176
135 Ga0207695_10025876 3300025913 Bacteria 6558
136 Ga0207660_10016035 3300025917 Bacteria 4954
137 Ga0207660_10599140 3300025917 Bacteria 897
138 Ga0207657_10000227 3300025919 Bacteria 58998
139 Ga0207657_10062826 3300025919 Bacteria 3177
140 Ga0207649_10311489 3300025920 Bacteria 1154
141 Ga0207649_10795591 3300025920 Bacteria 738
142 Ga0207652_10031500 3300025921 Bacteria 4454
143 Ga0207652_11456456 3300025921 Bacteria 589
144 Ga0207681_10000062 3300025923 Bacteria 99856
145 Ga0207681_10002110 3300025923 Bacteria 12736
146 Ga0207694_10171461 3300025924 Bacteria 1757
147 Ga0207694_10824611 3300025924 Bacteria 784
148 Ga0207650_10054883 3300025925 Bacteria 2957
149 Ga0207650_10104014 3300025925 Bacteria 2190
150 Ga0207644_10000008 3300025931 Bacteria 354219
151 Ga0207644_10001703 3300025931 Bacteria 14193
152 Ga0207690_10001255 3300025932 Bacteria 16060
153 Ga0207706_10003155 3300025933 Bacteria 15829
154 Ga0207706_10014383 3300025933 Bacteria 7172
155 Ga0207709_10033820 3300025935 Bacteria 3006
156 Ga0207691_10273975 3300025940 Bacteria 1453
157 Ga0207711_10001097 3300025941 Bacteria 25808
158 Ga0207711_10318722 3300025941 Bacteria 1436
159 Ga0207711_11231133 3300025941 Bacteria 690
160 Ga0207661_10132709 3300025944 Bacteria 2135
161 Ga0207679_10002582 3300025945 Bacteria 11164
162 Ga0207679_10175041 3300025945 Bacteria 1770
163 Ga0207667_10003923 3300025949 Bacteria 18300
164 Ga0207667_10009894 3300025949 Bacteria 11185
165 Ga0207667_10015998 3300025949 Bacteria 8494
166 Ga0207667_10029281 3300025949 Bacteria 5973
167 Ga0207667_10146073 3300025949 Bacteria 2434
168 Ga0207668_10003592 3300025972 Bacteria 9113
169 Ga0207640_10012375 3300025981 Bacteria 4856
170 Ga0207640_10153397 3300025981 Bacteria 1695
171 Ga0207658_10002546 3300025986 Bacteria 13253
172 Ga0207658_10407710 3300025986 Bacteria 1196
173 Ga0207703_10087733 3300026035 Bacteria 2609
174 Ga0207639_10001018 3300026041 Bacteria 19073
175 Ga0207639_10084798 3300026041 Bacteria 2518
176 Ga0207639_10102017 3300026041 Bacteria 2321
177 Ga0207639_10249950 3300026041 Bacteria 1546
178 Ga0207639_10587845 3300026041 Bacteria 1025
179 Ga0207678_10055583 3300026067 Bacteria 3410
180 Ga0207702_10024465 3300026078 Bacteria 5012
181 Ga0207702_10127236 3300026078 Bacteria 2289
182 Ga0207641_10025589 3300026088 Bacteria 4866
183 Ga0207641_10135506 3300026088 Bacteria 2216
184 Ga0207676_10164122 3300026095 Bacteria 1928
185 Ga0207674_10068241 3300026116 Bacteria 3579
186 Ga0207674_10115685 3300026116 Bacteria 2653
187 Ga0207674_10171507 3300026116 Bacteria 2123
188 Ga0207683_10331923 3300026121 Bacteria 1394
189 Ga0207698_10000256 3300026142 Bacteria 32596
190 Ga0207698_10129305 3300026142 Bacteria 2155
191 Ga0207698_10205607 3300026142 Bacteria 1767
192 Ga0207698_10253863 3300026142 Bacteria 1611
193 Ga0207698_10392076 3300026142 Bacteria 1324
194 Ga0207698_11962968 3300026142 Bacteria 600
195 Ga0209813_10000138 3300027866 Bacteria 25302
196 Ga0209974_10187112 3300027876 Bacteria 760
197 Ga0268266_10000124 3300028379 Bacteria 153051
198 Ga0268266_10050873 3300028379 Bacteria 3556
199 Ga0268265_10006050 3300028380 Bacteria 8224
200 Ga0268265_10197095 3300028380 Bacteria 1744
201 Ga0268264_10023531 3300028381 Bacteria 5023
202 Ga0268264_10153050 3300028381 Bacteria 2070
203 Ga0307408_100007558 3300031548 Bacteria 7185
204 Ga0316576_10759221 3300031727 Bacteria 700
205 Ga0307405_10002149 3300031731 Bacteria 8601
206 Ga0307405_10034387 3300031731 Bacteria 3016
207 Ga0307405_10064993 3300031731 Bacteria 2321
208 Ga0307413_10088340 3300031824 Bacteria 2010
209 Ga0307413_10105104 3300031824 Bacteria 1876
210 Ga0307413_10192886 3300031824 Bacteria 1464
211 Ga0307413_10381607 3300031824 Bacteria 1098
212 Ga0307413_11498377 3300031824 Bacteria 596
213 Ga0307410_10087311 3300031852 Bacteria 2205
214 Ga0307410_10174004 3300031852 Bacteria 1625
215 Ga0307410_10193927 3300031852 Bacteria 1546
216 Ga0307410_10220911 3300031852 Bacteria 1457
217 Ga0307410_10421577 3300031852 Bacteria 1083
218 Ga0307406_10015460 3300031901 Bacteria 4417
219 Ga0307406_10120357 3300031901 Bacteria 1824
220 Ga0307406_10141163 3300031901 Bacteria 1705
221 Ga0307406_10598259 3300031901 Bacteria 909
222 Ga0307407_10035535 3300031903 Bacteria 2738
223 Ga0307407_10581337 3300031903 Bacteria 832
224 Ga0307412_10015842 3300031911 Bacteria 4477
225 Ga0307412_10038231 3300031911 Bacteria 3089
226 Ga0307412_10147888 3300031911 Bacteria 1729
227 Ga0307412_10318612 3300031911 Bacteria 1236
228 Ga0307412_11218629 3300031911 Bacteria 674
229 Ga0307409_100022719 3300031995 Bacteria 4327
230 Ga0307409_101137345 3300031995 Bacteria 803
231 Ga0307409_101532269 3300031995 Bacteria 694
232 Ga0307416_100058152 3300032002 Bacteria 3133
233 Ga0307416_100085127 3300032002 Bacteria 2689
234 Ga0307416_100178895 3300032002 Bacteria 1985
235 Ga0307416_100784702 3300032002 Bacteria 1047
236 Ga0307416_100955638 3300032002 Bacteria 959
237 Ga0307416_101570937 3300032002 Bacteria 763
238 Ga0307414_10030405 3300032004 Bacteria 3527
239 Ga0307414_10123452 3300032004 Bacteria 1995
240 Ga0307414_10250342 3300032004 Bacteria 1472
241 Ga0307414_10322997 3300032004 Bacteria 1314
242 Ga0307414_10354553 3300032004 Bacteria 1260
243 Ga0307414_10591287 3300032004 Bacteria 994
244 Ga0307411_10108583 3300032005 Bacteria 1980
245 Ga0307411_10121896 3300032005 Bacteria 1888
246 Ga0307411_10181842 3300032005 Bacteria 1597
247 Ga0307411_10347821 3300032005 Bacteria 1207
248 Ga0307411_10871807 3300032005 Bacteria 798
249 Ga0307415_100045881 3300032126 Bacteria 2933
250 Ga0307415_100048837 3300032126 Bacteria 2857
251 Ga0307415_100606962 3300032126 Bacteria 975
252 Ga0307415_100751480 3300032126 Bacteria 885
253 Ga0373948_0009357 3300034817 Bacteria 1688
254 Ga0373932_0022153 3300035112 Bacteria 1685
255 Ga0395900_0001302 3300037418 Bacteria 30375
256 Ga0395900_0055234 3300037418 Bacteria 4089
257 Ga0395905_0040414 3300037471 Bacteria 4375
258 Ga0395901_0000131 3300038443 Bacteria 96504
259 Ga0395901_0087152 3300038443 Bacteria 3264
260 Ga0451843_0204349 3300041509 Bacteria 2496
261 Ga0451853_1296698 3300041512 Bacteria 903
262 Ga0451853_1869091 3300041512 Bacteria 685
263 Ga0451853_3454958 3300041512 Bacteria 618
264 Ga0439448_0379228 3300042005 Bacteria 505
265 Ga0466972_0324747 3300044658 Bacteria 719
266 Ga0466963_0011625 3300044694 Bacteria 5360
267 Ga0466957_0277288 3300044842 Bacteria 1121
268 Ga0466967_0017556 3300045976 Bacteria 5687
269 Ga0466967_0385204 3300045976 Bacteria 1362
270 Ga0466967_0610713 3300045976 Bacteria 1077
271 Ga0495638_0028154 3300046460 Bacteria 3631
272 Ga0495638_0097715 3300046460 Bacteria 1760
273 Ga0495638_0112986 3300046460 Bacteria 1612
274 Ga0495596_0000226 3300046500 Bacteria 38225
275 Ga0495596_0003844 3300046500 Bacteria 7462
276 Ga0495610_0001472 3300046512 Bacteria 20775
277 Ga0495620_0178790 3300046515 Bacteria 821
278 Ga0495631_0256651 3300046518 Bacteria 745
279 Ga0495643_0026283 3300046522 Bacteria 3286
280 Ga0495643_0094254 3300046522 Bacteria 1541
281 Ga0495609_0017095 3300046538 Bacteria 3372
282 Ga0495621_0020526 3300046539 Bacteria 2169
283 Ga0495668_0051731 3300046616 Bacteria 2274
284 Ga0495668_0184342 3300046616 Bacteria 1143
285 Ga0495625_0010394 3300046660 Bacteria 7707
286 Ga0495625_0318407 3300046660 Bacteria 991
287 Ga0495670_0049104 3300046691 Bacteria 2111
288 Ga0495671_0016625 3300046692 Bacteria 3926
289 Ga0495686_0523149 3300047472 Bacteria 622
290 Ga0495615_0011944 3300048090 Bacteria 1779
291 Ga0495626_0000346 3300048091 Bacteria 48769
292 Ga0496100_0224231 3300048903 Bacteria 1380
293 Ga0496100_1478584 3300048903 Bacteria 536
294 Ga0496101_0032170 3300048904 Bacteria 3690
295 Ga0496102_0656719 3300048905 Bacteria 972
296 Ga0496103_0030838 3300048906 Bacteria 3264
297 Ga0496103_0085040 3300048906 Bacteria 1993
298 Ga0496104_0216369 3300048907 Bacteria 1827
299 Ga0496105_0040419 3300048908 Bacteria 3845
300 Ga0496106_0025330 3300048909 Bacteria 4414
301 Ga0496107_0000222 3300048910 Bacteria 30025
302 Ga0496108_0668022 3300048911 Bacteria 902
303 Ga0496109_0139276 3300048912 Bacteria 2268
304 Ga0496110_0042442 3300048913 Bacteria 3969
305 Ga0496113_0068029 3300048916 Bacteria 2702
306 Ga0496114_0088885 3300048917 Bacteria 2621
307 Ga0496116_0000045 3300048919 Bacteria 324307
308 Ga0496116_0105157 3300048919 Bacteria 1675
309 Ga0496117_0015740 3300048920 Bacteria 6423
310 Ga0496117_0066447 3300048920 Bacteria 2446
311 Ga0496118_0027493 3300048921 Bacteria 4813
312 Ga0496119_0030505 3300048922 Bacteria 3633
313 Ga0496120_0134271 3300048923 Bacteria 1264
314 Ga0496121_0007888 3300048924 Bacteria 12739
315 Ga0496121_0044956 3300048924 Bacteria 3801
316 Ga0496121_0088816 3300048924 Bacteria 2422
317 Ga0496122_0006623 3300048925 Bacteria 13212
318 Ga0496123_0006282 3300048926 Bacteria 11563
319 Ga0496124_0064546 3300048927 Bacteria 3055
320 Ga0496124_0066544 3300048927 Bacteria 3000
321 Ga0496124_0120767 3300048927 Bacteria 2094
322 Ga0496124_0343690 3300048927 Bacteria 1058
323 Ga0496125_0011111 3300048928 Bacteria 9031
324 Ga0496125_0026441 3300048928 Bacteria 5288
325 Ga0496126_0000568 3300048929 Bacteria 70707
326 Ga0496126_0727325 3300048929 Bacteria 769
327 Ga0495682_0208903 3300049460 Bacteria 692
328 Ga0501031_0919128 3300049568 Bacteria 560
329 Ga0501032_0323046 3300049569 Bacteria 996
330 Ga0501033_0208943 3300049570 Bacteria 1392
331 Ga0501034_0182575 3300049571 Bacteria 2063
332 Ga0501034_0758761 3300049571 Bacteria 865
333 Ga0501036_0961952 3300049572 Bacteria 700
334 Ga0501037_0712920 3300049573 Bacteria 667
335 Ga0501039_0222770 3300049575 Bacteria 1483
336 Ga0501042_0116023 3300049578 Bacteria 1928
337 Ga0501043_0267522 3300049579 Bacteria 1313
338 Ga0501047_0682530 3300049581 Bacteria 845
339 Ga0501070_0736303 3300049586 Bacteria 778
340 Ga0501035_0275868 3300049822 Bacteria 1422
341 Ga0501044_0016615 3300049823 Bacteria 7900
342 Ga0501044_0355335 3300049823 Bacteria 1384
343 nmdc:mga03683_193_c1 3300050489 Bacteria 20052
344 nmdc:mga03683_31940_c1 3300050489 Bacteria 2115
345 nmdc:mga03683_37_c1 3300050489 Bacteria 63604
346 nmdc:mga03n38_194_c1 3300050490 Bacteria 13831
347 nmdc:mga03n38_2320_c1 3300050490 Bacteria 5841
348 nmdc:mga00v17_210007_c1 3300050491 Bacteria 1260
349 nmdc:mga00v17_24287_c1 3300050491 Bacteria 3514
350 nmdc:mga00v17_3287_c1 3300050491 Bacteria 1915
351 nmdc:mga00v17_63149_c1 3300050491 Bacteria 2280
352 nmdc:mga00v17_853116_c1 3300050491 Bacteria 578
353 nmdc:mga0yw44_121926_c1 3300050492 Bacteria 1680
354 nmdc:mga0k408_140671_c1 3300050493 Bacteria 1436
355 nmdc:mga0k408_18_c1 3300050493 Bacteria 112318
356 nmdc:mga06z11_4461_c1 3300050494 Bacteria 5508
357 nmdc:mga06z11_8840_c1 3300050494 Bacteria 4219
358 nmdc:mga04h51_320_c1 3300050495 Bacteria 12120
359 nmdc:mga07m45_169635_c1 3300050496 Bacteria 1268
360 nmdc:mga07m45_19_c1 3300050496 Bacteria 133476
361 nmdc:mga07m45_449_c1 3300050496 Bacteria 17223
362 nmdc:mga07m45_64_c1 3300050496 Bacteria 41841
363 nmdc:mga0sz30_157153_c1 3300050516 Bacteria 1007
364 nmdc:mga0sz30_508_c1 3300050516 Bacteria 14498
365 nmdc:mga0sz30_60916_c1 3300050516 Bacteria 1238
366 Ga0500643_000039 3300053087 Bacteria 169629
367 Ga0500643_023678 3300053087 Bacteria 1959
368 Ga0500562_076088 3300053108 Bacteria 907
369 Ga0500592_011312 3300053116 Bacteria 1426
370 Ga0500594_0011659 3300053118 Bacteria 2055
371 Ga0500607_000152 3300053121 Bacteria 59345
372 Ga0500559_0000524 3300053136 Bacteria 26811
373 Ga0500616_0001209 3300053153 Bacteria 26110
374 Ga0500622_0001350 3300053156 Bacteria 19863
375 Ga0500637_0188159 3300053178 Bacteria 1180
376 Ga0500645_002769 3300053730 Bacteria 7579
377 Ga0500645_002911 3300053730 Bacteria 7297

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025924 Ga0207694_10824611 Ga0207694_108246112 143
2 3300027876 Ga0209974_10187112 Ga0209974_101871122 143
3 3300046539 Ga0495621_0020526 Ga0495621_0020526_1443_1901 143
4 3300028380 Ga0268265_10197095 Ga0268265_101970951 144
5 3300041512 Ga0451853_1869091 Ga0451853_1869091_146_607 145
6 iso_pu_bacteria 2882806704 2882809504 148
7 3300013102 Ga0157371_10758055 Ga0157371_107580552 149
8 iso_pu_bacteria 2896184354 2896185983 149
9 iso_pu_bacteria 2510917021 2511130808 150
10 3300049570 Ga0501033_0208943 Ga0501033_0208943_683_1138 151
11 3300049822 Ga0501035_0275868 Ga0501035_0275868_746_1201 151
12 3300005329 Ga0070683_100677911 Ga0070683_1006779112 152
13 3300005436 Ga0070713_100719703 Ga0070713_1007197031 152
14 3300031548 Ga0307408_100007558 Ga0307408_1000075588 152
15 3300031731 Ga0307405_10002149 Ga0307405_100021496 152
16 3300031824 Ga0307413_10192886 Ga0307413_101928862 152
17 3300031852 Ga0307410_10174004 Ga0307410_101740043 152
18 3300031852 Ga0307410_10193927 Ga0307410_101939272 152
19 3300031901 Ga0307406_10015460 Ga0307406_100154607 152
20 3300031911 Ga0307412_10015842 Ga0307412_100158427 152
21 3300031995 Ga0307409_101137345 Ga0307409_1011373451 152
22 3300032002 Ga0307416_100058152 Ga0307416_1000581524 152
23 3300032002 Ga0307416_100085127 Ga0307416_1000851274 152
24 3300032004 Ga0307414_10123452 Ga0307414_101234524 152
25 3300032005 Ga0307411_10108583 Ga0307411_101085833 152
26 3300032005 Ga0307411_10347821 Ga0307411_103478212 152
27 3300032005 Ga0307411_10871807 Ga0307411_108718071 152
28 3300032126 Ga0307415_100048837 Ga0307415_1000488372 152
29 3300037418 Ga0395900_0001302 Ga0395900_0001302_14543_15004 152
30 3300037418 Ga0395900_0055234 Ga0395900_0055234_3206_3667 152
31 3300037471 Ga0395905_0040414 Ga0395905_0040414_3743_4204 152
32 3300038443 Ga0395901_0000131 Ga0395901_0000131_69791_70252 152
33 3300038443 Ga0395901_0087152 Ga0395901_0087152_471_932 152
34 3300041509 Ga0451843_0204349 Ga0451843_0204349_1687_2154 152
35 3300044658 Ga0466972_0324747 Ga0466972_0324747_67_528 152
36 3300044694 Ga0466963_0011625 Ga0466963_0011625_3899_4360 152
37 3300044842 Ga0466957_0277288 Ga0466957_0277288_184_645 152
38 3300045976 Ga0466967_0017556 Ga0466967_0017556_505_966 152
39 3300045976 Ga0466967_0385204 Ga0466967_0385204_263_724 152
40 3300045976 Ga0466967_0610713 Ga0466967_0610713_587_1048 152
41 3300049571 Ga0501034_0182575 Ga0501034_0182575_458_916 152
42 3300049573 Ga0501037_0712920 Ga0501037_0712920_185_643 152
43 3300049578 Ga0501042_0116023 Ga0501042_0116023_532_990 152
44 3300049823 Ga0501044_0355335 Ga0501044_0355335_395_853 152
45 3300002075 JGI24738J21930_10010148 JGI24738J21930_100101484 153
46 3300005327 Ga0070658_10002481 Ga0070658_100024818 153
47 3300005327 Ga0070658_10002641 Ga0070658_1000264111 153
48 3300005327 Ga0070658_10028651 Ga0070658_100286513 153
49 3300005327 Ga0070658_10120376 Ga0070658_101203763 153
50 3300005329 Ga0070683_100035800 Ga0070683_1000358003 153
51 3300005329 Ga0070683_100155357 Ga0070683_1001553572 153
52 3300005330 Ga0070690_100014897 Ga0070690_1000148976 153
53 3300005331 Ga0070670_100016957 Ga0070670_1000169572 153
54 3300005331 Ga0070670_101362734 Ga0070670_1013627341 153
55 3300005335 Ga0070666_10004871 Ga0070666_100048713 153
56 3300005335 Ga0070666_10361241 Ga0070666_103612412 153
57 3300005336 Ga0070680_100012761 Ga0070680_1000127614 153
58 3300005336 Ga0070680_100281094 Ga0070680_1002810943 153
59 3300005337 Ga0070682_101516675 Ga0070682_1015166751 153
60 3300005339 Ga0070660_100002885 Ga0070660_1000028859 153
61 3300005339 Ga0070660_100015622 Ga0070660_1000156225 153
62 3300005341 Ga0070691_10494619 Ga0070691_104946192 153
63 3300005344 Ga0070661_100000507 Ga0070661_1000005074 153
64 3300005344 Ga0070661_100238469 Ga0070661_1002384692 153
65 3300005347 Ga0070668_100009192 Ga0070668_1000091923 153
66 3300005347 Ga0070668_100045573 Ga0070668_1000455733 153
67 3300005353 Ga0070669_100000266 Ga0070669_10000026637 153
68 3300005353 Ga0070669_100000393 Ga0070669_10000039324 153
69 3300005355 Ga0070671_100000005 Ga0070671_100000005259 153
70 3300005355 Ga0070671_100003556 Ga0070671_1000035568 153
71 3300005366 Ga0070659_100004145 Ga0070659_10000414510 153
72 3300005366 Ga0070659_100067766 Ga0070659_1000677662 153
73 3300005367 Ga0070667_100010228 Ga0070667_10001022810 153
74 3300005367 Ga0070667_100010790 Ga0070667_1000107909 153
75 3300005455 Ga0070663_100015997 Ga0070663_1000159971 153
76 3300005456 Ga0070678_100234577 Ga0070678_1002345772 153
77 3300005457 Ga0070662_100002012 Ga0070662_1000020127 153
78 3300005457 Ga0070662_100006536 Ga0070662_1000065363 153
79 3300005457 Ga0070662_100014552 Ga0070662_1000145523 153
80 3300005458 Ga0070681_10014179 Ga0070681_100141797 153
81 3300005466 Ga0070685_11090112 Ga0070685_110901121 153
82 3300005530 Ga0070679_100006615 Ga0070679_1000066157 153
83 3300005530 Ga0070679_101383171 Ga0070679_1013831711 153
84 3300005535 Ga0070684_100161985 Ga0070684_1001619852 153
85 3300005539 Ga0068853_100000191 Ga0068853_10000019141 153
86 3300005539 Ga0068853_100185045 Ga0068853_1001850452 153
87 3300005539 Ga0068853_100259122 Ga0068853_1002591223 153
88 3300005544 Ga0070686_100029070 Ga0070686_1000290704 153
89 3300005548 Ga0070665_100000150 Ga0070665_100000150106 153
90 3300005548 Ga0070665_101739065 Ga0070665_1017390652 153
91 3300005563 Ga0068855_100008151 Ga0068855_1000081516 153
92 3300005563 Ga0068855_100018010 Ga0068855_10001801010 153
93 3300005563 Ga0068855_100021457 Ga0068855_1000214577 153
94 3300005563 Ga0068855_100082676 Ga0068855_1000826763 153
95 3300005564 Ga0070664_100007691 Ga0070664_10000769110 153
96 3300005564 Ga0070664_100008974 Ga0070664_1000089747 153
97 3300005577 Ga0068857_100044374 Ga0068857_1000443742 153
98 3300005577 Ga0068857_100062982 Ga0068857_1000629824 153
99 3300005577 Ga0068857_100224031 Ga0068857_1002240312 153
100 3300005578 Ga0068854_100005234 Ga0068854_1000052345 153
101 3300005578 Ga0068854_100035461 Ga0068854_1000354612 153
102 3300005578 Ga0068854_100113624 Ga0068854_1001136243 153
103 3300005578 Ga0068854_100656912 Ga0068854_1006569122 153
104 3300005614 Ga0068856_100002668 Ga0068856_1000026688 153
105 3300005614 Ga0068856_100310060 Ga0068856_1003100603 153
106 3300005616 Ga0068852_100000122 Ga0068852_10000012211 153
107 3300005616 Ga0068852_100375189 Ga0068852_1003751892 153
108 3300005616 Ga0068852_100408749 Ga0068852_1004087492 153
109 3300005617 Ga0068859_100177232 Ga0068859_1001772323 153
110 3300005618 Ga0068864_100019038 Ga0068864_1000190386 153
111 3300005618 Ga0068864_100029172 Ga0068864_1000291727 153
112 3300005834 Ga0068851_10090843 Ga0068851_100908432 153
113 3300005841 Ga0068863_100004376 Ga0068863_10000437614 153
114 3300005842 Ga0068858_100038346 Ga0068858_1000383462 153
115 3300005842 Ga0068858_100082270 Ga0068858_1000822703 153
116 3300005843 Ga0068860_100021929 Ga0068860_1000219296 153
117 3300005843 Ga0068860_100025975 Ga0068860_1000259757 153
118 3300005843 Ga0068860_100275089 Ga0068860_1002750893 153
119 3300005844 Ga0068862_100013509 Ga0068862_1000135097 153
120 3300006042 Ga0075368_10000111 Ga0075368_1000011121 153
121 3300006048 Ga0075363_100043258 Ga0075363_1000432583 153
122 3300006051 Ga0075364_10029010 Ga0075364_100290106 153
123 3300006051 Ga0075364_10110339 Ga0075364_101103393 153
124 3300006177 Ga0075362_10000011 Ga0075362_1000001143 153
125 3300006177 Ga0075362_10003732 Ga0075362_100037327 153
126 3300006178 Ga0075367_10030503 Ga0075367_100305034 153
127 3300006178 Ga0075367_10048742 Ga0075367_100487422 153
128 3300006186 Ga0075369_10019547 Ga0075369_100195473 153
129 3300006186 Ga0075369_10022365 Ga0075369_100223654 153
130 3300006195 Ga0075366_10000295 Ga0075366_100002952 153
131 3300006195 Ga0075366_10346431 Ga0075366_103464312 153
132 3300006195 Ga0075366_10477551 Ga0075366_104775511 153
133 3300006353 Ga0075370_10000004 Ga0075370_1000000430 153
134 3300006353 Ga0075370_10042623 Ga0075370_100426233 153
135 3300006353 Ga0075370_10071458 Ga0075370_100714583 153
136 3300006353 Ga0075370_10457675 Ga0075370_104576752 153
137 3300006914 Ga0075436_100093322 Ga0075436_1000933223 153
138 3300006931 Ga0097620_100177247 Ga0097620_1001772472 153
139 3300006946 Ga0079104_1036604 Ga0079104_10366041 153
140 3300009011 Ga0105251_10000694 Ga0105251_100006949 153
141 3300009093 Ga0105240_10017045 Ga0105240_1001704511 153
142 3300009093 Ga0105240_10604894 Ga0105240_106048942 153
143 3300009094 Ga0111539_10295976 Ga0111539_102959762 153
144 3300009101 Ga0105247_10068931 Ga0105247_100689313 153
145 3300009174 Ga0105241_10684559 Ga0105241_106845592 153
146 3300009177 Ga0105248_10016340 Ga0105248_1001634011 153
147 3300009177 Ga0105248_10031840 Ga0105248_100318407 153
148 3300009177 Ga0105248_10155509 Ga0105248_101555093 153
149 3300009551 Ga0105238_10020313 Ga0105238_1002031311 153
150 3300011119 Ga0105246_10000896 Ga0105246_1000089614 153
151 3300013100 Ga0157373_10007639 Ga0157373_100076397 153
152 3300013100 Ga0157373_10019279 Ga0157373_100192795 153
153 3300013102 Ga0157371_10000938 Ga0157371_100009389 153
154 3300013104 Ga0157370_10000762 Ga0157370_1000076240 153
155 3300013104 Ga0157370_10679665 Ga0157370_106796652 153
156 3300013105 Ga0157369_10018279 Ga0157369_1001827910 153
157 3300013306 Ga0163162_10253028 Ga0163162_102530282 153
158 3300013307 Ga0157372_10001396 Ga0157372_1000139613 153
159 3300013308 Ga0157375_10063191 Ga0157375_100631916 153
160 3300014325 Ga0163163_10518378 Ga0163163_105183782 153
161 3300014325 Ga0163163_11039795 Ga0163163_110397952 153
162 3300014745 Ga0157377_10164053 Ga0157377_101640532 153
163 3300020070 Ga0206356_10487225 Ga0206356_104872252 153
164 3300025298 Ga0209050_1001670 Ga0209050_100167011 153
165 3300025321 Ga0207656_10341847 Ga0207656_103418472 153
166 3300025735 Ga0207713_1001943 Ga0207713_100194312 153
167 3300025900 Ga0207710_10051875 Ga0207710_100518754 153
168 3300025903 Ga0207680_10067512 Ga0207680_100675121 153
169 3300025904 Ga0207647_10002569 Ga0207647_1000256910 153
170 3300025907 Ga0207645_10555495 Ga0207645_105554952 153
171 3300025909 Ga0207705_10000037 Ga0207705_10000037122 153
172 3300025909 Ga0207705_10006653 Ga0207705_100066538 153
173 3300025909 Ga0207705_10147052 Ga0207705_101470523 153
174 3300025909 Ga0207705_10323211 Ga0207705_103232112 153
175 3300025912 Ga0207707_10013289 Ga0207707_100132895 153
176 3300025913 Ga0207695_10025876 Ga0207695_100258762 153
177 3300025917 Ga0207660_10016035 Ga0207660_100160354 153
178 3300025917 Ga0207660_10599140 Ga0207660_105991402 153
179 3300025919 Ga0207657_10000227 Ga0207657_1000022719 153
180 3300025919 Ga0207657_10062826 Ga0207657_100628263 153
181 3300025920 Ga0207649_10311489 Ga0207649_103114892 153
182 3300025920 Ga0207649_10795591 Ga0207649_107955912 153
183 3300025921 Ga0207652_10031500 Ga0207652_100315003 153
184 3300025921 Ga0207652_11456456 Ga0207652_114564561 153
185 3300025923 Ga0207681_10000062 Ga0207681_1000006268 153
186 3300025923 Ga0207681_10002110 Ga0207681_1000211013 153
187 3300025924 Ga0207694_10171461 Ga0207694_101714612 153
188 3300025925 Ga0207650_10054883 Ga0207650_100548832 153
189 3300025925 Ga0207650_10104014 Ga0207650_101040143 153
190 3300025931 Ga0207644_10000008 Ga0207644_1000000866 153
191 3300025931 Ga0207644_10001703 Ga0207644_1000170312 153
192 3300025932 Ga0207690_10001255 Ga0207690_1000125511 153
193 3300025933 Ga0207706_10003155 Ga0207706_100031557 153
194 3300025933 Ga0207706_10014383 Ga0207706_100143834 153
195 3300025935 Ga0207709_10033820 Ga0207709_100338205 153
196 3300025940 Ga0207691_10273975 Ga0207691_102739752 153
197 3300025941 Ga0207711_10001097 Ga0207711_1000109711 153
198 3300025941 Ga0207711_10318722 Ga0207711_103187222 153
199 3300025941 Ga0207711_11231133 Ga0207711_112311331 153
200 3300025944 Ga0207661_10132709 Ga0207661_101327091 153
201 3300025945 Ga0207679_10002582 Ga0207679_100025826 153
202 3300025945 Ga0207679_10175041 Ga0207679_101750412 153
203 3300025949 Ga0207667_10003923 Ga0207667_1000392312 153
204 3300025949 Ga0207667_10009894 Ga0207667_100098946 153
205 3300025949 Ga0207667_10015998 Ga0207667_100159982 153
206 3300025949 Ga0207667_10029281 Ga0207667_100292814 153
207 3300025949 Ga0207667_10146073 Ga0207667_101460736 153
208 3300025972 Ga0207668_10003592 Ga0207668_1000359210 153
209 3300025981 Ga0207640_10012375 Ga0207640_100123755 153
210 3300025981 Ga0207640_10153397 Ga0207640_101533972 153
211 3300025986 Ga0207658_10002546 Ga0207658_100025469 153
212 3300025986 Ga0207658_10407710 Ga0207658_104077102 153
213 3300026035 Ga0207703_10087733 Ga0207703_100877333 153
214 3300026041 Ga0207639_10001018 Ga0207639_1000101813 153
215 3300026041 Ga0207639_10084798 Ga0207639_100847985 153
216 3300026041 Ga0207639_10102017 Ga0207639_101020173 153
217 3300026041 Ga0207639_10249950 Ga0207639_102499502 153
218 3300026041 Ga0207639_10587845 Ga0207639_105878452 153
219 3300026067 Ga0207678_10055583 Ga0207678_100555833 153
220 3300026078 Ga0207702_10024465 Ga0207702_100244656 153
221 3300026078 Ga0207702_10127236 Ga0207702_101272362 153
222 3300026088 Ga0207641_10025589 Ga0207641_100255897 153
223 3300026088 Ga0207641_10135506 Ga0207641_101355061 153
224 3300026095 Ga0207676_10164122 Ga0207676_101641223 153
225 3300026116 Ga0207674_10068241 Ga0207674_100682416 153
226 3300026116 Ga0207674_10115685 Ga0207674_101156855 153
227 3300026116 Ga0207674_10171507 Ga0207674_101715072 153
228 3300026121 Ga0207683_10331923 Ga0207683_103319232 153
229 3300026142 Ga0207698_10000256 Ga0207698_1000025631 153
230 3300026142 Ga0207698_10129305 Ga0207698_101293053 153
231 3300026142 Ga0207698_10205607 Ga0207698_102056072 153
232 3300026142 Ga0207698_10253863 Ga0207698_102538633 153
233 3300026142 Ga0207698_10392076 Ga0207698_103920762 153
234 3300026142 Ga0207698_11962968 Ga0207698_119629681 153
235 3300027866 Ga0209813_10000138 Ga0209813_100001386 153
236 3300028379 Ga0268266_10000124 Ga0268266_100001246 153
237 3300028379 Ga0268266_10050873 Ga0268266_100508734 153
238 3300028380 Ga0268265_10006050 Ga0268265_100060502 153
239 3300028381 Ga0268264_10023531 Ga0268264_100235313 153
240 3300028381 Ga0268264_10153050 Ga0268264_101530502 153
241 3300031727 Ga0316576_10759221 Ga0316576_107592211 153
242 3300031731 Ga0307405_10034387 Ga0307405_100343871 153
243 3300031731 Ga0307405_10064993 Ga0307405_100649932 153
244 3300031824 Ga0307413_10088340 Ga0307413_100883404 153
245 3300031824 Ga0307413_10105104 Ga0307413_101051042 153
246 3300031824 Ga0307413_10381607 Ga0307413_103816072 153
247 3300031824 Ga0307413_11498377 Ga0307413_114983771 153
248 3300031852 Ga0307410_10087311 Ga0307410_100873112 153
249 3300031852 Ga0307410_10220911 Ga0307410_102209112 153
250 3300031852 Ga0307410_10421577 Ga0307410_104215771 153
251 3300031901 Ga0307406_10120357 Ga0307406_101203572 153
252 3300031901 Ga0307406_10141163 Ga0307406_101411634 153
253 3300031901 Ga0307406_10598259 Ga0307406_105982592 153
254 3300031903 Ga0307407_10035535 Ga0307407_100355352 153
255 3300031903 Ga0307407_10581337 Ga0307407_105813372 153
256 3300031911 Ga0307412_10038231 Ga0307412_100382316 153
257 3300031911 Ga0307412_10147888 Ga0307412_101478883 153
258 3300031911 Ga0307412_10318612 Ga0307412_103186122 153
259 3300031911 Ga0307412_11218629 Ga0307412_112186291 153
260 3300031995 Ga0307409_100022719 Ga0307409_1000227197 153
261 3300031995 Ga0307409_101532269 Ga0307409_1015322692 153
262 3300032002 Ga0307416_100178895 Ga0307416_1001788952 153
263 3300032002 Ga0307416_100784702 Ga0307416_1007847021 153
264 3300032002 Ga0307416_100955638 Ga0307416_1009556382 153
265 3300032002 Ga0307416_101570937 Ga0307416_1015709371 153
266 3300032004 Ga0307414_10030405 Ga0307414_100304056 153
267 3300032004 Ga0307414_10250342 Ga0307414_102503422 153
268 3300032004 Ga0307414_10322997 Ga0307414_103229972 153
269 3300032004 Ga0307414_10354553 Ga0307414_103545531 153
270 3300032004 Ga0307414_10591287 Ga0307414_105912872 153
271 3300032005 Ga0307411_10121896 Ga0307411_101218963 153
272 3300032005 Ga0307411_10181842 Ga0307411_101818421 153
273 3300032126 Ga0307415_100045881 Ga0307415_1000458813 153
274 3300032126 Ga0307415_100606962 Ga0307415_1006069622 153
275 3300032126 Ga0307415_100751480 Ga0307415_1007514802 153
276 3300034817 Ga0373948_0009357 Ga0373948_0009357_374_853 153
277 3300035112 Ga0373932_0022153 Ga0373932_0022153_749_1228 153
278 3300041512 Ga0451853_1296698 Ga0451853_1296698_346_807 153
279 3300041512 Ga0451853_3454958 Ga0451853_3454958_125_592 153
280 3300042005 Ga0439448_0379228 Ga0439448_0379228_10_471 153
281 3300046460 Ga0495638_0028154 Ga0495638_0028154_2687_3148 153
282 3300046460 Ga0495638_0097715 Ga0495638_0097715_613_1086 153
283 3300046460 Ga0495638_0112986 Ga0495638_0112986_450_917 153
284 3300046500 Ga0495596_0000226 Ga0495596_0000226_33492_33956 153
285 3300046500 Ga0495596_0003844 Ga0495596_0003844_5216_5680 153
286 3300046512 Ga0495610_0001472 Ga0495610_0001472_10832_11296 153
287 3300046515 Ga0495620_0178790 Ga0495620_0178790_130_594 153
288 3300046518 Ga0495631_0256651 Ga0495631_0256651_70_543 153
289 3300046522 Ga0495643_0026283 Ga0495643_0026283_2614_3078 153
290 3300046522 Ga0495643_0094254 Ga0495643_0094254_956_1420 153
291 3300046538 Ga0495609_0017095 Ga0495609_0017095_2614_3078 153
292 3300046616 Ga0495668_0051731 Ga0495668_0051731_1550_2020 153
293 3300046616 Ga0495668_0184342 Ga0495668_0184342_509_973 153
294 3300046660 Ga0495625_0010394 Ga0495625_0010394_5402_5866 153
295 3300046660 Ga0495625_0318407 Ga0495625_0318407_421_894 153
296 3300046691 Ga0495670_0049104 Ga0495670_0049104_391_864 153
297 3300046692 Ga0495671_0016625 Ga0495671_0016625_1815_2279 153
298 3300047472 Ga0495686_0523149 Ga0495686_0523149_121_585 153
299 3300048090 Ga0495615_0011944 Ga0495615_0011944_1150_1611 153
300 3300048091 Ga0495626_0000346 Ga0495626_0000346_7707_8171 153
301 3300048903 Ga0496100_0224231 Ga0496100_0224231_507_977 153
302 3300048903 Ga0496100_1478584 Ga0496100_1478584_31_501 153
303 3300048904 Ga0496101_0032170 Ga0496101_0032170_2194_2664 153
304 3300048905 Ga0496102_0656719 Ga0496102_0656719_327_797 153
305 3300048906 Ga0496103_0030838 Ga0496103_0030838_943_1413 153
306 3300048906 Ga0496103_0085040 Ga0496103_0085040_1303_1785 153
307 3300048907 Ga0496104_0216369 Ga0496104_0216369_178_648 153
308 3300048908 Ga0496105_0040419 Ga0496105_0040419_388_858 153
309 3300048909 Ga0496106_0025330 Ga0496106_0025330_2989_3459 153
310 3300048910 Ga0496107_0000222 Ga0496107_0000222_18130_18600 153
311 3300048911 Ga0496108_0668022 Ga0496108_0668022_169_639 153
312 3300048912 Ga0496109_0139276 Ga0496109_0139276_376_846 153
313 3300048913 Ga0496110_0042442 Ga0496110_0042442_2195_2665 153
314 3300048916 Ga0496113_0068029 Ga0496113_0068029_1426_1896 153
315 3300048917 Ga0496114_0088885 Ga0496114_0088885_1266_1727 153
316 3300048919 Ga0496116_0000045 Ga0496116_0000045_198933_199397 153
317 3300048919 Ga0496116_0105157 Ga0496116_0105157_148_630 153
318 3300048920 Ga0496117_0015740 Ga0496117_0015740_228_710 153
319 3300048920 Ga0496117_0066447 Ga0496117_0066447_1148_1612 153
320 3300048921 Ga0496118_0027493 Ga0496118_0027493_3409_3891 153
321 3300048922 Ga0496119_0030505 Ga0496119_0030505_2763_3245 153
322 3300048923 Ga0496120_0134271 Ga0496120_0134271_573_1055 153
323 3300048924 Ga0496121_0007888 Ga0496121_0007888_199_663 153
324 3300048924 Ga0496121_0044956 Ga0496121_0044956_1477_1959 153
325 3300048924 Ga0496121_0088816 Ga0496121_0088816_1579_2049 153
326 3300048925 Ga0496122_0006623 Ga0496122_0006623_7765_8229 153
327 3300048926 Ga0496123_0006282 Ga0496123_0006282_3175_3639 153
328 3300048927 Ga0496124_0064546 Ga0496124_0064546_137_601 153
329 3300048927 Ga0496124_0066544 Ga0496124_0066544_2339_2821 153
330 3300048927 Ga0496124_0120767 Ga0496124_0120767_1494_1958 153
331 3300048927 Ga0496124_0343690 Ga0496124_0343690_43_507 153
332 3300048928 Ga0496125_0011111 Ga0496125_0011111_6949_7431 153
333 3300048928 Ga0496125_0026441 Ga0496125_0026441_2506_2970 153
334 3300048929 Ga0496126_0000568 Ga0496126_0000568_63417_63881 153
335 3300048929 Ga0496126_0727325 Ga0496126_0727325_159_641 153
336 3300049460 Ga0495682_0208903 Ga0495682_0208903_74_538 153
337 3300049568 Ga0501031_0919128 Ga0501031_0919128_54_524 153
338 3300049569 Ga0501032_0323046 Ga0501032_0323046_509_979 153
339 3300049571 Ga0501034_0758761 Ga0501034_0758761_231_692 153
340 3300049572 Ga0501036_0961952 Ga0501036_0961952_223_684 153
341 3300049575 Ga0501039_0222770 Ga0501039_0222770_562_1032 153
342 3300049579 Ga0501043_0267522 Ga0501043_0267522_244_714 153
343 3300049581 Ga0501047_0682530 Ga0501047_0682530_10_471 153
344 3300049586 Ga0501070_0736303 Ga0501070_0736303_234_695 153
345 3300049823 Ga0501044_0016615 Ga0501044_0016615_4458_4928 153
346 3300050489 nmdc:mga03683_193_c1 nmdc:mga03683_193_c1_2257_2727 153
347 3300050489 nmdc:mga03683_31940_c1 nmdc:mga03683_31940_c1_767_1237 153
348 3300050489 nmdc:mga03683_37_c1 nmdc:mga03683_37_c1_33874_34353 153
349 3300050490 nmdc:mga03n38_194_c1 nmdc:mga03n38_194_c1_418_897 153
350 3300050490 nmdc:mga03n38_2320_c1 nmdc:mga03n38_2320_c1_4867_5337 153
351 3300050491 nmdc:mga00v17_210007_c1 nmdc:mga00v17_210007_c1_495_965 153
352 3300050491 nmdc:mga00v17_24287_c1 nmdc:mga00v17_24287_c1_172_642 153
353 3300050491 nmdc:mga00v17_3287_c1 nmdc:mga00v17_3287_c1_296_766 153
354 3300050491 nmdc:mga00v17_63149_c1 nmdc:mga00v17_63149_c1_791_1270 153
355 3300050491 nmdc:mga00v17_853116_c1 nmdc:mga00v17_853116_c1_85_555 153
356 3300050492 nmdc:mga0yw44_121926_c1 nmdc:mga0yw44_121926_c1_1007_1477 153
357 3300050493 nmdc:mga0k408_140671_c1 nmdc:mga0k408_140671_c1_763_1233 153
358 3300050493 nmdc:mga0k408_18_c1 nmdc:mga0k408_18_c1_34840_35319 153
359 3300050494 nmdc:mga06z11_4461_c1 nmdc:mga06z11_4461_c1_2143_2613 153
360 3300050494 nmdc:mga06z11_8840_c1 nmdc:mga06z11_8840_c1_551_1030 153
361 3300050495 nmdc:mga04h51_320_c1 nmdc:mga04h51_320_c1_3529_3999 153
362 3300050496 nmdc:mga07m45_169635_c1 nmdc:mga07m45_169635_c1_709_1179 153
363 3300050496 nmdc:mga07m45_19_c1 nmdc:mga07m45_19_c1_97446_97925 153
364 3300050496 nmdc:mga07m45_449_c1 nmdc:mga07m45_449_c1_11912_12385 153
365 3300050496 nmdc:mga07m45_64_c1 nmdc:mga07m45_64_c1_21335_21805 153
366 3300050516 nmdc:mga0sz30_157153_c1 nmdc:mga0sz30_157153_c1_426_896 153
367 3300050516 nmdc:mga0sz30_508_c1 nmdc:mga0sz30_508_c1_2848_3318 153
368 3300050516 nmdc:mga0sz30_60916_c1 nmdc:mga0sz30_60916_c1_268_738 153
369 3300053087 Ga0500643_000039 Ga0500643_000039_157731_158192 153
370 3300053087 Ga0500643_023678 Ga0500643_023678_1329_1802 153
371 3300053108 Ga0500562_076088 Ga0500562_076088_49_510 153
372 3300053116 Ga0500592_011312 Ga0500592_011312_350_820 153
373 3300053118 Ga0500594_0011659 Ga0500594_0011659_855_1316 153
374 3300053121 Ga0500607_000152 Ga0500607_000152_28936_29409 153
375 3300053136 Ga0500559_0000524 Ga0500559_0000524_14136_14609 153
376 3300053153 Ga0500616_0001209 Ga0500616_0001209_13169_13630 153
377 3300053156 Ga0500622_0001350 Ga0500622_0001350_14595_15068 153
378 3300053178 Ga0500637_0188159 Ga0500637_0188159_396_869 153
379 3300053730 Ga0500645_002769 Ga0500645_002769_6897_7367 153
380 3300053730 Ga0500645_002911 Ga0500645_002911_4316_4789 153

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14588

YjgF_endoribonc

YjgF/chorismate_mutase-like, putative endoribonuclease

67

174

0.94

PF13476

AAA_23

AAA domain

6

72

0.91

PF01042

Ribonuc_L-PSP

Endoribonuclease L-PSP

67

174

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
2otm-assembly1.cif.gz_C crystal structure of a putative endoribonuclease (so_1960) from shewanella oneidensis mr-1 at 1.85 a resolution 0.9415 1 150
3d01-assembly1.cif.gz_I error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.9332 3 151
3d01-assembly3.cif.gz_C error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.9321 2 151
3d01-assembly2.cif.gz_E error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.932 2 151
3d01-assembly1.cif.gz_K error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.9309 2 152
ID Description Score Start End Superfamily
af_A4I058_2_156_3.30.1330.40 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9616 2 151 3.30.1330.40
af_A4I058_2_156_3.30.1330.40 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9372 2 151 3.30.1330.40
af_I6YGW9_1_150_3.30.1330.40 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9366 1 150 3.30.1330.40
2otmC00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9342 1 150 3.30.1330.40
af_I6YGW9_1_150_3.30.1330.40 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9306 1 150 3.30.1330.40
ID Description Score Start End GO Terms
AF-A0A382K155-F1-model_v4 Endoribonuclease L-PSP/chorismate mutase-like domain-containing protein 0.9989 57 151
AF-X1SC61-F1-model_v4 Endoribonuclease L-PSP/chorismate mutase-like domain-containing protein 0.9978 59 152
AF-A0A7R8WSA3-F1-model_v4 Endoribonuclease L-PSP/chorismate mutase-like domain-containing protein 0.9941 48 152
AF-A0A502X7X9-F1-model_v4 deleted 0.9937 59 151
AF-A0A847ZXD2-F1-model_v4 RidA family protein 0.9933 57 151

Feature Viewer

pLDDT pTM Quality
95.69 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map