F428608

General Info

Members Datasets Scaffolds Average Seq Length
380 171 760 117

Family's Representative Sequence

Representative Sequence 3300005985|Ga0081539_10053098|Ga0081539_100530981
Length 156
Sequence VPDFGTLSSQSGRYARYLGRPSPDWRPFFYPRQRLKCAPMLYLFVKAALSGLIVAAVSEIARRYPGWGGLVASLPLTSLLAMLWLWRDSGGDSGRVAALAGSTFWFILPSLPLFIALPWLLRSGLGFWVAMAIVIAGTLALYALTFWAAPKLGIRL

Samples

Sample ID Description Type Environment
1 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
7 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
72 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
73 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
74 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
75 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
76 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
82 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
83 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
84 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
85 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
138 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
139 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
140 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
141 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
142 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
143 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
144 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
145 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
146 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
147 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
148 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
149 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
150 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
151 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
152 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
153 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
154 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
155 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
156 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
157 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
158 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
159 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
160 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
161 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
162 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
163 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
164 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
165 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
166 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
167 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
168 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
169 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
170 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
171 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.74
Metatranscriptomes 0.26
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.11
Nodule 0
Rhizoplane 1.32
Rhizosphere 96.58
Stem 0
Stem Tuber 0
Unclassified 3.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081539_10053098 3300005985 Bacteria 2271
2 JGI24747J21853_1008399 3300001978 Bacteria 1009
3 JGI24740J21852_10060247 3300001979 Bacteria 1049
4 JGI24740J21852_10084346 3300001979 Bacteria 828
5 JGI24740J21852_10108312 3300001979 Bacteria 702
6 JGI24739J22299_10110425 3300001989 Unclassified 825
7 JGI24737J22298_10036683 3300001990 Bacteria 1513
8 JGI24743J22301_10092179 3300001991 Bacteria 647
9 JGI24744J21845_10000075 3300002077 Bacteria 12498
10 Ga0070658_10086326 3300005327 Bacteria 2581
11 Ga0070658_10325310 3300005327 Bacteria 1313
12 Ga0070658_10335091 3300005327 Bacteria 1293
13 Ga0070658_10397879 3300005327 Bacteria 1183
14 Ga0070658_10931246 3300005327 Bacteria 755
15 Ga0070658_10976172 3300005327 Unclassified 737
16 Ga0070658_11043666 3300005327 Bacteria 711
17 Ga0070676_11169788 3300005328 Bacteria 583
18 Ga0070676_11245926 3300005328 Unclassified 566
19 Ga0070683_100165422 3300005329 Bacteria 2098
20 Ga0070683_100226296 3300005329 Bacteria 1777
21 Ga0070683_100266901 3300005329 Bacteria 1628
22 Ga0070683_100620283 3300005329 Bacteria 1035
23 Ga0070690_100334021 3300005330 Bacteria 1096
24 Ga0070670_100138544 3300005331 Bacteria 2104
25 Ga0070670_101388956 3300005331 Bacteria 644
26 Ga0070677_10199487 3300005333 Bacteria 965
27 Ga0070677_10355336 3300005333 Bacteria 760
28 Ga0070666_10047238 3300005335 Bacteria 2890
29 Ga0070666_10938384 3300005335 Bacteria 641
30 Ga0070666_11383252 3300005335 Bacteria 526
31 Ga0070680_100020561 3300005336 Bacteria 5240
32 Ga0070680_100044007 3300005336 Bacteria 3627
33 Ga0070682_100336714 3300005337 Bacteria 1120
34 Ga0068868_100505903 3300005338 Bacteria 1059
35 Ga0068868_100528547 3300005338 Bacteria 1037
36 Ga0070660_100024220 3300005339 Bacteria 4502
37 Ga0070660_100064939 3300005339 Bacteria 2840
38 Ga0070660_100135032 3300005339 Bacteria 1976
39 Ga0070660_100197213 3300005339 Bacteria 1632
40 Ga0070660_100922619 3300005339 Bacteria 737
41 Ga0070660_101084720 3300005339 Bacteria 677
42 Ga0070687_100106531 3300005343 Bacteria 1579
43 Ga0070661_100052379 3300005344 Bacteria 2987
44 Ga0070661_100368222 3300005344 Bacteria 1131
45 Ga0070661_100626028 3300005344 Bacteria 872
46 Ga0070661_101173513 3300005344 Bacteria 641
47 Ga0070661_101818612 3300005344 Bacteria 517
48 Ga0070661_101942651 3300005344 Bacteria 500
49 Ga0070692_10405480 3300005345 Bacteria 862
50 Ga0070668_100296104 3300005347 Bacteria 1356
51 Ga0070668_100418044 3300005347 Bacteria 1148
52 Ga0070668_100938133 3300005347 Bacteria 775
53 Ga0070669_100191158 3300005353 Bacteria 1606
54 Ga0070669_100296261 3300005353 Bacteria 1300
55 Ga0070669_100860504 3300005353 Bacteria 773
56 Ga0070675_100058743 3300005354 Bacteria 3172
57 Ga0070671_100449030 3300005355 Bacteria 1106
58 Ga0070674_100110149 3300005356 Bacteria 2020
59 Ga0070673_100015941 3300005364 Bacteria 5295
60 Ga0070673_100296932 3300005364 Bacteria 1421
61 Ga0070673_101002228 3300005364 Bacteria 778
62 Ga0070659_100269639 3300005366 Bacteria 1414
63 Ga0070659_100679084 3300005366 Bacteria 889
64 Ga0070659_100794928 3300005366 Bacteria 822
65 Ga0070667_100035496 3300005367 Bacteria 4177
66 Ga0070667_100105816 3300005367 Bacteria 2435
67 Ga0070667_100570476 3300005367 Unclassified 1041
68 Ga0070714_100047515 3300005435 Bacteria 3647
69 Ga0070714_100428808 3300005435 Bacteria 1253
70 Ga0070663_100011812 3300005455 Bacteria 5499
71 Ga0070663_100026140 3300005455 Bacteria 3949
72 Ga0070663_100135834 3300005455 Bacteria 1872
73 Ga0070663_100317143 3300005455 Bacteria 1252
74 Ga0070663_101618479 3300005455 Bacteria 578
75 Ga0070678_100069461 3300005456 Bacteria 2630
76 Ga0070662_100138828 3300005457 Bacteria 1881
77 Ga0070662_100522670 3300005457 Bacteria 992
78 Ga0070662_100727317 3300005457 Bacteria 841
79 Ga0070681_10413987 3300005458 Bacteria 1260
80 Ga0070681_10546598 3300005458 Bacteria 1072
81 Ga0068867_100173146 3300005459 Bacteria 1711
82 Ga0068867_100531668 3300005459 Bacteria 1015
83 Ga0070679_100024361 3300005530 Bacteria 5930
84 Ga0070679_101070326 3300005530 Bacteria 751
85 Ga0070684_100021165 3300005535 Bacteria 5406
86 Ga0070684_100244860 3300005535 Bacteria 1638
87 Ga0070684_100641321 3300005535 Bacteria 988
88 Ga0070684_102252450 3300005535 Unclassified 514
89 Ga0068853_100085597 3300005539 Bacteria 2763
90 Ga0068853_100281733 3300005539 Bacteria 1532
91 Ga0068853_100375040 3300005539 Bacteria 1328
92 Ga0068853_100972740 3300005539 Bacteria 817
93 Ga0070672_100044390 3300005543 Bacteria 3432
94 Ga0070672_101762004 3300005543 Bacteria 557
95 Ga0070696_100723595 3300005546 Bacteria 813
96 Ga0070665_100034313 3300005548 Bacteria 5103
97 Ga0068855_100609799 3300005563 Bacteria 1176
98 Ga0068855_100626486 3300005563 Bacteria 1158
99 Ga0068855_100880474 3300005563 Bacteria 947
100 Ga0068855_100939674 3300005563 Bacteria 911
101 Ga0070664_100081093 3300005564 Bacteria 2795
102 Ga0070664_100112311 3300005564 Bacteria 2379
103 Ga0070664_100634978 3300005564 Bacteria 992
104 Ga0068857_100019208 3300005577 Bacteria 5999
105 Ga0068857_100366250 3300005577 Bacteria 1337
106 Ga0068854_100081725 3300005578 Bacteria 2387
107 Ga0068854_100095730 3300005578 Bacteria 2217
108 Ga0068854_100235811 3300005578 Bacteria 1454
109 Ga0068854_100567464 3300005578 Bacteria 965
110 Ga0068856_100060678 3300005614 Bacteria 3736
111 Ga0068856_100099376 3300005614 Bacteria 2901
112 Ga0068856_100122020 3300005614 Bacteria 2608
113 Ga0068856_100446081 3300005614 Bacteria 1315
114 Ga0068856_100772488 3300005614 Bacteria 981
115 Ga0070702_100602882 3300005615 Bacteria 823
116 Ga0068852_100028945 3300005616 Bacteria 4542
117 Ga0068852_100051664 3300005616 Bacteria 3529
118 Ga0068852_101023542 3300005616 Bacteria 845
119 Ga0068852_101095857 3300005616 Bacteria 816
120 Ga0068852_101470681 3300005616 Bacteria 703
121 Ga0068859_101255819 3300005617 Bacteria 816
122 Ga0068864_100254107 3300005618 Bacteria 1633
123 Ga0068866_10026607 3300005718 Bacteria 2734
124 Ga0068861_100085961 3300005719 Bacteria 2471
125 Ga0068851_11032132 3300005834 Bacteria 519
126 Ga0068870_10180491 3300005840 Bacteria 1267
127 Ga0068863_100494463 3300005841 Bacteria 1204
128 Ga0068858_100714184 3300005842 Bacteria 976
129 Ga0068862_100194859 3300005844 Bacteria 1825
130 Ga0097621_100157589 3300006237 Bacteria 1949
131 Ga0097621_100212607 3300006237 Bacteria 1683
132 Ga0068871_100181331 3300006358 Bacteria 1810
133 Ga0068871_100663642 3300006358 Bacteria 953
134 Ga0075430_100967224 3300006846 Bacteria 701
135 Ga0068865_100294915 3300006881 Bacteria 1296
136 Ga0068865_100336511 3300006881 Bacteria 1219
137 Ga0097620_101256073 3300006931 Bacteria 816
138 Ga0105240_10198780 3300009093 Bacteria 2351
139 Ga0105245_10095767 3300009098 Bacteria 2739
140 Ga0105245_11805414 3300009098 Bacteria 664
141 Ga0105243_10223536 3300009148 Bacteria 1666
142 Ga0105241_10513695 3300009174 Bacteria 1070
143 Ga0105242_10139484 3300009176 Bacteria 2102
144 Ga0105242_10257936 3300009176 Bacteria 1573
145 Ga0105248_10520949 3300009177 Bacteria 1341
146 Ga0105237_10063235 3300009545 Bacteria 3699
147 Ga0105238_10242098 3300009551 Bacteria 1781
148 Ga0105238_10985913 3300009551 Bacteria 863
149 Ga0105246_10101627 3300011119 Bacteria 2094
150 Ga0157373_10050132 3300013100 Bacteria 2974
151 Ga0157373_10148981 3300013100 Bacteria 1646
152 Ga0157373_10164555 3300013100 Bacteria 1561
153 Ga0157373_10251583 3300013100 Bacteria 1250
154 Ga0157373_10292957 3300013100 Bacteria 1154
155 Ga0157373_10424564 3300013100 Bacteria 955
156 Ga0157373_10888828 3300013100 Bacteria 660
157 Ga0157371_10073636 3300013102 Bacteria 2419
158 Ga0157371_10369321 3300013102 Bacteria 1046
159 Ga0157371_11177121 3300013102 Bacteria 590
160 Ga0157370_10077125 3300013104 Bacteria 3140
161 Ga0157370_10106039 3300013104 Bacteria 2630
162 Ga0157370_10292286 3300013104 Bacteria 1505
163 Ga0157370_11110928 3300013104 Bacteria 714
164 Ga0157370_11110930 3300013104 Bacteria 714
165 Ga0157369_10021841 3300013105 Bacteria 7155
166 Ga0157369_10072023 3300013105 Bacteria 3709
167 Ga0157369_10109643 3300013105 Bacteria 2935
168 Ga0157369_10138028 3300013105 Bacteria 2580
169 Ga0157369_10173835 3300013105 Bacteria 2268
170 Ga0157369_10540959 3300013105 Bacteria 1204
171 Ga0157374_10031577 3300013296 Bacteria 4815
172 Ga0157378_10016357 3300013297 Bacteria 6494
173 Ga0163162_10147748 3300013306 Bacteria 2467
174 Ga0157372_11362153 3300013307 Bacteria 818
175 Ga0157372_11955420 3300013307 Bacteria 674
176 Ga0157372_12039012 3300013307 Bacteria 659
177 Ga0157375_10134340 3300013308 Bacteria 2596
178 Ga0157375_10690426 3300013308 Bacteria 1175
179 Ga0157380_10699842 3300014326 Bacteria 1018
180 Ga0182008_10330546 3300014497 Unclassified 804
181 Ga0157377_10103434 3300014745 Bacteria 1701
182 Ga0157376_10244673 3300014969 Bacteria 1672
183 Ga0157376_10616304 3300014969 Bacteria 1082
184 Ga0206356_10234429 3300020070 Bacteria 852
185 Ga0207697_10070314 3300025315 Bacteria 1466
186 Ga0207656_10282285 3300025321 Bacteria 819
187 Ga0207682_10016458 3300025893 Bacteria 2884
188 Ga0207642_10091550 3300025899 Bacteria 1503
189 Ga0207688_10013362 3300025901 Bacteria 4460
190 Ga0207680_10028084 3300025903 Bacteria 3143
191 Ga0207680_10124162 3300025903 Bacteria 1692
192 Ga0207647_10024011 3300025904 Bacteria 4023
193 Ga0207647_10035313 3300025904 Bacteria 3186
194 Ga0207645_10047413 3300025907 Bacteria 2744
195 Ga0207643_10064190 3300025908 Bacteria 2102
196 Ga0207705_10042360 3300025909 Bacteria 3268
197 Ga0207705_10205200 3300025909 Bacteria 1494
198 Ga0207705_10369967 3300025909 Unclassified 1106
199 Ga0207705_10539693 3300025909 Bacteria 906
200 Ga0207705_10692431 3300025909 Bacteria 792
201 Ga0207705_10824465 3300025909 Bacteria 720
202 Ga0207707_10102477 3300025912 Bacteria 2502
203 Ga0207695_11404053 3300025913 Bacteria 579
204 Ga0207671_10774464 3300025914 Bacteria 761
205 Ga0207660_10009217 3300025917 Bacteria 6385
206 Ga0207657_10021872 3300025919 Bacteria 6006
207 Ga0207657_10035081 3300025919 Bacteria 4503
208 Ga0207657_10044222 3300025919 Bacteria 3917
209 Ga0207657_10067359 3300025919 Bacteria 3045
210 Ga0207657_10079814 3300025919 Bacteria 2752
211 Ga0207657_10226474 3300025919 Bacteria 1496
212 Ga0207649_10067225 3300025920 Bacteria 2274
213 Ga0207649_10070224 3300025920 Bacteria 2233
214 Ga0207649_10135832 3300025920 Bacteria 1676
215 Ga0207649_10254677 3300025920 Bacteria 1266
216 Ga0207652_10099087 3300025921 Bacteria 2571
217 Ga0207652_10751429 3300025921 Bacteria 868
218 Ga0207652_10922936 3300025921 Bacteria 770
219 Ga0207681_10308312 3300025923 Bacteria 1255
220 Ga0207694_10271673 3300025924 Bacteria 1391
221 Ga0207659_10223964 3300025926 Bacteria 1514
222 Ga0207687_11051123 3300025927 Bacteria 699
223 Ga0207664_10490364 3300025929 Bacteria 1100
224 Ga0207644_10585655 3300025931 Bacteria 925
225 Ga0207690_10335888 3300025932 Bacteria 1191
226 Ga0207690_10948559 3300025932 Bacteria 715
227 Ga0207706_10018619 3300025933 Bacteria 6247
228 Ga0207706_10045170 3300025933 Bacteria 3903
229 Ga0207706_10626234 3300025933 Bacteria 923
230 Ga0207709_10057354 3300025935 Bacteria 2414
231 Ga0207669_10309329 3300025937 Bacteria 1204
232 Ga0207669_10399853 3300025937 Bacteria 1076
233 Ga0207704_10051580 3300025938 Bacteria 2489
234 Ga0207704_10177887 3300025938 Bacteria 1534
235 Ga0207691_10018687 3300025940 Bacteria 6566
236 Ga0207691_10106887 3300025940 Bacteria 2492
237 Ga0207689_10093683 3300025942 Bacteria 2467
238 Ga0207661_10041370 3300025944 Bacteria 3628
239 Ga0207661_10096227 3300025944 Bacteria 2477
240 Ga0207661_10142534 3300025944 Bacteria 2063
241 Ga0207661_10851711 3300025944 Bacteria 839
242 Ga0207661_11065412 3300025944 Bacteria 744
243 Ga0207679_10026587 3300025945 Bacteria 3992
244 Ga0207679_10102885 3300025945 Bacteria 2237
245 Ga0207679_10307585 3300025945 Bacteria 1368
246 Ga0207679_10985900 3300025945 Bacteria 772
247 Ga0207679_11062219 3300025945 Bacteria 743
248 Ga0207667_10393481 3300025949 Bacteria 1411
249 Ga0207667_10423995 3300025949 Bacteria 1353
250 Ga0207667_10536079 3300025949 Bacteria 1185
251 Ga0207651_10009634 3300025960 Bacteria 5304
252 Ga0207651_10252888 3300025960 Bacteria 1442
253 Ga0207668_10154772 3300025972 Bacteria 1780
254 Ga0207668_10321504 3300025972 Bacteria 1284
255 Ga0207640_10136628 3300025981 Bacteria 1781
256 Ga0207640_10188870 3300025981 Bacteria 1551
257 Ga0207640_10239081 3300025981 Bacteria 1402
258 Ga0207640_10260294 3300025981 Bacteria 1351
259 Ga0207640_12140510 3300025981 Bacteria 507
260 Ga0207677_10163830 3300026023 Bacteria 1731
261 Ga0207677_11624461 3300026023 Bacteria 599
262 Ga0207703_10364409 3300026035 Bacteria 1333
263 Ga0207639_10332539 3300026041 Bacteria 1352
264 Ga0207639_10538955 3300026041 Bacteria 1070
265 Ga0207639_12071750 3300026041 Bacteria 530
266 Ga0207678_10007244 3300026067 Bacteria 9838
267 Ga0207678_10024851 3300026067 Bacteria 5230
268 Ga0207678_10074392 3300026067 Bacteria 2911
269 Ga0207678_10162505 3300026067 Bacteria 1907
270 Ga0207678_10678248 3300026067 Bacteria 906
271 Ga0207702_10028705 3300026078 Bacteria 4626
272 Ga0207702_10117752 3300026078 Bacteria 2372
273 Ga0207702_10283138 3300026078 Bacteria 1568
274 Ga0207702_10459381 3300026078 Bacteria 1237
275 Ga0207641_10427880 3300026088 Bacteria 1276
276 Ga0207648_10075758 3300026089 Bacteria 2933
277 Ga0207648_10173959 3300026089 Bacteria 1904
278 Ga0207676_10547505 3300026095 Bacteria 1105
279 Ga0207674_10049038 3300026116 Bacteria 4320
280 Ga0207674_10229818 3300026116 Bacteria 1803
281 Ga0207674_10876878 3300026116 Bacteria 865
282 Ga0207675_100009959 3300026118 Bacteria 8899
283 Ga0207675_100296997 3300026118 Bacteria 1572
284 Ga0207683_10011963 3300026121 Bacteria 7407
285 Ga0207683_10012270 3300026121 Bacteria 7313
286 Ga0207698_10036177 3300026142 Bacteria 3621
287 Ga0207698_10113810 3300026142 Bacteria 2274
288 Ga0207698_10512427 3300026142 Bacteria 1169
289 Ga0207698_10681572 3300026142 Bacteria 1021
290 Ga0207698_10739741 3300026142 Bacteria 981
291 Ga0207698_12582349 3300026142 Bacteria 518
292 Ga0209974_10046476 3300027876 Bacteria 1452
293 Ga0209974_10133019 3300027876 Archaea 888
294 Ga0209974_10342089 3300027876 Bacteria 579
295 Ga0209974_10456594 3300027876 Bacteria 507
296 Ga0268266_10029186 3300028379 Bacteria 4689
297 Ga0268265_10030200 3300028380 Bacteria 3900
298 Ga0307409_100260562 3300031995 Bacteria 1591
299 Ga0307414_11859389 3300032004 Bacteria 562
300 Ga0395899_0002671 3300037312 Bacteria 14376
301 Ga0395899_0032626 3300037312 Bacteria 3913
302 Ga0395899_0270332 3300037312 Unclassified 1159
303 Ga0395899_0832214 3300037312 Bacteria 568
304 Ga0395900_0002289 3300037418 Bacteria 21271
305 Ga0395900_0058774 3300037418 Bacteria 3958
306 Ga0395900_0220783 3300037418 Bacteria 1910
307 Ga0395900_0332206 3300037418 Bacteria 1498
308 Ga0395900_0348053 3300037418 Bacteria 1456
309 Ga0395900_0419745 3300037418 Bacteria 1299
310 Ga0395900_0684141 3300037418 Unclassified 960
311 Ga0395900_0812162 3300037418 Unclassified 862
312 Ga0395900_0854024 3300037418 Bacteria 836
313 Ga0395900_1563692 3300037418 Unclassified 571
314 Ga0395898_0006097 3300037466 Bacteria 12931
315 Ga0395898_0027291 3300037466 Bacteria 5734
316 Ga0395898_0220048 3300037466 Bacteria 1811
317 Ga0395898_1201385 3300037466 Bacteria 689
318 Ga0395905_0012947 3300037471 Bacteria 8018
319 Ga0395905_0061392 3300037471 Bacteria 3516
320 Ga0395905_0113318 3300037471 Bacteria 2547
321 Ga0395905_0300186 3300037471 Bacteria 1493
322 Ga0395905_0805652 3300037471 Bacteria 842
323 Ga0395901_0000372 3300038443 Bacteria 53814
324 Ga0395901_0004352 3300038443 Bacteria 14287
325 Ga0395901_0045037 3300038443 Bacteria 4577
326 Ga0395901_0939018 3300038443 Unclassified 844
327 Ga0466969_0121394 3300044656 Bacteria 1216
328 Ga0466972_0016335 3300044658 Bacteria 3711
329 Ga0466965_0205663 3300044683 Bacteria 1045
330 Ga0466965_0291851 3300044683 Bacteria 883
331 Ga0466966_0022285 3300044684 Bacteria 4156
332 Ga0466966_0179843 3300044684 Bacteria 1283
333 Ga0466966_0207071 3300044684 Bacteria 1186
334 Ga0466961_0029649 3300044693 Bacteria 3515
335 Ga0466961_0269036 3300044693 Bacteria 1044
336 Ga0466961_0330772 3300044693 Bacteria 928
337 Ga0466963_0051573 3300044694 Bacteria 2727
338 Ga0466963_0154039 3300044694 Bacteria 1597
339 Ga0466963_0277656 3300044694 Bacteria 1177
340 Ga0466963_0435333 3300044694 Bacteria 925
341 Ga0466963_0500890 3300044694 Bacteria 857
342 Ga0466964_0038378 3300044706 Bacteria 1925
343 Ga0466971_0001809 3300044719 Bacteria 9078
344 Ga0466971_0020759 3300044719 Bacteria 2919
345 Ga0466971_0104377 3300044719 Bacteria 1304
346 Ga0466968_0008386 3300044735 Bacteria 3955
347 Ga0466970_0053735 3300044765 Bacteria 2151
348 Ga0466957_0061983 3300044842 Bacteria 2297
349 Ga0466957_0124115 3300044842 Bacteria 1648
350 Ga0466957_0429068 3300044842 Bacteria 908
351 Ga0466957_0513032 3300044842 Bacteria 832
352 Ga0466959_0043457 3300045049 Bacteria 3312
353 Ga0466959_0066040 3300045049 Bacteria 2624
354 Ga0466959_0105191 3300045049 Bacteria 2018
355 Ga0466959_0265983 3300045049 Bacteria 1180
356 Ga0466958_0016393 3300045836 Bacteria 4266
357 Ga0466958_0019306 3300045836 Bacteria 3967
358 Ga0466958_0022185 3300045836 Bacteria 3717
359 Ga0466967_0039014 3300045976 Bacteria 4079
360 Ga0466967_0292298 3300045976 Bacteria 1566
361 Ga0466967_0527222 3300045976 Bacteria 1161
362 Ga0466967_0665542 3300045976 Bacteria 1030
363 Ga0466967_0680875 3300045976 Unclassified 1018
364 Ga0466967_1849191 3300045976 Bacteria 601
365 Ga0495669_0236042 3300046684 Bacteria 877
366 Ga0496102_0356754 3300048905 Bacteria 1376
367 Ga0496102_0403681 3300048905 Bacteria 1285
368 Ga0496103_0062957 3300048906 Bacteria 2310
369 Ga0496106_0417779 3300048909 Bacteria 1078
370 Ga0496107_0112928 3300048910 Bacteria 1998
371 nmdc:mga03683_136272_c1 3300050489 Bacteria 1101
372 nmdc:mga00v17_655997_c1 3300050491 Bacteria 674
373 Ga0500594_0006215 3300053118 Bacteria 2678
374 Ga0500608_214980 3300053122 Bacteria 781
375 Ga0500614_008172 3300053123 Bacteria 2216
376 Ga0500559_0089515 3300053136 Bacteria 1408
377 Ga0500564_001397 3300053138 Bacteria 8328
378 Ga0500625_000006 3300053729 Bacteria 206258
379 Ga0466962_0004882 3300061719 Bacteria 6447
380 Ga0466962_0068085 3300061719 Bacteria 1700
381 Ga0081539_10053098
382 JGI24747J21853_1008399
383 JGI24740J21852_10060247
384 JGI24740J21852_10084346
385 JGI24740J21852_10108312
386 JGI24739J22299_10110425
387 JGI24737J22298_10036683
388 JGI24743J22301_10092179
389 JGI24744J21845_10000075
390 Ga0070658_10086326
391 Ga0070658_10325310
392 Ga0070658_10335091
393 Ga0070658_10397879
394 Ga0070658_10931246
395 Ga0070658_10976172
396 Ga0070658_11043666
397 Ga0070676_11169788
398 Ga0070676_11245926
399 Ga0070683_100165422
400 Ga0070683_100226296
401 Ga0070683_100266901
402 Ga0070683_100620283
403 Ga0070690_100334021
404 Ga0070670_100138544
405 Ga0070670_101388956
406 Ga0070677_10199487
407 Ga0070677_10355336
408 Ga0070666_10047238
409 Ga0070666_10938384
410 Ga0070666_11383252
411 Ga0070680_100020561
412 Ga0070680_100044007
413 Ga0070682_100336714
414 Ga0068868_100505903
415 Ga0068868_100528547
416 Ga0070660_100024220
417 Ga0070660_100064939
418 Ga0070660_100135032
419 Ga0070660_100197213
420 Ga0070660_100922619
421 Ga0070660_101084720
422 Ga0070687_100106531
423 Ga0070661_100052379
424 Ga0070661_100368222
425 Ga0070661_100626028
426 Ga0070661_101173513
427 Ga0070661_101818612
428 Ga0070661_101942651
429 Ga0070692_10405480
430 Ga0070668_100296104
431 Ga0070668_100418044
432 Ga0070668_100938133
433 Ga0070669_100191158
434 Ga0070669_100296261
435 Ga0070669_100860504
436 Ga0070675_100058743
437 Ga0070671_100449030
438 Ga0070674_100110149
439 Ga0070673_100015941
440 Ga0070673_100296932
441 Ga0070673_101002228
442 Ga0070659_100269639
443 Ga0070659_100679084
444 Ga0070659_100794928
445 Ga0070667_100035496
446 Ga0070667_100105816
447 Ga0070667_100570476
448 Ga0070714_100047515
449 Ga0070714_100428808
450 Ga0070663_100011812
451 Ga0070663_100026140
452 Ga0070663_100135834
453 Ga0070663_100317143
454 Ga0070663_101618479
455 Ga0070678_100069461
456 Ga0070662_100138828
457 Ga0070662_100522670
458 Ga0070662_100727317
459 Ga0070681_10413987
460 Ga0070681_10546598
461 Ga0068867_100173146
462 Ga0068867_100531668
463 Ga0070679_100024361
464 Ga0070679_101070326
465 Ga0070684_100021165
466 Ga0070684_100244860
467 Ga0070684_100641321
468 Ga0070684_102252450
469 Ga0068853_100085597
470 Ga0068853_100281733
471 Ga0068853_100375040
472 Ga0068853_100972740
473 Ga0070672_100044390
474 Ga0070672_101762004
475 Ga0070696_100723595
476 Ga0070665_100034313
477 Ga0068855_100609799
478 Ga0068855_100626486
479 Ga0068855_100880474
480 Ga0068855_100939674
481 Ga0070664_100081093
482 Ga0070664_100112311
483 Ga0070664_100634978
484 Ga0068857_100019208
485 Ga0068857_100366250
486 Ga0068854_100081725
487 Ga0068854_100095730
488 Ga0068854_100235811
489 Ga0068854_100567464
490 Ga0068856_100060678
491 Ga0068856_100099376
492 Ga0068856_100122020
493 Ga0068856_100446081
494 Ga0068856_100772488
495 Ga0070702_100602882
496 Ga0068852_100028945
497 Ga0068852_100051664
498 Ga0068852_101023542
499 Ga0068852_101095857
500 Ga0068852_101470681
501 Ga0068859_101255819
502 Ga0068864_100254107
503 Ga0068866_10026607
504 Ga0068861_100085961
505 Ga0068851_11032132
506 Ga0068870_10180491
507 Ga0068863_100494463
508 Ga0068858_100714184
509 Ga0068862_100194859
510 Ga0097621_100157589
511 Ga0097621_100212607
512 Ga0068871_100181331
513 Ga0068871_100663642
514 Ga0075430_100967224
515 Ga0068865_100294915
516 Ga0068865_100336511
517 Ga0097620_101256073
518 Ga0105240_10198780
519 Ga0105245_10095767
520 Ga0105245_11805414
521 Ga0105243_10223536
522 Ga0105241_10513695
523 Ga0105242_10139484
524 Ga0105242_10257936
525 Ga0105248_10520949
526 Ga0105237_10063235
527 Ga0105238_10242098
528 Ga0105238_10985913
529 Ga0105246_10101627
530 Ga0157373_10050132
531 Ga0157373_10148981
532 Ga0157373_10164555
533 Ga0157373_10251583
534 Ga0157373_10292957
535 Ga0157373_10424564
536 Ga0157373_10888828
537 Ga0157371_10073636
538 Ga0157371_10369321
539 Ga0157371_11177121
540 Ga0157370_10077125
541 Ga0157370_10106039
542 Ga0157370_10292286
543 Ga0157370_11110928
544 Ga0157370_11110930
545 Ga0157369_10021841
546 Ga0157369_10072023
547 Ga0157369_10109643
548 Ga0157369_10138028
549 Ga0157369_10173835
550 Ga0157369_10540959
551 Ga0157374_10031577
552 Ga0157378_10016357
553 Ga0163162_10147748
554 Ga0157372_11362153
555 Ga0157372_11955420
556 Ga0157372_12039012
557 Ga0157375_10134340
558 Ga0157375_10690426
559 Ga0157380_10699842
560 Ga0182008_10330546
561 Ga0157377_10103434
562 Ga0157376_10244673
563 Ga0157376_10616304
564 Ga0206356_10234429
565 Ga0207697_10070314
566 Ga0207656_10282285
567 Ga0207682_10016458
568 Ga0207642_10091550
569 Ga0207688_10013362
570 Ga0207680_10028084
571 Ga0207680_10124162
572 Ga0207647_10024011
573 Ga0207647_10035313
574 Ga0207645_10047413
575 Ga0207643_10064190
576 Ga0207705_10042360
577 Ga0207705_10205200
578 Ga0207705_10369967
579 Ga0207705_10539693
580 Ga0207705_10692431
581 Ga0207705_10824465
582 Ga0207707_10102477
583 Ga0207695_11404053
584 Ga0207671_10774464
585 Ga0207660_10009217
586 Ga0207657_10021872
587 Ga0207657_10035081
588 Ga0207657_10044222
589 Ga0207657_10067359
590 Ga0207657_10079814
591 Ga0207657_10226474
592 Ga0207649_10067225
593 Ga0207649_10070224
594 Ga0207649_10135832
595 Ga0207649_10254677
596 Ga0207652_10099087
597 Ga0207652_10751429
598 Ga0207652_10922936
599 Ga0207681_10308312
600 Ga0207694_10271673
601 Ga0207659_10223964
602 Ga0207687_11051123
603 Ga0207664_10490364
604 Ga0207644_10585655
605 Ga0207690_10335888
606 Ga0207690_10948559
607 Ga0207706_10018619
608 Ga0207706_10045170
609 Ga0207706_10626234
610 Ga0207709_10057354
611 Ga0207669_10309329
612 Ga0207669_10399853
613 Ga0207704_10051580
614 Ga0207704_10177887
615 Ga0207691_10018687
616 Ga0207691_10106887
617 Ga0207689_10093683
618 Ga0207661_10041370
619 Ga0207661_10096227
620 Ga0207661_10142534
621 Ga0207661_10851711
622 Ga0207661_11065412
623 Ga0207679_10026587
624 Ga0207679_10102885
625 Ga0207679_10307585
626 Ga0207679_10985900
627 Ga0207679_11062219
628 Ga0207667_10393481
629 Ga0207667_10423995
630 Ga0207667_10536079
631 Ga0207651_10009634
632 Ga0207651_10252888
633 Ga0207668_10154772
634 Ga0207668_10321504
635 Ga0207640_10136628
636 Ga0207640_10188870
637 Ga0207640_10239081
638 Ga0207640_10260294
639 Ga0207640_12140510
640 Ga0207677_10163830
641 Ga0207677_11624461
642 Ga0207703_10364409
643 Ga0207639_10332539
644 Ga0207639_10538955
645 Ga0207639_12071750
646 Ga0207678_10007244
647 Ga0207678_10024851
648 Ga0207678_10074392
649 Ga0207678_10162505
650 Ga0207678_10678248
651 Ga0207702_10028705
652 Ga0207702_10117752
653 Ga0207702_10283138
654 Ga0207702_10459381
655 Ga0207641_10427880
656 Ga0207648_10075758
657 Ga0207648_10173959
658 Ga0207676_10547505
659 Ga0207674_10049038
660 Ga0207674_10229818
661 Ga0207674_10876878
662 Ga0207675_100009959
663 Ga0207675_100296997
664 Ga0207683_10011963
665 Ga0207683_10012270
666 Ga0207698_10036177
667 Ga0207698_10113810
668 Ga0207698_10512427
669 Ga0207698_10681572
670 Ga0207698_10739741
671 Ga0207698_12582349
672 Ga0209974_10046476
673 Ga0209974_10133019
674 Ga0209974_10342089
675 Ga0209974_10456594
676 Ga0268266_10029186
677 Ga0268265_10030200
678 Ga0307409_100260562
679 Ga0307414_11859389
680 Ga0395899_0002671
681 Ga0395899_0032626
682 Ga0395899_0270332
683 Ga0395899_0832214
684 Ga0395900_0002289
685 Ga0395900_0058774
686 Ga0395900_0220783
687 Ga0395900_0332206
688 Ga0395900_0348053
689 Ga0395900_0419745
690 Ga0395900_0684141
691 Ga0395900_0812162
692 Ga0395900_0854024
693 Ga0395900_1563692
694 Ga0395898_0006097
695 Ga0395898_0027291
696 Ga0395898_0220048
697 Ga0395898_1201385
698 Ga0395905_0012947
699 Ga0395905_0061392
700 Ga0395905_0113318
701 Ga0395905_0300186
702 Ga0395905_0805652
703 Ga0395901_0000372
704 Ga0395901_0004352
705 Ga0395901_0045037
706 Ga0395901_0939018
707 Ga0466969_0121394
708 Ga0466972_0016335
709 Ga0466965_0205663
710 Ga0466965_0291851
711 Ga0466966_0022285
712 Ga0466966_0179843
713 Ga0466966_0207071
714 Ga0466961_0029649
715 Ga0466961_0269036
716 Ga0466961_0330772
717 Ga0466963_0051573
718 Ga0466963_0154039
719 Ga0466963_0277656
720 Ga0466963_0435333
721 Ga0466963_0500890
722 Ga0466964_0038378
723 Ga0466971_0001809
724 Ga0466971_0020759
725 Ga0466971_0104377
726 Ga0466968_0008386
727 Ga0466970_0053735
728 Ga0466957_0061983
729 Ga0466957_0124115
730 Ga0466957_0429068
731 Ga0466957_0513032
732 Ga0466959_0043457
733 Ga0466959_0066040
734 Ga0466959_0105191
735 Ga0466959_0265983
736 Ga0466958_0016393
737 Ga0466958_0019306
738 Ga0466958_0022185
739 Ga0466967_0039014
740 Ga0466967_0292298
741 Ga0466967_0527222
742 Ga0466967_0665542
743 Ga0466967_0680875
744 Ga0466967_1849191
745 Ga0495669_0236042
746 Ga0496102_0356754
747 Ga0496102_0403681
748 Ga0496103_0062957
749 Ga0496106_0417779
750 Ga0496107_0112928
751 nmdc:mga03683_136272_c1
752 nmdc:mga00v17_655997_c1
753 Ga0500594_0006215
754 Ga0500608_214980
755 Ga0500614_008172
756 Ga0500559_0089515
757 Ga0500564_001397
758 Ga0500625_000006
759 Ga0466962_0004882
760 Ga0466962_0068085

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
1cnt-assembly1.cif.gz_4 ciliary neurotrophic factor 0.3731 38 115
8e12-assembly1.cif.gz_B homotrimeric variant of tctrp9, bgl14 0.3668 6 101
4knf-assembly1.cif.gz_E crystal structure of a blue-light absorbing proteorhodopsin double-mutant d97n/q105l from hot75 0.3412 5 110
4knf-assembly1.cif.gz_E crystal structure of a blue-light absorbing proteorhodopsin double-mutant d97n/q105l from hot75 0.3205 5 110
8e12-assembly1.cif.gz_B homotrimeric variant of tctrp9, bgl14 0.3024 6 101
ID Description Score Start End Superfamily
af_Q2FUQ6_7_117_1.10.10.1740 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like 0.8371 5 105 1.10.10.1740
af_Q2FVU8_1_63_1.20.20.10 Mainly Alpha;Up-down Bundle;F1FO ATP Synthase;F1F0 ATP synthase subunit C 0.784 63 108 1.20.20.10
af_Q2FUQ6_7_117_1.10.10.1740 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like 0.765 5 105 1.10.10.1740
af_Q2FUQ7_4_112_1.10.10.1740 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like 0.7634 5 109 1.10.10.1740
af_Q2FUQ7_4_112_1.10.10.1740 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like 0.7349 5 109 1.10.10.1740
ID Description Score Start End GO Terms
AF-A0A6J4SSN5-F1-model_v4 DUF3147 family protein 0.9919 1 115 GO:0016020
AF-A0A6J4SSN5-F1-model_v4 DUF3147 family protein 0.9834 1 115 GO:0016020
AF-A0A2N3E9E4-F1-model_v4 DUF3147 family protein 0.981 1 70 GO:0016020
AF-A0A3S0R4L8-F1-model_v4 DUF3147 family protein 0.9746 1 115 GO:0016020
AF-A0A3D5V218-F1-model_v4 DUF3147 family protein 0.9731 1 65 GO:0016020

Map