F428480

General Info

Members Datasets Scaffolds Average Seq Length
379 253 758 172

Family's Representative Sequence

Representative Sequence 3300049575|Ga0501039_0320956|Ga0501039_0320956_512_1036
Length 174
Sequence VAKAIADRKTADLSAYPDLVVIYLGMRVNRLTGWKTLLGFGPKISKAAGAKPDGLLLHESIIYSLRHIGMRQYWRDFDSLERWARSLPHQAWWQGFIRDTGGTGFWHETYFLQGGMESVYLDMEKPTGFLRFATPQPARGAMFTARKRMRMETPETVAVPVGEDELYSTPRSAG

Samples

Sample ID Description Type Environment
1 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
2 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
49 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
50 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
51 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
52 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
56 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
57 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
58 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
63 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
68 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
71 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
72 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
73 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
74 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
75 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
76 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
83 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
84 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
85 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
86 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
88 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
89 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
90 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
130 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
134 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
135 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
136 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
137 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
138 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
139 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
140 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
141 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
142 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
143 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
144 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
145 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
146 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
147 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
148 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
149 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
150 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
151 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
152 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
153 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
154 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
155 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
156 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
157 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
158 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
159 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
160 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
161 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
162 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
163 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
164 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
165 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
166 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
167 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
168 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
169 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
170 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
171 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
172 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
173 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
174 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
175 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
176 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
177 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
178 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
179 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
180 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
181 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
182 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
183 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
184 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
185 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
186 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
187 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
188 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
189 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
190 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
191 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
192 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
193 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
194 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
195 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
196 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
197 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
198 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
199 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
200 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
201 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
202 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
203 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
204 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
205 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
206 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
207 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
208 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
209 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
210 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
211 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
212 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
213 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
214 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
215 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
228 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
229 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
230 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
231 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
232 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
233 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
234 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
235 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
236 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
237 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
238 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
239 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
240 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
241 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
242 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
243 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
244 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
245 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
246 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
247 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
248 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
249 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
250 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
251 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
252 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
253 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.47
Metatranscriptomes 0.53
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.79
Rhizosphere 97.1
Stem 0
Stem Tuber 0
Unclassified 20.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501039_0320956 3300049575 Bacteria 1217
2 LJNas_1000374 3300000546 Bacteria 7862
3 JGI25406J46586_10000708 3300003203 Bacteria 15585
4 JGI25404J52841_10002700 3300003659 Bacteria 3395
5 Ga0065712_10138650 3300005290 Bacteria 1472
6 Ga0070658_10000408 3300005327 Bacteria 37244
7 Ga0070676_10199438 3300005328 Bacteria 1311
8 Ga0070683_100553240 3300005329 Bacteria 1100
9 Ga0070670_100051125 3300005331 Unclassified 3550
10 Ga0070670_100176840 3300005331 Bacteria 1852
11 Ga0068869_100013235 3300005334 Bacteria 5481
12 Ga0068869_100544539 3300005334 Bacteria 974
13 Ga0070682_100548055 3300005337 Unclassified 905
14 Ga0070682_100714770 3300005337 Unclassified 805
15 Ga0070689_100007596 3300005340 Bacteria 7594
16 Ga0070687_100029026 3300005343 Bacteria 2689
17 Ga0070661_100074462 3300005344 Unclassified 2501
18 Ga0070669_100024383 3300005353 Bacteria 4337
19 Ga0070675_100044314 3300005354 Unclassified 3638
20 Ga0070675_100407232 3300005354 Unclassified 1214
21 Ga0070673_100141188 3300005364 Bacteria 2032
22 Ga0070688_100034224 3300005365 Unclassified 3075
23 Ga0070659_100057509 3300005366 Unclassified 3067
24 Ga0070714_100142688 3300005435 Bacteria 2151
25 Ga0070714_100499348 3300005435 Bacteria 1160
26 Ga0070714_101733981 3300005435 Bacteria 610
27 Ga0070713_100037457 3300005436 Unclassified 3921
28 Ga0070713_100134074 3300005436 Bacteria 2187
29 Ga0070701_10047642 3300005438 Bacteria 2208
30 Ga0070701_10144215 3300005438 Bacteria 1365
31 Ga0070711_100497921 3300005439 Bacteria 1004
32 Ga0070711_100765684 3300005439 Bacteria 817
33 Ga0070700_100034859 3300005441 Unclassified 3042
34 Ga0070708_100022011 3300005445 Bacteria 5403
35 Ga0070708_101308316 3300005445 Bacteria 677
36 Ga0070663_100053418 3300005455 Unclassified 2884
37 Ga0070678_100901345 3300005456 Unclassified 808
38 Ga0070681_10181016 3300005458 Bacteria 2029
39 Ga0068867_100315576 3300005459 Bacteria 1293
40 Ga0068867_100633737 3300005459 Bacteria 936
41 Ga0068867_101194493 3300005459 Unclassified 698
42 Ga0070706_100025488 3300005467 Bacteria 5443
43 Ga0070707_100153723 3300005468 Bacteria 2241
44 Ga0070707_100355182 3300005468 Unclassified 1423
45 Ga0070707_100677222 3300005468 Bacteria 994
46 Ga0070698_100294369 3300005471 Unclassified 1554
47 Ga0070698_100426480 3300005471 Bacteria 1261
48 Ga0070697_100597621 3300005536 Unclassified 970
49 Ga0068853_100037047 3300005539 Unclassified 4149
50 Ga0068853_100342446 3300005539 Bacteria 1389
51 Ga0070672_100020008 3300005543 Bacteria 4875
52 Ga0070695_100704242 3300005545 Bacteria 802
53 Ga0070695_101125718 3300005545 Bacteria 643
54 Ga0070696_100338422 3300005546 Unclassified 1162
55 Ga0070693_100349691 3300005547 Unclassified 1011
56 Ga0070665_101724772 3300005548 Unclassified 633
57 Ga0068855_100021705 3300005563 Bacteria 7700
58 Ga0068855_100585303 3300005563 Bacteria 1205
59 Ga0070664_100023040 3300005564 Bacteria 5138
60 Ga0070664_100083769 3300005564 Unclassified 2751
61 Ga0070664_100151748 3300005564 Bacteria 2046
62 Ga0068856_100006174 3300005614 Bacteria 11753
63 Ga0068856_100155321 3300005614 Bacteria 2298
64 Ga0068859_100018365 3300005617 Bacteria 7029
65 Ga0068861_100275140 3300005719 Bacteria 1447
66 Ga0068870_10153088 3300005840 Bacteria 1360
67 Ga0068870_10289961 3300005840 Unclassified 1029
68 Ga0068863_100039767 3300005841 Bacteria 4473
69 Ga0068863_100075592 3300005841 Bacteria 3187
70 Ga0068858_100179626 3300005842 Bacteria 1998
71 Ga0068858_100192877 3300005842 Bacteria 1925
72 Ga0068858_100351148 3300005842 Unclassified 1412
73 Ga0081455_10015859 3300005937 Bacteria 7295
74 Ga0081455_10135233 3300005937 Bacteria 1922
75 Ga0081540_1000047 3300005983 Bacteria 129126
76 Ga0081540_1000702 3300005983 Bacteria 31199
77 Ga0081540_1001184 3300005983 Bacteria 22839
78 Ga0081539_10000209 3300005985 Bacteria 136637
79 Ga0081539_10003863 3300005985 Bacteria 17558
80 Ga0081539_10076767 3300005985 Bacteria 1769
81 Ga0081539_10162877 3300005985 Bacteria 1061
82 Ga0070717_10002444 3300006028 Bacteria 13112
83 Ga0070717_10055056 3300006028 Bacteria 3281
84 Ga0070717_10125156 3300006028 Bacteria 2206
85 Ga0070717_10195202 3300006028 Bacteria 1770
86 Ga0070712_100318145 3300006175 Unclassified 1265
87 Ga0070712_100656804 3300006175 Bacteria 891
88 Ga0097621_100160685 3300006237 Bacteria 1931
89 Ga0097621_100174629 3300006237 Bacteria 1854
90 Ga0097621_100775508 3300006237 Unclassified 887
91 Ga0068871_100291097 3300006358 Bacteria 1431
92 Ga0068871_100752716 3300006358 Unclassified 896
93 Ga0075430_100075120 3300006846 Bacteria 2834
94 Ga0075430_101280602 3300006846 Unclassified 603
95 Ga0075433_10236520 3300006852 Bacteria 1622
96 Ga0075433_10843716 3300006852 Bacteria 800
97 Ga0075434_100001669 3300006871 Bacteria 18928
98 Ga0075434_100187911 3300006871 Bacteria 2086
99 Ga0075434_101155197 3300006871 Bacteria 787
100 Ga0075429_100136831 3300006880 Bacteria 2144
101 Ga0068865_100739058 3300006881 Bacteria 844
102 Ga0075436_100006700 3300006914 Bacteria 7887
103 Ga0075436_100027996 3300006914 Bacteria 3879
104 Ga0097620_100018365 3300006931 Bacteria 7029
105 Ga0075435_100057412 3300007076 Unclassified 3149
106 Ga0075435_100134115 3300007076 Bacteria 2073
107 Ga0099794_10130211 3300007265 Unclassified 1270
108 Ga0105240_10194513 3300009093 Bacteria 2382
109 Ga0105240_10731640 3300009093 Unclassified 1077
110 Ga0114129_11477547 3300009147 Unclassified 836
111 Ga0105243_11800510 3300009148 Bacteria 643
112 Ga0105241_10008984 3300009174 Bacteria 7349
113 Ga0105241_10156991 3300009174 Unclassified 1866
114 Ga0105237_10206616 3300009545 Bacteria 1964
115 Ga0105237_11521211 3300009545 Bacteria 676
116 Ga0105249_10112130 3300009553 Bacteria 2579
117 Ga0099796_10093100 3300010159 Bacteria 1123
118 Ga0105239_10338074 3300010375 Bacteria 1699
119 Ga0105246_10857628 3300011119 Bacteria 811
120 Ga0157373_10062539 3300013100 Bacteria 2637
121 Ga0157370_10772888 3300013104 Bacteria 875
122 Ga0157369_10009486 3300013105 Bacteria 11127
123 Ga0157369_10077614 3300013105 Bacteria 3560
124 Ga0157374_10024658 3300013296 Bacteria 5393
125 Ga0157374_10054096 3300013296 Bacteria 3743
126 Ga0157378_10197188 3300013297 Unclassified 1902
127 Ga0163162_11060107 3300013306 Unclassified 918
128 Ga0157372_10012688 3300013307 Bacteria 8976
129 Ga0157372_10036934 3300013307 Bacteria 5386
130 Ga0157372_10077024 3300013307 Bacteria 3766
131 Ga0157372_10129294 3300013307 Unclassified 2905
132 Ga0157375_10513575 3300013308 Bacteria 1362
133 Ga0163163_10009675 3300014325 Bacteria 8623
134 Ga0163163_10139497 3300014325 Bacteria 2466
135 Ga0157380_10105036 3300014326 Bacteria 2361
136 Ga0157377_10080406 3300014745 Bacteria 1904
137 Ga0157379_10967004 3300014968 Bacteria 810
138 Ga0157376_10019860 3300014969 Bacteria 5187
139 Ga0157376_10312088 3300014969 Bacteria 1492
140 Ga0206353_11975718 3300020082 Bacteria 978
141 Ga0213874_10015212 3300021377 Bacteria 2026
142 Ga0213874_10198597 3300021377 Bacteria 721
143 Ga0213875_10035197 3300021388 Unclassified 2363
144 Ga0228598_1000117 3300024227 Bacteria 13477
145 Ga0207692_10171755 3300025898 Bacteria 1257
146 Ga0207680_10996532 3300025903 Bacteria 600
147 Ga0207647_10310507 3300025904 Bacteria 897
148 Ga0207645_10406242 3300025907 Bacteria 916
149 Ga0207705_10000034 3300025909 Bacteria 216943
150 Ga0207684_10101934 3300025910 Unclassified 2454
151 Ga0207684_10161907 3300025910 Unclassified 1927
152 Ga0207684_10489680 3300025910 Bacteria 1054
153 Ga0207654_10084941 3300025911 Unclassified 1914
154 Ga0207654_10328638 3300025911 Bacteria 1047
155 Ga0207695_10446864 3300025913 Unclassified 1176
156 Ga0207693_10068178 3300025915 Bacteria 2784
157 Ga0207693_10369998 3300025915 Unclassified 1121
158 Ga0207663_10170233 3300025916 Bacteria 1546
159 Ga0207663_10800610 3300025916 Bacteria 750
160 Ga0207649_10051836 3300025920 Unclassified 2543
161 Ga0207652_10331050 3300025921 Bacteria 1375
162 Ga0207646_10165348 3300025922 Bacteria 1997
163 Ga0207646_10571470 3300025922 Bacteria 1016
164 Ga0207681_10021830 3300025923 Bacteria 4075
165 Ga0207650_10006802 3300025925 Bacteria 7798
166 Ga0207650_10702151 3300025925 Bacteria 854
167 Ga0207659_10755447 3300025926 Bacteria 834
168 Ga0207700_10006490 3300025928 Bacteria 7068
169 Ga0207664_10386735 3300025929 Bacteria 1243
170 Ga0207664_10436211 3300025929 Bacteria 1168
171 Ga0207690_10024371 3300025932 Bacteria 3790
172 Ga0207706_10091626 3300025933 Bacteria 2672
173 Ga0207706_10102294 3300025933 Bacteria 2521
174 Ga0207670_10203865 3300025936 Bacteria 1504
175 Ga0207704_10911318 3300025938 Bacteria 740
176 Ga0207691_10025247 3300025940 Bacteria 5580
177 Ga0207711_10282146 3300025941 Bacteria 1530
178 Ga0207689_10030632 3300025942 Bacteria 4483
179 Ga0207689_10354303 3300025942 Bacteria 1220
180 Ga0207661_10492057 3300025944 Bacteria 1120
181 Ga0207679_10120637 3300025945 Bacteria 2086
182 Ga0207679_10160429 3300025945 Unclassified 1841
183 Ga0207679_10346074 3300025945 Bacteria 1294
184 Ga0207667_10010215 3300025949 Bacteria 10995
185 Ga0207667_11280621 3300025949 Bacteria 710
186 Ga0207651_10035153 3300025960 Unclassified 3254
187 Ga0207703_10134046 3300026035 Bacteria 2142
188 Ga0207703_10284069 3300026035 Bacteria 1504
189 Ga0207703_10518949 3300026035 Bacteria 1120
190 Ga0207639_10026801 3300026041 Unclassified 4191
191 Ga0207678_10088541 3300026067 Unclassified 2646
192 Ga0207702_10036388 3300026078 Bacteria 4117
193 Ga0207702_10047743 3300026078 Bacteria 3609
194 Ga0207702_10172937 3300026078 Bacteria 1982
195 Ga0207641_10003094 3300026088 Bacteria 14981
196 Ga0207641_10037079 3300026088 Bacteria 4071
197 Ga0207648_10359111 3300026089 Bacteria 1314
198 Ga0207648_10649006 3300026089 Bacteria 975
199 Ga0207648_11448342 3300026089 Unclassified 646
200 Ga0207676_10729287 3300026095 Bacteria 962
201 Ga0207674_11818143 3300026116 Bacteria 576
202 Ga0207675_100134370 3300026118 Bacteria 2346
203 Ga0207683_10096811 3300026121 Bacteria 2631
204 Ga0207428_10172457 3300027907 Bacteria 1637
205 Ga0268266_11877407 3300028379 Unclassified 573
206 Ga0268265_11797318 3300028380 Bacteria 619
207 Ga0268264_10706385 3300028381 Bacteria 1002
208 Ga0265319_1053478 3300028563 Bacteria 1327
209 Ga0265338_10029725 3300028800 Bacteria 5407
210 Ga0265338_10087034 3300028800 Bacteria 2597
211 Ga0265760_10002995 3300031090 Unclassified 4937
212 Ga0265330_10000709 3300031235 Bacteria 21057
213 Ga0265330_10279932 3300031235 Bacteria 703
214 Ga0265332_10189027 3300031238 Bacteria 857
215 Ga0265328_10023677 3300031239 Bacteria 2327
216 Ga0265320_10125984 3300031240 Bacteria 1165
217 Ga0265325_10003098 3300031241 Bacteria 10973
218 Ga0265325_10009241 3300031241 Bacteria 5763
219 Ga0265329_10054102 3300031242 Unclassified 1275
220 Ga0265340_10038427 3300031247 Bacteria 2367
221 Ga0265339_10001252 3300031249 Bacteria 19113
222 Ga0265339_10010266 3300031249 Bacteria 5826
223 Ga0265339_10063425 3300031249 Bacteria 1984
224 Ga0265331_10049815 3300031250 Unclassified 2011
225 Ga0265331_10233173 3300031250 Bacteria 826
226 Ga0265316_10001986 3300031344 Bacteria 21534
227 Ga0265316_10019555 3300031344 Bacteria 5786
228 Ga0265316_10045884 3300031344 Bacteria 3466
229 Ga0265316_10053848 3300031344 Unclassified 3152
230 Ga0265316_10095531 3300031344 Bacteria 2263
231 Ga0307408_100075049 3300031548 Bacteria 2511
232 Ga0307408_101360479 3300031548 Unclassified 667
233 Ga0265313_10038954 3300031595 Unclassified 2362
234 Ga0265313_10048448 3300031595 Bacteria 2050
235 Ga0265314_10102806 3300031711 Bacteria 1833
236 Ga0265314_10211622 3300031711 Bacteria 1138
237 Ga0265342_10021052 3300031712 Unclassified 4171
238 Ga0265342_10215017 3300031712 Bacteria 1038
239 Ga0307405_10273034 3300031731 Bacteria 1269
240 Ga0307413_10190457 3300031824 Bacteria 1472
241 Ga0307406_10121971 3300031901 Bacteria 1814
242 Ga0307406_10274663 3300031901 Bacteria 1282
243 Ga0307406_10478755 3300031901 Unclassified 1005
244 Ga0307407_10779147 3300031903 Bacteria 726
245 Ga0307412_10073041 3300031911 Unclassified 2346
246 Ga0307416_100032709 3300032002 Bacteria 3934
247 Ga0307414_10113400 3300032004 Bacteria 2069
248 Ga0307411_10234669 3300032005 Bacteria 1432
249 Ga0307415_100070597 3300032126 Unclassified 2453
250 Ga0373929_0088383 3300035085 Bacteria 765
251 Ga0373929_0107432 3300035085 Bacteria 710
252 Ga0373940_0203818 3300035088 Bacteria 651
253 Ga0373939_0170378 3300035114 Bacteria 805
254 Ga0373956_0092934 3300035119 Bacteria 1393
255 Ga0373961_0036890 3300035241 Bacteria 1394
256 Ga0373931_0252278 3300035691 Bacteria 1073
257 Ga0373927_0080075 3300035695 Unclassified 2117
258 Ga0373947_0814013 3300035725 Bacteria 638
259 Ga0395900_0047311 3300037418 Bacteria 4428
260 Ga0395900_0642924 3300037418 Bacteria 998
261 Ga0395898_0053732 3300037466 Bacteria 3933
262 Ga0395898_0081221 3300037466 Bacteria 3126
263 Ga0436364_0200667 3300037853 Bacteria 3744
264 Ga0436364_0262859 3300037853 Bacteria 9821
265 Ga0395901_0061624 3300038443 Bacteria 3903
266 Ga0395901_0452978 3300038443 Bacteria 1312
267 Ga0395901_1009048 3300038443 Bacteria 808
268 Ga0436365_0537660 3300039437 Unclassified 619
269 Ga0436365_1073864 3300039437 Bacteria 2580
270 Ga0436363_0840720 3300039450 Unclassified 1612
271 Ga0439437_006023 3300042000 Bacteria 1340
272 Ga0439448_0046920 3300042005 Unclassified 1408
273 Ga0439450_050818 3300042008 Unclassified 984
274 Ga0439460_0058937 3300042461 Unclassified 1168
275 Ga0451577_0879409 3300042876 Bacteria 807
276 Ga0466966_0512627 3300044684 Bacteria 721
277 Ga0466963_0713461 3300044694 Bacteria 708
278 Ga0453684_0005114 3300044712 Bacteria 26421
279 Ga0451576_1505798 3300045051 Bacteria 699
280 Ga0495653_0100645 3300046463 Bacteria 2095
281 Ga0495639_0613868 3300046475 Unclassified 559
282 Ga0495584_0126908 3300046491 Bacteria 1293
283 Ga0495585_0010467 3300046492 Bacteria 5516
284 Ga0495585_0193730 3300046492 Bacteria 1038
285 Ga0495596_0088606 3300046500 Unclassified 1201
286 Ga0495608_0585475 3300046511 Bacteria 670
287 Ga0495631_0006001 3300046518 Bacteria 6316
288 Ga0495652_0769020 3300046529 Bacteria 643
289 Ga0495665_0120508 3300046531 Unclassified 1374
290 Ga0495598_0001817 3300046537 Bacteria 4295
291 Ga0495598_0018640 3300046537 Bacteria 1807
292 Ga0495598_0046087 3300046537 Bacteria 1295
293 Ga0495621_0004387 3300046539 Bacteria 3965
294 Ga0495633_0005280 3300046558 Bacteria 7949
295 Ga0495633_0259999 3300046558 Bacteria 791
296 Ga0495667_0060781 3300046559 Bacteria 2478
297 Ga0495656_0232927 3300046615 Unclassified 925
298 Ga0495668_0055704 3300046616 Bacteria 2183
299 Ga0495634_0581271 3300046642 Bacteria 651
300 Ga0495611_0043906 3300046648 Bacteria 1999
301 Ga0495659_0000501 3300046664 Bacteria 14433
302 Ga0495661_0004336 3300046665 Bacteria 10266
303 Ga0495661_0325163 3300046665 Bacteria 763
304 Ga0495658_0070933 3300046683 Bacteria 2023
305 Ga0495670_0002112 3300046691 Bacteria 9811
306 Ga0495670_0465806 3300046691 Bacteria 685
307 Ga0495671_0322171 3300046692 Unclassified 742
308 Ga0495604_0366812 3300047317 Bacteria 954
309 Ga0495674_0110555 3300047319 Bacteria 2330
310 Ga0495680_0626616 3300047322 Bacteria 717
311 Ga0495683_0103059 3300047323 Bacteria 1370
312 Ga0495687_003092 3300047443 Bacteria 12465
313 Ga0495677_0003478 3300047445 Bacteria 6115
314 Ga0495681_0002284 3300047470 Bacteria 13781
315 Ga0495681_0012709 3300047470 Unclassified 4931
316 Ga0495593_0313689 3300047673 Bacteria 784
317 Ga0496104_0239695 3300048907 Unclassified 1726
318 Ga0496112_0023709 3300048915 Bacteria 5870
319 Ga0496114_0809163 3300048917 Unclassified 816
320 Ga0501031_0007479 3300049568 Bacteria 7115
321 Ga0501032_0106836 3300049569 Bacteria 1854
322 Ga0501033_0022371 3300049570 Bacteria 4769
323 Ga0501034_0497606 3300049571 Bacteria 1133
324 Ga0501036_0004026 3300049572 Bacteria 11819
325 Ga0501039_0057165 3300049575 Unclassified 3021
326 Ga0501040_0000865 3300049576 Bacteria 19003
327 Ga0501040_0335655 3300049576 Bacteria 1082
328 Ga0501041_0010819 3300049577 Bacteria 5382
329 Ga0501041_0155437 3300049577 Bacteria 1429
330 Ga0501042_0089585 3300049578 Bacteria 2207
331 Ga0501043_0005532 3300049579 Bacteria 10194
332 Ga0501046_0021179 3300049580 Bacteria 5368
333 Ga0501046_0188915 3300049580 Bacteria 1537
334 Ga0501047_0166731 3300049581 Bacteria 2073
335 Ga0501048_0035782 3300049582 Bacteria 3572
336 Ga0501048_0040545 3300049582 Bacteria 3336
337 Ga0501067_0146052 3300049583 Bacteria 1318
338 Ga0501068_0109692 3300049584 Bacteria 1715
339 Ga0501071_0001641 3300049587 Bacteria 13141
340 Ga0501071_0224947 3300049587 Archaea 1413
341 Ga0501072_0159897 3300049588 Bacteria 1797
342 Ga0501074_0017288 3300049590 Bacteria 5231
343 Ga0501075_0014811 3300049591 Bacteria 5591
344 Ga0501075_0164538 3300049591 Bacteria 1692
345 Ga0501076_0056225 3300049592 Bacteria 3122
346 Ga0501076_0298514 3300049592 Bacteria 1320
347 Ga0501077_0079896 3300049593 Bacteria 2072
348 Ga0501077_0120005 3300049593 Bacteria 1666
349 Ga0501079_0014790 3300049741 Bacteria 5949
350 Ga0501079_0093686 3300049741 Bacteria 2327
351 Ga0501080_0531493 3300049742 Bacteria 1048
352 Ga0501081_0014762 3300049743 Bacteria 5154
353 Ga0501083_0488249 3300049744 Bacteria 802
354 Ga0501035_0045068 3300049822 Bacteria 3969
355 Ga0501035_0551592 3300049822 Bacteria 944
356 Ga0501045_0041459 3300049824 Unclassified 3349
357 Ga0501045_0126987 3300049824 Bacteria 1895
358 nmdc:mga05p37_1424093_c1 3300050507 Unclassified 696
359 nmdc:mga05p37_24133_c1 3300050507 Bacteria 7387
360 nmdc:mga0qj67_56988_c1 3300050509 Bacteria 3098
361 nmdc:mga06r32_112237_c1 3300050510 Bacteria 2682
362 nmdc:mga08y16_1372753_c1 3300050511 Bacteria 671
363 nmdc:mga08y16_315209_c1 3300050511 Bacteria 1611
364 nmdc:mga0n895_13543_c1 3300050512 Bacteria 7365
365 nmdc:mga0n895_222817_c1 3300050512 Bacteria 1915
366 nmdc:mga0n895_398733_c1 3300050512 Bacteria 1391
367 nmdc:mga0rr50_23358_c1 3300050513 Bacteria 4263
368 nmdc:mga0rr50_99859_c1 3300050513 Bacteria 2278
369 nmdc:mga08x19_17666_c1 3300050514 Unclassified 4368
370 nmdc:mga08x19_85342_c1 3300050514 Bacteria 2078
371 nmdc:mga0a205_175046_c1 3300050515 Bacteria 2041
372 nmdc:mga0a205_96487_c1 3300050515 Bacteria 2855
373 Ga0495601_0005060 3300053077 Bacteria 7651
374 Ga0495619_0004677 3300053085 Bacteria 8721
375 Ga0501084_0027243 3300054114 Bacteria 4776
376 Ga0501084_0106435 3300054114 Bacteria 2356
377 Ga0501082_0002133 3300060353 Bacteria 17346
378 Ga0530510_0001973 3300061734 Bacteria 14057
379 Ga0530510_0056488 3300061734 Bacteria 2836
380 Ga0501039_0320956
381 LJNas_1000374
382 JGI25406J46586_10000708
383 JGI25404J52841_10002700
384 Ga0065712_10138650
385 Ga0070658_10000408
386 Ga0070676_10199438
387 Ga0070683_100553240
388 Ga0070670_100051125
389 Ga0070670_100176840
390 Ga0068869_100013235
391 Ga0068869_100544539
392 Ga0070682_100548055
393 Ga0070682_100714770
394 Ga0070689_100007596
395 Ga0070687_100029026
396 Ga0070661_100074462
397 Ga0070669_100024383
398 Ga0070675_100044314
399 Ga0070675_100407232
400 Ga0070673_100141188
401 Ga0070688_100034224
402 Ga0070659_100057509
403 Ga0070714_100142688
404 Ga0070714_100499348
405 Ga0070714_101733981
406 Ga0070713_100037457
407 Ga0070713_100134074
408 Ga0070701_10047642
409 Ga0070701_10144215
410 Ga0070711_100497921
411 Ga0070711_100765684
412 Ga0070700_100034859
413 Ga0070708_100022011
414 Ga0070708_101308316
415 Ga0070663_100053418
416 Ga0070678_100901345
417 Ga0070681_10181016
418 Ga0068867_100315576
419 Ga0068867_100633737
420 Ga0068867_101194493
421 Ga0070706_100025488
422 Ga0070707_100153723
423 Ga0070707_100355182
424 Ga0070707_100677222
425 Ga0070698_100294369
426 Ga0070698_100426480
427 Ga0070697_100597621
428 Ga0068853_100037047
429 Ga0068853_100342446
430 Ga0070672_100020008
431 Ga0070695_100704242
432 Ga0070695_101125718
433 Ga0070696_100338422
434 Ga0070693_100349691
435 Ga0070665_101724772
436 Ga0068855_100021705
437 Ga0068855_100585303
438 Ga0070664_100023040
439 Ga0070664_100083769
440 Ga0070664_100151748
441 Ga0068856_100006174
442 Ga0068856_100155321
443 Ga0068859_100018365
444 Ga0068861_100275140
445 Ga0068870_10153088
446 Ga0068870_10289961
447 Ga0068863_100039767
448 Ga0068863_100075592
449 Ga0068858_100179626
450 Ga0068858_100192877
451 Ga0068858_100351148
452 Ga0081455_10015859
453 Ga0081455_10135233
454 Ga0081540_1000047
455 Ga0081540_1000702
456 Ga0081540_1001184
457 Ga0081539_10000209
458 Ga0081539_10003863
459 Ga0081539_10076767
460 Ga0081539_10162877
461 Ga0070717_10002444
462 Ga0070717_10055056
463 Ga0070717_10125156
464 Ga0070717_10195202
465 Ga0070712_100318145
466 Ga0070712_100656804
467 Ga0097621_100160685
468 Ga0097621_100174629
469 Ga0097621_100775508
470 Ga0068871_100291097
471 Ga0068871_100752716
472 Ga0075430_100075120
473 Ga0075430_101280602
474 Ga0075433_10236520
475 Ga0075433_10843716
476 Ga0075434_100001669
477 Ga0075434_100187911
478 Ga0075434_101155197
479 Ga0075429_100136831
480 Ga0068865_100739058
481 Ga0075436_100006700
482 Ga0075436_100027996
483 Ga0097620_100018365
484 Ga0075435_100057412
485 Ga0075435_100134115
486 Ga0099794_10130211
487 Ga0105240_10194513
488 Ga0105240_10731640
489 Ga0114129_11477547
490 Ga0105243_11800510
491 Ga0105241_10008984
492 Ga0105241_10156991
493 Ga0105237_10206616
494 Ga0105237_11521211
495 Ga0105249_10112130
496 Ga0099796_10093100
497 Ga0105239_10338074
498 Ga0105246_10857628
499 Ga0157373_10062539
500 Ga0157370_10772888
501 Ga0157369_10009486
502 Ga0157369_10077614
503 Ga0157374_10024658
504 Ga0157374_10054096
505 Ga0157378_10197188
506 Ga0163162_11060107
507 Ga0157372_10012688
508 Ga0157372_10036934
509 Ga0157372_10077024
510 Ga0157372_10129294
511 Ga0157375_10513575
512 Ga0163163_10009675
513 Ga0163163_10139497
514 Ga0157380_10105036
515 Ga0157377_10080406
516 Ga0157379_10967004
517 Ga0157376_10019860
518 Ga0157376_10312088
519 Ga0206353_11975718
520 Ga0213874_10015212
521 Ga0213874_10198597
522 Ga0213875_10035197
523 Ga0228598_1000117
524 Ga0207692_10171755
525 Ga0207680_10996532
526 Ga0207647_10310507
527 Ga0207645_10406242
528 Ga0207705_10000034
529 Ga0207684_10101934
530 Ga0207684_10161907
531 Ga0207684_10489680
532 Ga0207654_10084941
533 Ga0207654_10328638
534 Ga0207695_10446864
535 Ga0207693_10068178
536 Ga0207693_10369998
537 Ga0207663_10170233
538 Ga0207663_10800610
539 Ga0207649_10051836
540 Ga0207652_10331050
541 Ga0207646_10165348
542 Ga0207646_10571470
543 Ga0207681_10021830
544 Ga0207650_10006802
545 Ga0207650_10702151
546 Ga0207659_10755447
547 Ga0207700_10006490
548 Ga0207664_10386735
549 Ga0207664_10436211
550 Ga0207690_10024371
551 Ga0207706_10091626
552 Ga0207706_10102294
553 Ga0207670_10203865
554 Ga0207704_10911318
555 Ga0207691_10025247
556 Ga0207711_10282146
557 Ga0207689_10030632
558 Ga0207689_10354303
559 Ga0207661_10492057
560 Ga0207679_10120637
561 Ga0207679_10160429
562 Ga0207679_10346074
563 Ga0207667_10010215
564 Ga0207667_11280621
565 Ga0207651_10035153
566 Ga0207703_10134046
567 Ga0207703_10284069
568 Ga0207703_10518949
569 Ga0207639_10026801
570 Ga0207678_10088541
571 Ga0207702_10036388
572 Ga0207702_10047743
573 Ga0207702_10172937
574 Ga0207641_10003094
575 Ga0207641_10037079
576 Ga0207648_10359111
577 Ga0207648_10649006
578 Ga0207648_11448342
579 Ga0207676_10729287
580 Ga0207674_11818143
581 Ga0207675_100134370
582 Ga0207683_10096811
583 Ga0207428_10172457
584 Ga0268266_11877407
585 Ga0268265_11797318
586 Ga0268264_10706385
587 Ga0265319_1053478
588 Ga0265338_10029725
589 Ga0265338_10087034
590 Ga0265760_10002995
591 Ga0265330_10000709
592 Ga0265330_10279932
593 Ga0265332_10189027
594 Ga0265328_10023677
595 Ga0265320_10125984
596 Ga0265325_10003098
597 Ga0265325_10009241
598 Ga0265329_10054102
599 Ga0265340_10038427
600 Ga0265339_10001252
601 Ga0265339_10010266
602 Ga0265339_10063425
603 Ga0265331_10049815
604 Ga0265331_10233173
605 Ga0265316_10001986
606 Ga0265316_10019555
607 Ga0265316_10045884
608 Ga0265316_10053848
609 Ga0265316_10095531
610 Ga0307408_100075049
611 Ga0307408_101360479
612 Ga0265313_10038954
613 Ga0265313_10048448
614 Ga0265314_10102806
615 Ga0265314_10211622
616 Ga0265342_10021052
617 Ga0265342_10215017
618 Ga0307405_10273034
619 Ga0307413_10190457
620 Ga0307406_10121971
621 Ga0307406_10274663
622 Ga0307406_10478755
623 Ga0307407_10779147
624 Ga0307412_10073041
625 Ga0307416_100032709
626 Ga0307414_10113400
627 Ga0307411_10234669
628 Ga0307415_100070597
629 Ga0373929_0088383
630 Ga0373929_0107432
631 Ga0373940_0203818
632 Ga0373939_0170378
633 Ga0373956_0092934
634 Ga0373961_0036890
635 Ga0373931_0252278
636 Ga0373927_0080075
637 Ga0373947_0814013
638 Ga0395900_0047311
639 Ga0395900_0642924
640 Ga0395898_0053732
641 Ga0395898_0081221
642 Ga0436364_0200667
643 Ga0436364_0262859
644 Ga0395901_0061624
645 Ga0395901_0452978
646 Ga0395901_1009048
647 Ga0436365_0537660
648 Ga0436365_1073864
649 Ga0436363_0840720
650 Ga0439437_006023
651 Ga0439448_0046920
652 Ga0439450_050818
653 Ga0439460_0058937
654 Ga0451577_0879409
655 Ga0466966_0512627
656 Ga0466963_0713461
657 Ga0453684_0005114
658 Ga0451576_1505798
659 Ga0495653_0100645
660 Ga0495639_0613868
661 Ga0495584_0126908
662 Ga0495585_0010467
663 Ga0495585_0193730
664 Ga0495596_0088606
665 Ga0495608_0585475
666 Ga0495631_0006001
667 Ga0495652_0769020
668 Ga0495665_0120508
669 Ga0495598_0001817
670 Ga0495598_0018640
671 Ga0495598_0046087
672 Ga0495621_0004387
673 Ga0495633_0005280
674 Ga0495633_0259999
675 Ga0495667_0060781
676 Ga0495656_0232927
677 Ga0495668_0055704
678 Ga0495634_0581271
679 Ga0495611_0043906
680 Ga0495659_0000501
681 Ga0495661_0004336
682 Ga0495661_0325163
683 Ga0495658_0070933
684 Ga0495670_0002112
685 Ga0495670_0465806
686 Ga0495671_0322171
687 Ga0495604_0366812
688 Ga0495674_0110555
689 Ga0495680_0626616
690 Ga0495683_0103059
691 Ga0495687_003092
692 Ga0495677_0003478
693 Ga0495681_0002284
694 Ga0495681_0012709
695 Ga0495593_0313689
696 Ga0496104_0239695
697 Ga0496112_0023709
698 Ga0496114_0809163
699 Ga0501031_0007479
700 Ga0501032_0106836
701 Ga0501033_0022371
702 Ga0501034_0497606
703 Ga0501036_0004026
704 Ga0501039_0057165
705 Ga0501040_0000865
706 Ga0501040_0335655
707 Ga0501041_0010819
708 Ga0501041_0155437
709 Ga0501042_0089585
710 Ga0501043_0005532
711 Ga0501046_0021179
712 Ga0501046_0188915
713 Ga0501047_0166731
714 Ga0501048_0035782
715 Ga0501048_0040545
716 Ga0501067_0146052
717 Ga0501068_0109692
718 Ga0501071_0001641
719 Ga0501071_0224947
720 Ga0501072_0159897
721 Ga0501074_0017288
722 Ga0501075_0014811
723 Ga0501075_0164538
724 Ga0501076_0056225
725 Ga0501076_0298514
726 Ga0501077_0079896
727 Ga0501077_0120005
728 Ga0501079_0014790
729 Ga0501079_0093686
730 Ga0501080_0531493
731 Ga0501081_0014762
732 Ga0501083_0488249
733 Ga0501035_0045068
734 Ga0501035_0551592
735 Ga0501045_0041459
736 Ga0501045_0126987
737 nmdc:mga05p37_1424093_c1
738 nmdc:mga05p37_24133_c1
739 nmdc:mga0qj67_56988_c1
740 nmdc:mga06r32_112237_c1
741 nmdc:mga08y16_1372753_c1
742 nmdc:mga08y16_315209_c1
743 nmdc:mga0n895_13543_c1
744 nmdc:mga0n895_222817_c1
745 nmdc:mga0n895_398733_c1
746 nmdc:mga0rr50_23358_c1
747 nmdc:mga0rr50_99859_c1
748 nmdc:mga08x19_17666_c1
749 nmdc:mga08x19_85342_c1
750 nmdc:mga0a205_175046_c1
751 nmdc:mga0a205_96487_c1
752 Ga0495601_0005060
753 Ga0495619_0004677
754 Ga0501084_0027243
755 Ga0501084_0106435
756 Ga0501082_0002133
757 Ga0530510_0001973
758 Ga0530510_0056488

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13826

Monooxy_af470-like

Monooxygenase af470-like

19

129

0.94

PF13816

Dehydratase_hem

Haem-containing dehydratase

64

161

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
2fb0-assembly1.cif.gz_A-2 crystal structure of conserved protein of unknown function from bacteroides thetaiotaomicron vpi-5482 at 2.10 a resolution, possible oxidoreductase 0.789 16 112
2fb0-assembly1.cif.gz_A-2 crystal structure of conserved protein of unknown function from bacteroides thetaiotaomicron vpi-5482 at 2.10 a resolution, possible oxidoreductase 0.7683 16 112
3kng-assembly1.cif.gz_B crystal structure of snoab, a cofactor-independent oxygenase from streptomyces nogalater, determined to 1.9 resolution 0.752 17 111
8ecp-assembly1.cif.gz_B r16a pa0709 with bme modifications 0.7465 19 97
3w08-assembly1.cif.gz_B crystal structure of aldoxime dehydratase 0.7439 14 121
ID Description Score Start End Superfamily
af_Q55CR9_1_97_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7783 16 112 3.30.70.100
af_A3KQL1_329_418_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7646 21 95 3.30.70.100
af_Q55CR9_1_97_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7452 16 112 3.30.70.100
af_Q96P71_296_384_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7387 19 95 3.30.70.100
3kg1A00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7364 19 111 3.30.70.100
ID Description Score Start End GO Terms
AF-W3ZWW9-F1-model_v4 deleted 0.9262 2 168
AF-A0A345WTR3-F1-model_v4 DUF4188 domain-containing protein 0.9228 19 150
AF-A0A433WW30-F1-model_v4 DUF4188 domain-containing protein 0.9191 1 112
AF-W3ZWW9-F1-model_v4 deleted 0.9158 2 168
AF-A0A7W1D2N8-F1-model_v4 DUF4188 domain-containing protein 0.9096 26 166

Map