F428444

General Info

Members Datasets Scaffolds Average Seq Length
379 237 758 123

Family's Representative Sequence

Representative Sequence 3300046455|Ga0495603_0315772|Ga0495603_0315772_326_694
Length 117
Sequence VRRVYLAGPPFADEYRRRATALVRGHDGEPVDPMRRDFRGGTEIVDGDLADIDSCDAVLAAFTAPDEGTSMEAWYAHSKGIPVVAYTGGEPAHPWTVYVSETVHVTLEDAVAAACNV

Samples

Sample ID Description Type Environment
1 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
4 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
5 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
6 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
7 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
8 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
9 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
10 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
11 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
14 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
15 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
16 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
17 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
23 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
29 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
30 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
31 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
32 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
33 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
34 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
35 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
37 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
38 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
39 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
40 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
41 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
43 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
44 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
45 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
46 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
47 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
48 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
49 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
50 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
51 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
52 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
53 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
54 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
55 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
56 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
57 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
58 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
59 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
60 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
61 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
91 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
92 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
93 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
94 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
95 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
96 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
97 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
98 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
99 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
100 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
101 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
102 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
103 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
104 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
105 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
106 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
107 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
108 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
109 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
110 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
111 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
112 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
113 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
114 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
115 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
116 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
117 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
118 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
119 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
120 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
121 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
122 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
123 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
124 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
125 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
126 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
127 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
128 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
129 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
130 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
131 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
132 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
133 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
134 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
135 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
136 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
137 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
138 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
139 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
140 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
141 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
142 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
143 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
144 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
145 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
146 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
147 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
148 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
149 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
150 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
151 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
152 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
153 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
154 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
155 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
156 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
157 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
158 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
159 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
160 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
161 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
162 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
163 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
164 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
165 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
166 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
167 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
168 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
169 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
170 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
171 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
172 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
173 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
174 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
175 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
176 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
177 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
178 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
179 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
180 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
181 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
182 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
183 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
184 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
185 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
186 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
187 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
188 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
189 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
190 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
191 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
192 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
193 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
194 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
195 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
196 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
197 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
198 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
199 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
213 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
214 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
215 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
216 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
217 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
218 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
219 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
220 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
221 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
222 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
223 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
224 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
225 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
226 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
227 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
228 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
229 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
230 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
231 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
232 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
233 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
234 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
235 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
236 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
237 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.74
Metatranscriptomes 0.26
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 16.09
Rhizosphere 83.11
Stem 0
Stem Tuber 0
Unclassified 12.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495603_0315772 3300046455 Bacteria 897
2 Ga0070683_100064585 3300005329 Bacteria 3408
3 Ga0070683_100146092 3300005329 Bacteria 2241
4 Ga0070691_10434050 3300005341 Bacteria 747
5 Ga0070661_101942204 3300005344 Unclassified 501
6 Ga0070674_100873127 3300005356 Bacteria 782
7 Ga0070714_100191571 3300005435 Bacteria 1866
8 Ga0070714_101550912 3300005435 Unclassified 647
9 Ga0070713_100099373 3300005436 Bacteria 2517
10 Ga0070713_100235982 3300005436 Bacteria 1664
11 Ga0070713_100238600 3300005436 Unclassified 1655
12 Ga0070713_101246723 3300005436 Unclassified 720
13 Ga0070710_10376434 3300005437 Bacteria 946
14 Ga0070711_100209045 3300005439 Bacteria 1510
15 Ga0070708_100337741 3300005445 Bacteria 1420
16 Ga0070708_101016416 3300005445 Bacteria 777
17 Ga0070663_100009497 3300005455 Bacteria 6025
18 Ga0070681_10071390 3300005458 Bacteria 3437
19 Ga0070681_10084869 3300005458 Bacteria 3119
20 Ga0070681_10281385 3300005458 Bacteria 1574
21 Ga0070685_11143132 3300005466 Unclassified 590
22 Ga0070706_100200998 3300005467 Bacteria 1862
23 Ga0070707_100422697 3300005468 Bacteria 1293
24 Ga0070698_100138736 3300005471 Bacteria 2384
25 Ga0070699_101545453 3300005518 Bacteria 608
26 Ga0070679_101670982 3300005530 Unclassified 585
27 Ga0070684_100195688 3300005535 Bacteria 1841
28 Ga0070697_100082922 3300005536 Bacteria 2644
29 Ga0068853_100125278 3300005539 Bacteria 2295
30 Ga0070696_100554679 3300005546 Bacteria 921
31 Ga0070693_100026310 3300005547 Bacteria 3140
32 Ga0070665_100089442 3300005548 Bacteria 3085
33 Ga0070664_100593635 3300005564 Bacteria 1027
34 Ga0070664_101804274 3300005564 Unclassified 580
35 Ga0068856_100132405 3300005614 Unclassified 2498
36 Ga0068852_100497241 3300005616 Bacteria 1214
37 Ga0081455_10019134 3300005937 Bacteria 6490
38 Ga0081455_10040788 3300005937 Unclassified 4090
39 Ga0081455_10061750 3300005937 Bacteria 3152
40 Ga0081538_10037284 3300005981 Bacteria 3157
41 Ga0081538_10086279 3300005981 Bacteria 1644
42 Ga0081540_1046208 3300005983 Bacteria 2201
43 Ga0070717_10226133 3300006028 Unclassified 1646
44 Ga0070715_10011358 3300006163 Bacteria 3206
45 Ga0070715_10208403 3300006163 Bacteria 997
46 Ga0070715_10325442 3300006163 Unclassified 831
47 Ga0070716_100026514 3300006173 Bacteria 3104
48 Ga0070716_100588990 3300006173 Unclassified 835
49 Ga0070716_100951428 3300006173 Bacteria 676
50 Ga0070712_100087872 3300006175 Bacteria 2269
51 Ga0070712_100126683 3300006175 Bacteria 1930
52 Ga0070712_100178032 3300006175 Bacteria 1655
53 Ga0070712_101481823 3300006175 Bacteria 593
54 Ga0097621_100059046 3300006237 Bacteria 3139
55 Ga0068871_100061497 3300006358 Bacteria 3067
56 Ga0075434_100158142 3300006871 Bacteria 2286
57 Ga0075434_100316528 3300006871 Bacteria 1581
58 Ga0068865_100696400 3300006881 Bacteria 868
59 Ga0075436_100352449 3300006914 Bacteria 1061
60 Ga0075435_100018815 3300007076 Bacteria 5262
61 Ga0075435_100200760 3300007076 Bacteria 1690
62 Ga0111539_10056082 3300009094 Bacteria 4684
63 Ga0105245_10765452 3300009098 Bacteria 1002
64 Ga0105245_10812266 3300009098 Bacteria 974
65 Ga0105247_10827674 3300009101 Bacteria 709
66 Ga0105243_10253454 3300009148 Bacteria 1572
67 Ga0105243_10672564 3300009148 Unclassified 1006
68 Ga0105241_10744433 3300009174 Bacteria 898
69 Ga0105241_11021693 3300009174 Unclassified 774
70 Ga0105242_10035410 3300009176 Bacteria 4003
71 Ga0105242_12407710 3300009176 Unclassified 574
72 Ga0105248_10841821 3300009177 Bacteria 1035
73 Ga0105238_12916470 3300009551 Unclassified 514
74 Ga0105249_10879071 3300009553 Bacteria 963
75 Ga0105239_10145916 3300010375 Bacteria 2639
76 Ga0157373_10097456 3300013100 Bacteria 2070
77 Ga0157373_11248224 3300013100 Bacteria 561
78 Ga0157369_11081044 3300013105 Bacteria 820
79 Ga0157374_10484971 3300013296 Bacteria 1240
80 Ga0157374_11169045 3300013296 Bacteria 790
81 Ga0157372_10295581 3300013307 Unclassified 1884
82 Ga0157372_11639732 3300013307 Bacteria 740
83 Ga0157375_11033520 3300013308 Bacteria 960
84 Ga0157375_12007995 3300013308 Bacteria 687
85 Ga0163163_10053024 3300014325 Bacteria 4003
86 Ga0163163_11963479 3300014325 Bacteria 645
87 Ga0163163_13226249 3300014325 Unclassified 509
88 Ga0157380_10896757 3300014326 Bacteria 912
89 Ga0157379_10867341 3300014968 Unclassified 855
90 Ga0157376_10071165 3300014969 Bacteria 2955
91 Ga0157376_10674519 3300014969 Bacteria 1036
92 Ga0206354_11525840 3300020081 Unclassified 525
93 Ga0207692_10162144 3300025898 Bacteria 1289
94 Ga0207692_10548584 3300025898 Bacteria 738
95 Ga0207642_10396901 3300025899 Unclassified 824
96 Ga0207685_10017187 3300025905 Bacteria 2333
97 Ga0207643_10318254 3300025908 Bacteria 971
98 Ga0207684_10068641 3300025910 Bacteria 3012
99 Ga0207707_10478151 3300025912 Bacteria 1064
100 Ga0207693_10027562 3300025915 Bacteria 4490
101 Ga0207693_10072593 3300025915 Bacteria 2694
102 Ga0207663_10035305 3300025916 Bacteria 2998
103 Ga0207663_10106103 3300025916 Unclassified 1898
104 Ga0207663_10725496 3300025916 Bacteria 788
105 Ga0207660_10027283 3300025917 Bacteria 3895
106 Ga0207652_10981875 3300025921 Unclassified 743
107 Ga0207646_10431223 3300025922 Bacteria 1189
108 Ga0207664_10039429 3300025929 Bacteria 3667
109 Ga0207664_10147195 3300025929 Bacteria 1998
110 Ga0207686_10339985 3300025934 Bacteria 1127
111 Ga0207686_11292568 3300025934 Unclassified 599
112 Ga0207709_10309918 3300025935 Unclassified 1177
113 Ga0207669_10663555 3300025937 Bacteria 854
114 Ga0207704_11642558 3300025938 Unclassified 552
115 Ga0207665_10108416 3300025939 Bacteria 1948
116 Ga0207665_10435686 3300025939 Bacteria 1004
117 Ga0207711_10937153 3300025941 Bacteria 804
118 Ga0207661_10294104 3300025944 Bacteria 1454
119 Ga0207667_11667720 3300025949 Unclassified 605
120 Ga0207712_10265532 3300025961 Bacteria 1394
121 Ga0207640_10542682 3300025981 Bacteria 975
122 Ga0207702_11149033 3300026078 Bacteria 770
123 Ga0207648_10016547 3300026089 Bacteria 6735
124 Ga0207674_11789778 3300026116 Bacteria 581
125 Ga0207675_100187780 3300026118 Bacteria 1981
126 Ga0207683_10011725 3300026121 Bacteria 7481
127 Ga0207683_10017440 3300026121 Bacteria 6119
128 Ga0268266_10253371 3300028379 Bacteria 1629
129 Ga0268264_10068619 3300028381 Bacteria 2997
130 Ga0265337_1183001 3300028556 Bacteria 569
131 Ga0265338_10019538 3300028800 Bacteria 7180
132 Ga0265338_10511312 3300028800 Bacteria 844
133 Ga0265331_10416563 3300031250 Unclassified 603
134 Ga0307408_100630884 3300031548 Bacteria 956
135 Ga0265314_10236278 3300031711 Bacteria 1057
136 Ga0307406_11505006 3300031901 Bacteria 592
137 Ga0307409_100203807 3300031995 Bacteria 1772
138 Ga0307416_100327228 3300032002 Bacteria 1538
139 Ga0307416_100336026 3300032002 Bacteria 1521
140 Ga0307416_100861758 3300032002 Bacteria 1004
141 Ga0307411_10531848 3300032005 Unclassified 1000
142 Ga0307415_100028978 3300032126 Bacteria 3531
143 Ga0307415_100058447 3300032126 Bacteria 2655
144 Ga0307415_100297739 3300032126 Bacteria 1335
145 Ga0307415_101870059 3300032126 Bacteria 582
146 Ga0373959_0006641 3300034820 Bacteria 1927
147 Ga0373938_0017318 3300034957 Bacteria 1418
148 Ga0373929_0038234 3300035085 Bacteria 1055
149 Ga0373944_0030069 3300035089 Bacteria 1627
150 Ga0373944_0169553 3300035089 Bacteria 778
151 Ga0373951_0013424 3300035091 Bacteria 1842
152 Ga0373932_0007337 3300035112 Bacteria 2625
153 Ga0373939_0429004 3300035114 Bacteria 553
154 Ga0373941_0036623 3300035115 Bacteria 1493
155 Ga0373941_0046755 3300035115 Bacteria 1361
156 Ga0373945_0012114 3300035116 Bacteria 2859
157 Ga0373960_0161384 3300035121 Bacteria 772
158 Ga0373943_0002676 3300035170 Bacteria 8100
159 Ga0373943_0030792 3300035170 Bacteria 2542
160 Ga0373946_0206714 3300035171 Bacteria 942
161 Ga0373946_0506787 3300035171 Unclassified 619
162 Ga0373942_0154297 3300035207 Bacteria 739
163 Ga0373962_0372143 3300035242 Bacteria 520
164 Ga0373935_0019661 3300035692 Bacteria 4117
165 Ga0373927_0256133 3300035695 Bacteria 1151
166 Ga0373947_0001170 3300035725 Bacteria 16135
167 Ga0373925_0002413 3300037068 Bacteria 14989
168 Ga0373925_0035952 3300037068 Bacteria 3656
169 Ga0395900_0010201 3300037418 Bacteria 9607
170 Ga0395900_0249202 3300037418 Unclassified 1778
171 Ga0395900_1102864 3300037418 Bacteria 711
172 Ga0395898_0205414 3300037466 Unclassified 1880
173 Ga0395898_0965110 3300037466 Bacteria 789
174 Ga0395905_0098958 3300037471 Bacteria 2739
175 Ga0395901_0035394 3300038443 Bacteria 5158
176 Ga0395901_0435602 3300038443 Bacteria 1343
177 Ga0395901_0980278 3300038443 Bacteria 822
178 Ga0242420_044392 3300038996 Bacteria 856
179 Ga0439453_0037955 3300041408 Bacteria 936
180 Ga0451800_0279120 3300041459 Bacteria 673
181 Ga0451853_0268203 3300041512 Bacteria 617
182 Ga0451853_1157851 3300041512 Bacteria 760
183 Ga0451853_2547907 3300041512 Bacteria 842
184 Ga0439454_069670 3300042011 Bacteria 622
185 Ga0439464_0211477 3300042439 Bacteria 621
186 Ga0439440_0082823 3300042993 Bacteria 851
187 Ga0466972_0608456 3300044658 Bacteria 517
188 Ga0466965_0481901 3300044683 Bacteria 694
189 Ga0466961_0005606 3300044693 Bacteria 7932
190 Ga0466963_0020325 3300044694 Bacteria 4175
191 Ga0466964_0003929 3300044706 Bacteria 5463
192 Ga0466964_0069204 3300044706 Bacteria 1488
193 Ga0466971_0030805 3300044719 Bacteria 2401
194 Ga0466970_0051419 3300044765 Bacteria 2199
195 Ga0466957_0054182 3300044842 Bacteria 2447
196 Ga0466958_0000208 3300045836 Bacteria 21875
197 Ga0466967_0015902 3300045976 Bacteria 5914
198 Ga0466967_0124584 3300045976 Bacteria 2385
199 Ga0466967_0198522 3300045976 Bacteria 1899
200 Ga0466967_0603294 3300045976 Bacteria 1084
201 Ga0466967_1359492 3300045976 Bacteria 707
202 Ga0466967_1686750 3300045976 Bacteria 631
203 Ga0495592_0229769 3300046454 Unclassified 1236
204 Ga0495603_0291098 3300046455 Bacteria 938
205 Ga0495629_0000319 3300046459 Bacteria 41153
206 Ga0495629_0012248 3300046459 Bacteria 6214
207 Ga0495629_0295036 3300046459 Bacteria 1111
208 Ga0495629_0535992 3300046459 Bacteria 787
209 Ga0495641_0012133 3300046461 Bacteria 4844
210 Ga0495641_0263863 3300046461 Bacteria 775
211 Ga0495651_0003903 3300046462 Bacteria 11402
212 Ga0495653_0057207 3300046463 Unclassified 2969
213 Ga0495582_0000358 3300046473 Bacteria 24948
214 Ga0495582_0078032 3300046473 Bacteria 1837
215 Ga0495639_0006507 3300046475 Bacteria 5024
216 Ga0495662_0002647 3300046476 Bacteria 9048
217 Ga0495662_0038073 3300046476 Unclassified 2324
218 Ga0495664_0219185 3300046477 Bacteria 1152
219 Ga0495664_0289457 3300046477 Bacteria 989
220 Ga0495664_0446125 3300046477 Bacteria 775
221 Ga0495608_0156123 3300046511 Bacteria 1452
222 Ga0495618_0193076 3300046514 Bacteria 1290
223 Ga0495618_0243000 3300046514 Bacteria 1131
224 Ga0495628_0041119 3300046516 Bacteria 3691
225 Ga0495628_0369876 3300046516 Bacteria 1051
226 Ga0495630_0361903 3300046517 Bacteria 1110
227 Ga0495630_1043759 3300046517 Unclassified 620
228 Ga0495631_0120423 3300046518 Bacteria 1129
229 Ga0495652_0029468 3300046529 Bacteria 4821
230 Ga0495652_0140592 3300046529 Bacteria 1899
231 Ga0495665_0278194 3300046531 Bacteria 859
232 Ga0495640_0033605 3300046533 Bacteria 3642
233 Ga0495640_0107562 3300046533 Bacteria 1825
234 Ga0495640_0793295 3300046533 Bacteria 565
235 Ga0495586_0314296 3300046535 Bacteria 898
236 Ga0495609_0467930 3300046538 Bacteria 500
237 Ga0495645_0428853 3300046543 Unclassified 838
238 Ga0495622_0348666 3300046557 Bacteria 641
239 Ga0495633_0492363 3300046558 Bacteria 553
240 Ga0495667_0007211 3300046559 Bacteria 7543
241 Ga0495667_0016332 3300046559 Bacteria 5016
242 Ga0495667_0166495 3300046559 Unclassified 1417
243 Ga0495634_0028295 3300046642 Bacteria 3891
244 Ga0495634_0137692 3300046642 Unclassified 1552
245 Ga0495634_0552849 3300046642 Bacteria 671
246 Ga0495635_0015529 3300046663 Bacteria 5322
247 Ga0495659_0103323 3300046664 Bacteria 1106
248 Ga0495657_0102104 3300046675 Unclassified 1826
249 Ga0495599_0098230 3300046678 Unclassified 1825
250 Ga0495646_0051447 3300046680 Bacteria 2493
251 Ga0495647_0004464 3300046681 Bacteria 4548
252 Ga0495658_0000384 3300046683 Bacteria 24849
253 Ga0495658_0048715 3300046683 Bacteria 2390
254 Ga0495613_0009571 3300046689 Bacteria 7198
255 Ga0495624_0009729 3300046690 Bacteria 6652
256 Ga0495589_0367346 3300046794 Bacteria 662
257 Ga0495600_0050128 3300046809 Bacteria 2724
258 Ga0495600_0171584 3300046809 Bacteria 1400
259 Ga0495581_0003702 3300047315 Bacteria 8805
260 Ga0495604_0379273 3300047317 Bacteria 934
261 Ga0495674_0017882 3300047319 Bacteria 6601
262 Ga0495674_0083329 3300047319 Bacteria 2741
263 Ga0495676_0009195 3300047321 Bacteria 9004
264 Ga0495676_0165912 3300047321 Unclassified 1558
265 Ga0495680_0016192 3300047322 Bacteria 6410
266 Ga0495680_0051566 3300047322 Bacteria 3211
267 Ga0495680_0755352 3300047322 Bacteria 638
268 Ga0495680_0959407 3300047322 Bacteria 549
269 Ga0495675_0244469 3300047444 Bacteria 1079
270 Ga0495684_0003823 3300047471 Bacteria 11723
271 Ga0495684_0004656 3300047471 Bacteria 10704
272 Ga0495593_0001908 3300047673 Bacteria 12428
273 Ga0495593_0064194 3300047673 Bacteria 1917
274 Ga0495602_0272654 3300048088 Bacteria 1250
275 Ga0495602_0796840 3300048088 Bacteria 635
276 Ga0495614_0011237 3300048089 Bacteria 3940
277 Ga0496100_0016460 3300048903 Bacteria 4343
278 Ga0496100_0161015 3300048903 Bacteria 1609
279 Ga0496100_0225582 3300048903 Bacteria 1377
280 Ga0496100_0406942 3300048903 Bacteria 1037
281 Ga0496100_0498273 3300048903 Bacteria 938
282 Ga0496101_0011095 3300048904 Bacteria 5971
283 Ga0496101_0088890 3300048904 Bacteria 2295
284 Ga0496101_0262928 3300048904 Unclassified 1346
285 Ga0496101_0288530 3300048904 Bacteria 1283
286 Ga0496101_0628831 3300048904 Bacteria 848
287 Ga0496101_0664002 3300048904 Bacteria 823
288 Ga0496101_0836970 3300048904 Bacteria 725
289 Ga0496101_0953895 3300048904 Bacteria 675
290 Ga0496103_0037300 3300048906 Bacteria 2977
291 Ga0496103_0181252 3300048906 Bacteria 1354
292 Ga0496104_0002242 3300048907 Bacteria 16680
293 Ga0496104_0003336 3300048907 Bacteria 13855
294 Ga0496104_0101551 3300048907 Unclassified 2754
295 Ga0496104_0180670 3300048907 Bacteria 2020
296 Ga0496104_0270857 3300048907 Bacteria 1610
297 Ga0496104_1519463 3300048907 Bacteria 572
298 Ga0496105_0000671 3300048908 Bacteria 22997
299 Ga0496105_0000741 3300048908 Bacteria 22135
300 Ga0496105_0190035 3300048908 Bacteria 1679
301 Ga0496105_0209597 3300048908 Bacteria 1589
302 Ga0496105_0226855 3300048908 Bacteria 1519
303 Ga0496105_1298796 3300048908 Bacteria 531
304 Ga0496106_0180442 3300048909 Bacteria 1676
305 Ga0496106_0227590 3300048909 Bacteria 1488
306 Ga0496106_0691280 3300048909 Bacteria 813
307 Ga0496107_0381502 3300048910 Bacteria 1048
308 Ga0496107_0450549 3300048910 Bacteria 956
309 Ga0496107_0463329 3300048910 Bacteria 941
310 Ga0496107_0610749 3300048910 Bacteria 805
311 Ga0496108_0000317 3300048911 Bacteria 40920
312 Ga0496108_0643172 3300048911 Bacteria 922
313 Ga0496109_0007014 3300048912 Bacteria 9505
314 Ga0496109_0020838 3300048912 Bacteria 5793
315 Ga0496109_0130745 3300048912 Bacteria 2343
316 Ga0496109_1340520 3300048912 Bacteria 651
317 Ga0496110_0000774 3300048913 Bacteria 22221
318 Ga0496111_0001461 3300048914 Bacteria 13512
319 Ga0496111_0158240 3300048914 Bacteria 1681
320 Ga0496112_0101171 3300048915 Bacteria 2852
321 Ga0496112_0828352 3300048915 Unclassified 849
322 Ga0496113_0001684 3300048916 Bacteria 12527
323 Ga0496113_0111187 3300048916 Bacteria 2133
324 Ga0496114_0049463 3300048917 Bacteria 3498
325 Ga0496114_0050500 3300048917 Bacteria 3462
326 Ga0496114_0138032 3300048917 Bacteria 2109
327 Ga0496114_0164091 3300048917 Bacteria 1933
328 Ga0496114_0191639 3300048917 Bacteria 1789
329 Ga0496114_0319095 3300048917 Bacteria 1372
330 Ga0496114_0347550 3300048917 Bacteria 1311
331 Ga0496114_0430266 3300048917 Bacteria 1169
332 Ga0496114_0725807 3300048917 Bacteria 870
333 Ga0496115_0006719 3300048918 Bacteria 8439
334 Ga0496115_0017703 3300048918 Bacteria 5454
335 Ga0496115_0027649 3300048918 Bacteria 4439
336 Ga0496115_0592813 3300048918 Unclassified 882
337 Ga0501032_0272705 3300049569 Bacteria 1096
338 Ga0501033_0269258 3300049570 Bacteria 1204
339 Ga0501034_0582448 3300049571 Bacteria 1026
340 Ga0501036_0000770 3300049572 Bacteria 23736
341 Ga0501038_0153480 3300049574 Bacteria 1876
342 Ga0501039_0005156 3300049575 Bacteria 9902
343 Ga0501040_0003699 3300049576 Bacteria 9911
344 Ga0501041_0008249 3300049577 Bacteria 6127
345 Ga0501042_0016213 3300049578 Bacteria 5111
346 Ga0501043_0122888 3300049579 Bacteria 2036
347 Ga0501046_0005831 3300049580 Bacteria 10982
348 Ga0501047_0583308 3300049581 Bacteria 941
349 Ga0501048_0001984 3300049582 Bacteria 15558
350 Ga0501068_0144245 3300049584 Bacteria 1494
351 Ga0501069_0039289 3300049585 Bacteria 2614
352 Ga0501070_0046726 3300049586 Bacteria 3600
353 Ga0501071_0001603 3300049587 Bacteria 13269
354 Ga0501072_0001794 3300049588 Bacteria 15975
355 Ga0501073_0227394 3300049589 Bacteria 1289
356 Ga0501075_0005559 3300049591 Bacteria 8624
357 Ga0501076_0016037 3300049592 Bacteria 5671
358 Ga0501077_0069081 3300049593 Bacteria 2239
359 Ga0501079_0003749 3300049741 Bacteria 11217
360 Ga0501080_0052175 3300049742 Bacteria 3806
361 Ga0501081_0044494 3300049743 Bacteria 3047
362 Ga0501044_0156056 3300049823 Bacteria 2262
363 nmdc:mga08y16_175118_c1 3300050511 Bacteria 2228
364 nmdc:mga0n895_164560_c1 3300050512 Unclassified 2249
365 nmdc:mga0rr50_116722_c1 3300050513 Bacteria 2119
366 nmdc:mga0rr50_399556_c1 3300050513 Bacteria 1161
367 nmdc:mga08x19_250134_c1 3300050514 Bacteria 1223
368 nmdc:mga0a205_2005_c1 3300050515 Bacteria 17756
369 Ga0495601_0025201 3300053077 Bacteria 3666
370 Ga0495612_0229305 3300053078 Bacteria 823
371 Ga0495655_0002187 3300053083 Bacteria 3084
372 Ga0495595_0008515 3300053084 Bacteria 4213
373 Ga0495595_0049147 3300053084 Bacteria 1950
374 Ga0495619_0002851 3300053085 Bacteria 11265
375 Ga0495619_0008383 3300053085 Bacteria 6535
376 Ga0495619_0219996 3300053085 Bacteria 1315
377 Ga0501084_0002823 3300054114 Bacteria 14023
378 Ga0466962_0100163 3300061719 Bacteria 1391
379 Ga0530510_0003412 3300061734 Bacteria 10928
380 Ga0495603_0315772
381 Ga0070683_100064585
382 Ga0070683_100146092
383 Ga0070691_10434050
384 Ga0070661_101942204
385 Ga0070674_100873127
386 Ga0070714_100191571
387 Ga0070714_101550912
388 Ga0070713_100099373
389 Ga0070713_100235982
390 Ga0070713_100238600
391 Ga0070713_101246723
392 Ga0070710_10376434
393 Ga0070711_100209045
394 Ga0070708_100337741
395 Ga0070708_101016416
396 Ga0070663_100009497
397 Ga0070681_10071390
398 Ga0070681_10084869
399 Ga0070681_10281385
400 Ga0070685_11143132
401 Ga0070706_100200998
402 Ga0070707_100422697
403 Ga0070698_100138736
404 Ga0070699_101545453
405 Ga0070679_101670982
406 Ga0070684_100195688
407 Ga0070697_100082922
408 Ga0068853_100125278
409 Ga0070696_100554679
410 Ga0070693_100026310
411 Ga0070665_100089442
412 Ga0070664_100593635
413 Ga0070664_101804274
414 Ga0068856_100132405
415 Ga0068852_100497241
416 Ga0081455_10019134
417 Ga0081455_10040788
418 Ga0081455_10061750
419 Ga0081538_10037284
420 Ga0081538_10086279
421 Ga0081540_1046208
422 Ga0070717_10226133
423 Ga0070715_10011358
424 Ga0070715_10208403
425 Ga0070715_10325442
426 Ga0070716_100026514
427 Ga0070716_100588990
428 Ga0070716_100951428
429 Ga0070712_100087872
430 Ga0070712_100126683
431 Ga0070712_100178032
432 Ga0070712_101481823
433 Ga0097621_100059046
434 Ga0068871_100061497
435 Ga0075434_100158142
436 Ga0075434_100316528
437 Ga0068865_100696400
438 Ga0075436_100352449
439 Ga0075435_100018815
440 Ga0075435_100200760
441 Ga0111539_10056082
442 Ga0105245_10765452
443 Ga0105245_10812266
444 Ga0105247_10827674
445 Ga0105243_10253454
446 Ga0105243_10672564
447 Ga0105241_10744433
448 Ga0105241_11021693
449 Ga0105242_10035410
450 Ga0105242_12407710
451 Ga0105248_10841821
452 Ga0105238_12916470
453 Ga0105249_10879071
454 Ga0105239_10145916
455 Ga0157373_10097456
456 Ga0157373_11248224
457 Ga0157369_11081044
458 Ga0157374_10484971
459 Ga0157374_11169045
460 Ga0157372_10295581
461 Ga0157372_11639732
462 Ga0157375_11033520
463 Ga0157375_12007995
464 Ga0163163_10053024
465 Ga0163163_11963479
466 Ga0163163_13226249
467 Ga0157380_10896757
468 Ga0157379_10867341
469 Ga0157376_10071165
470 Ga0157376_10674519
471 Ga0206354_11525840
472 Ga0207692_10162144
473 Ga0207692_10548584
474 Ga0207642_10396901
475 Ga0207685_10017187
476 Ga0207643_10318254
477 Ga0207684_10068641
478 Ga0207707_10478151
479 Ga0207693_10027562
480 Ga0207693_10072593
481 Ga0207663_10035305
482 Ga0207663_10106103
483 Ga0207663_10725496
484 Ga0207660_10027283
485 Ga0207652_10981875
486 Ga0207646_10431223
487 Ga0207664_10039429
488 Ga0207664_10147195
489 Ga0207686_10339985
490 Ga0207686_11292568
491 Ga0207709_10309918
492 Ga0207669_10663555
493 Ga0207704_11642558
494 Ga0207665_10108416
495 Ga0207665_10435686
496 Ga0207711_10937153
497 Ga0207661_10294104
498 Ga0207667_11667720
499 Ga0207712_10265532
500 Ga0207640_10542682
501 Ga0207702_11149033
502 Ga0207648_10016547
503 Ga0207674_11789778
504 Ga0207675_100187780
505 Ga0207683_10011725
506 Ga0207683_10017440
507 Ga0268266_10253371
508 Ga0268264_10068619
509 Ga0265337_1183001
510 Ga0265338_10019538
511 Ga0265338_10511312
512 Ga0265331_10416563
513 Ga0307408_100630884
514 Ga0265314_10236278
515 Ga0307406_11505006
516 Ga0307409_100203807
517 Ga0307416_100327228
518 Ga0307416_100336026
519 Ga0307416_100861758
520 Ga0307411_10531848
521 Ga0307415_100028978
522 Ga0307415_100058447
523 Ga0307415_100297739
524 Ga0307415_101870059
525 Ga0373959_0006641
526 Ga0373938_0017318
527 Ga0373929_0038234
528 Ga0373944_0030069
529 Ga0373944_0169553
530 Ga0373951_0013424
531 Ga0373932_0007337
532 Ga0373939_0429004
533 Ga0373941_0036623
534 Ga0373941_0046755
535 Ga0373945_0012114
536 Ga0373960_0161384
537 Ga0373943_0002676
538 Ga0373943_0030792
539 Ga0373946_0206714
540 Ga0373946_0506787
541 Ga0373942_0154297
542 Ga0373962_0372143
543 Ga0373935_0019661
544 Ga0373927_0256133
545 Ga0373947_0001170
546 Ga0373925_0002413
547 Ga0373925_0035952
548 Ga0395900_0010201
549 Ga0395900_0249202
550 Ga0395900_1102864
551 Ga0395898_0205414
552 Ga0395898_0965110
553 Ga0395905_0098958
554 Ga0395901_0035394
555 Ga0395901_0435602
556 Ga0395901_0980278
557 Ga0242420_044392
558 Ga0439453_0037955
559 Ga0451800_0279120
560 Ga0451853_0268203
561 Ga0451853_1157851
562 Ga0451853_2547907
563 Ga0439454_069670
564 Ga0439464_0211477
565 Ga0439440_0082823
566 Ga0466972_0608456
567 Ga0466965_0481901
568 Ga0466961_0005606
569 Ga0466963_0020325
570 Ga0466964_0003929
571 Ga0466964_0069204
572 Ga0466971_0030805
573 Ga0466970_0051419
574 Ga0466957_0054182
575 Ga0466958_0000208
576 Ga0466967_0015902
577 Ga0466967_0124584
578 Ga0466967_0198522
579 Ga0466967_0603294
580 Ga0466967_1359492
581 Ga0466967_1686750
582 Ga0495592_0229769
583 Ga0495603_0291098
584 Ga0495629_0000319
585 Ga0495629_0012248
586 Ga0495629_0295036
587 Ga0495629_0535992
588 Ga0495641_0012133
589 Ga0495641_0263863
590 Ga0495651_0003903
591 Ga0495653_0057207
592 Ga0495582_0000358
593 Ga0495582_0078032
594 Ga0495639_0006507
595 Ga0495662_0002647
596 Ga0495662_0038073
597 Ga0495664_0219185
598 Ga0495664_0289457
599 Ga0495664_0446125
600 Ga0495608_0156123
601 Ga0495618_0193076
602 Ga0495618_0243000
603 Ga0495628_0041119
604 Ga0495628_0369876
605 Ga0495630_0361903
606 Ga0495630_1043759
607 Ga0495631_0120423
608 Ga0495652_0029468
609 Ga0495652_0140592
610 Ga0495665_0278194
611 Ga0495640_0033605
612 Ga0495640_0107562
613 Ga0495640_0793295
614 Ga0495586_0314296
615 Ga0495609_0467930
616 Ga0495645_0428853
617 Ga0495622_0348666
618 Ga0495633_0492363
619 Ga0495667_0007211
620 Ga0495667_0016332
621 Ga0495667_0166495
622 Ga0495634_0028295
623 Ga0495634_0137692
624 Ga0495634_0552849
625 Ga0495635_0015529
626 Ga0495659_0103323
627 Ga0495657_0102104
628 Ga0495599_0098230
629 Ga0495646_0051447
630 Ga0495647_0004464
631 Ga0495658_0000384
632 Ga0495658_0048715
633 Ga0495613_0009571
634 Ga0495624_0009729
635 Ga0495589_0367346
636 Ga0495600_0050128
637 Ga0495600_0171584
638 Ga0495581_0003702
639 Ga0495604_0379273
640 Ga0495674_0017882
641 Ga0495674_0083329
642 Ga0495676_0009195
643 Ga0495676_0165912
644 Ga0495680_0016192
645 Ga0495680_0051566
646 Ga0495680_0755352
647 Ga0495680_0959407
648 Ga0495675_0244469
649 Ga0495684_0003823
650 Ga0495684_0004656
651 Ga0495593_0001908
652 Ga0495593_0064194
653 Ga0495602_0272654
654 Ga0495602_0796840
655 Ga0495614_0011237
656 Ga0496100_0016460
657 Ga0496100_0161015
658 Ga0496100_0225582
659 Ga0496100_0406942
660 Ga0496100_0498273
661 Ga0496101_0011095
662 Ga0496101_0088890
663 Ga0496101_0262928
664 Ga0496101_0288530
665 Ga0496101_0628831
666 Ga0496101_0664002
667 Ga0496101_0836970
668 Ga0496101_0953895
669 Ga0496103_0037300
670 Ga0496103_0181252
671 Ga0496104_0002242
672 Ga0496104_0003336
673 Ga0496104_0101551
674 Ga0496104_0180670
675 Ga0496104_0270857
676 Ga0496104_1519463
677 Ga0496105_0000671
678 Ga0496105_0000741
679 Ga0496105_0190035
680 Ga0496105_0209597
681 Ga0496105_0226855
682 Ga0496105_1298796
683 Ga0496106_0180442
684 Ga0496106_0227590
685 Ga0496106_0691280
686 Ga0496107_0381502
687 Ga0496107_0450549
688 Ga0496107_0463329
689 Ga0496107_0610749
690 Ga0496108_0000317
691 Ga0496108_0643172
692 Ga0496109_0007014
693 Ga0496109_0020838
694 Ga0496109_0130745
695 Ga0496109_1340520
696 Ga0496110_0000774
697 Ga0496111_0001461
698 Ga0496111_0158240
699 Ga0496112_0101171
700 Ga0496112_0828352
701 Ga0496113_0001684
702 Ga0496113_0111187
703 Ga0496114_0049463
704 Ga0496114_0050500
705 Ga0496114_0138032
706 Ga0496114_0164091
707 Ga0496114_0191639
708 Ga0496114_0319095
709 Ga0496114_0347550
710 Ga0496114_0430266
711 Ga0496114_0725807
712 Ga0496115_0006719
713 Ga0496115_0017703
714 Ga0496115_0027649
715 Ga0496115_0592813
716 Ga0501032_0272705
717 Ga0501033_0269258
718 Ga0501034_0582448
719 Ga0501036_0000770
720 Ga0501038_0153480
721 Ga0501039_0005156
722 Ga0501040_0003699
723 Ga0501041_0008249
724 Ga0501042_0016213
725 Ga0501043_0122888
726 Ga0501046_0005831
727 Ga0501047_0583308
728 Ga0501048_0001984
729 Ga0501068_0144245
730 Ga0501069_0039289
731 Ga0501070_0046726
732 Ga0501071_0001603
733 Ga0501072_0001794
734 Ga0501073_0227394
735 Ga0501075_0005559
736 Ga0501076_0016037
737 Ga0501077_0069081
738 Ga0501079_0003749
739 Ga0501080_0052175
740 Ga0501081_0044494
741 Ga0501044_0156056
742 nmdc:mga08y16_175118_c1
743 nmdc:mga0n895_164560_c1
744 nmdc:mga0rr50_116722_c1
745 nmdc:mga0rr50_399556_c1
746 nmdc:mga08x19_250134_c1
747 nmdc:mga0a205_2005_c1
748 Ga0495601_0025201
749 Ga0495612_0229305
750 Ga0495655_0002187
751 Ga0495595_0008515
752 Ga0495595_0049147
753 Ga0495619_0002851
754 Ga0495619_0008383
755 Ga0495619_0219996
756 Ga0501084_0002823
757 Ga0466962_0100163
758 Ga0530510_0003412

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05014

Nuc_deoxyrib_tr

Nucleoside 2-deoxyribosyltransferase

4

109

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
5tse-assembly2.cif.gz_B error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.8643 2 31
5tse-assembly3.cif.gz_C error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.8443 2 31
7o62-assembly1.cif.gz_C crystal structure of a 2`-deoxyribosyltransferase from the psychrophilic bacterium desulfotalea psychrophila. 0.8382 2 118
7m4s-assembly2.cif.gz_B crystal structure of macrocyclase amdnb from anabaena sp. pcc 7120 0.8361 2 32
7o62-assembly1.cif.gz_A crystal structure of a 2`-deoxyribosyltransferase from the psychrophilic bacterium desulfotalea psychrophila. 0.8327 2 119
ID Description Score Start End Superfamily
5tseB00 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;Lipoprotein like domain 0.8643 2 31 3.30.160.150
6iltB00 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.815 51 108 3.40.1190.20
3ry7A00 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.7853 48 108 3.40.1190.20
4ohrA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.7707 1 120 3.40.50.450
4hx9B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.7644 2 113 3.40.50.450
ID Description Score Start End GO Terms
AF-A0A538LGA7-F1-model_v4 Nucleoside 2-deoxyribosyltransferase 0.9764 1 118
AF-A0A538K7I3-F1-model_v4 Nucleoside 2-deoxyribosyltransferase 0.9746 1 120
AF-A0A7V9KXM9-F1-model_v4 Nucleoside 2-deoxyribosyltransferase 0.9742 1 118 GO:0016740
AF-A0A538GDM5-F1-model_v4 Nucleoside 2-deoxyribosyltransferase 0.9738 1 118
AF-A0A538F479-F1-model_v4 Nucleoside 2-deoxyribosyltransferase 0.9719 1 118

Map