F428388

General Info

Members Datasets Scaffolds Average Seq Length
379 161 379 159

Family's Representative Sequence

Representative Sequence 3300026142|Ga0207698_11328581|Ga0207698_113285811
Length 159
Sequence MKITAQEEYGLRLLIRIAGCKTADGLSIPQLSEAEGLSSHYVAKLSRILRMAGFINSTPGYKGGYVLALPAKEININKVLQALGGVMFDKSFCENHSGVEKRLCTNSVDCSARSLWQMVQVTVDELLNKISLQDLITQQQAAVSPLYDYLPEGLLKRPA

Samples

Sample ID Description Type Environment
1 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
2 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
47 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
50 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
56 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
62 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
63 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
64 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
65 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
66 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
67 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
73 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
74 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
75 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
76 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
118 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
120 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
121 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
122 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
123 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
124 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
125 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
126 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
127 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
128 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
129 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
130 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
131 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
132 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
133 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
134 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
135 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
136 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
137 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
138 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
139 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
140 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
141 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
142 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
143 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
144 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
145 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
146 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
147 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
148 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
149 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
150 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
154 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
155 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
156 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
158 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
159 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
160 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
161 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.74
Metatranscriptomes 0.26
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.32
Nodule 0
Rhizoplane 0.79
Rhizosphere 97.1
Stem 0
Stem Tuber 0
Unclassified 0.79

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0058863_11478956 3300004799 Bacteria 752
2 Ga0065714_10279225 3300005288 Unclassified 726
3 Ga0065707_10179642 3300005295 Bacteria 1426
4 Ga0070658_10009081 3300005327 Bacteria 7996
5 Ga0070658_10013656 3300005327 Bacteria 6516
6 Ga0070658_10070071 3300005327 Bacteria 2870
7 Ga0070658_10222313 3300005327 Bacteria 1597
8 Ga0070658_10641370 3300005327 Unclassified 921
9 Ga0070670_100030147 3300005331 Bacteria 4672
10 Ga0070670_100091297 3300005331 Bacteria 2618
11 Ga0068869_100006366 3300005334 Bacteria 7482
12 Ga0068869_100084900 3300005334 Bacteria 2371
13 Ga0070666_10000031 3300005335 Bacteria 132089
14 Ga0070666_10253557 3300005335 Bacteria 1246
15 Ga0070680_100001109 3300005336 Bacteria 19331
16 Ga0070680_100340368 3300005336 Bacteria 1275
17 Ga0068868_100016736 3300005338 Bacteria 5452
18 Ga0068868_100038534 3300005338 Bacteria 3711
19 Ga0070660_100009253 3300005339 Bacteria 6923
20 Ga0070660_100027628 3300005339 Bacteria 4237
21 Ga0070660_100028267 3300005339 Bacteria 4193
22 Ga0070660_100104292 3300005339 Bacteria 2249
23 Ga0070660_100254095 3300005339 Bacteria 1434
24 Ga0070687_100086203 3300005343 Bacteria 1725
25 Ga0070687_100239258 3300005343 Unclassified 1121
26 Ga0070668_100134014 3300005347 Unclassified 1990
27 Ga0070668_101328478 3300005347 Bacteria 654
28 Ga0070675_100265200 3300005354 Unclassified 1506
29 Ga0070675_101075339 3300005354 Bacteria 739
30 Ga0070675_101475983 3300005354 Bacteria 627
31 Ga0070671_100050201 3300005355 Bacteria 3470
32 Ga0070671_100168793 3300005355 Bacteria 1850
33 Ga0070674_100140670 3300005356 Bacteria 1811
34 Ga0070674_100190035 3300005356 Bacteria 1579
35 Ga0070673_100142306 3300005364 Bacteria 2024
36 Ga0070673_100513905 3300005364 Bacteria 1085
37 Ga0070688_100062631 3300005365 Unclassified 2355
38 Ga0070688_100546097 3300005365 Bacteria 880
39 Ga0070659_100020736 3300005366 Bacteria 4997
40 Ga0070659_100024285 3300005366 Bacteria 4645
41 Ga0070659_100105794 3300005366 Bacteria 2268
42 Ga0070659_100128473 3300005366 Bacteria 2057
43 Ga0070667_100005582 3300005367 Bacteria 10502
44 Ga0070667_100022891 3300005367 Bacteria 5180
45 Ga0070667_100051824 3300005367 Bacteria 3461
46 Ga0070667_100114246 3300005367 Bacteria 2344
47 Ga0070667_100313590 3300005367 Bacteria 1414
48 Ga0070713_100474372 3300005436 Bacteria 1178
49 Ga0070663_100078181 3300005455 Bacteria 2424
50 Ga0070663_100715552 3300005455 Unclassified 852
51 Ga0070678_100459356 3300005456 Unclassified 1117
52 Ga0070678_101808674 3300005456 Unclassified 576
53 Ga0070662_100386791 3300005457 Bacteria 1152
54 Ga0070681_10005409 3300005458 Bacteria 12333
55 Ga0070681_10044990 3300005458 Bacteria 4418
56 Ga0070681_10094317 3300005458 Bacteria 2941
57 Ga0068867_100216317 3300005459 Bacteria 1542
58 Ga0068867_100252096 3300005459 Bacteria 1436
59 Ga0070679_100000517 3300005530 Bacteria 32752
60 Ga0070679_100019775 3300005530 Bacteria 6555
61 Ga0070679_100087355 3300005530 Bacteria 3105
62 Ga0070679_100107378 3300005530 Bacteria 2777
63 Ga0070679_100152568 3300005530 Unclassified 2286
64 Ga0070684_100073078 3300005535 Bacteria 3021
65 Ga0070684_101540359 3300005535 Bacteria 627
66 Ga0068853_100046207 3300005539 Bacteria 3733
67 Ga0068853_100129643 3300005539 Bacteria 2257
68 Ga0068853_100177305 3300005539 Bacteria 1931
69 Ga0068853_101118651 3300005539 Bacteria 760
70 Ga0068853_101166124 3300005539 Bacteria 743
71 Ga0070672_100402251 3300005543 Unclassified 1174
72 Ga0070672_100683665 3300005543 Unclassified 898
73 Ga0070686_100083642 3300005544 Bacteria 2119
74 Ga0070665_102107123 3300005548 Unclassified 568
75 Ga0070704_101263429 3300005549 Unclassified 675
76 Ga0068855_100009310 3300005563 Bacteria 11860
77 Ga0068855_100063955 3300005563 Bacteria 4292
78 Ga0068855_100174877 3300005563 Bacteria 2430
79 Ga0068855_100286577 3300005563 Bacteria 1827
80 Ga0068855_100654250 3300005563 Bacteria 1128
81 Ga0068857_100076770 3300005577 Bacteria 2980
82 Ga0068857_100172125 3300005577 Bacteria 1968
83 Ga0068854_101255955 3300005578 Bacteria 665
84 Ga0068856_100056506 3300005614 Bacteria 3872
85 Ga0068856_100660664 3300005614 Bacteria 1066
86 Ga0068852_100001769 3300005616 Bacteria 14700
87 Ga0068852_100083555 3300005616 Bacteria 2839
88 Ga0068852_100089960 3300005616 Bacteria 2744
89 Ga0068859_100000045 3300005617 Bacteria 143607
90 Ga0068859_100879035 3300005617 Unclassified 982
91 Ga0068864_100001153 3300005618 Bacteria 21991
92 Ga0068861_100200953 3300005719 Bacteria 1673
93 Ga0068861_101471927 3300005719 Bacteria 667
94 Ga0068861_101834155 3300005719 Bacteria 602
95 Ga0068851_10016891 3300005834 Bacteria 3498
96 Ga0068863_100002071 3300005841 Bacteria 19895
97 Ga0068863_100143385 3300005841 Bacteria 2284
98 Ga0068863_100783183 3300005841 Bacteria 951
99 Ga0068858_100002469 3300005842 Bacteria 18659
100 Ga0068858_100101461 3300005842 Unclassified 2684
101 Ga0068858_101062353 3300005842 Bacteria 794
102 Ga0068860_100004015 3300005843 Bacteria 15110
103 Ga0068860_100004776 3300005843 Bacteria 13806
104 Ga0068860_100059064 3300005843 Bacteria 3647
105 Ga0068860_100156159 3300005843 Bacteria 2199
106 Ga0068862_100394428 3300005844 Bacteria 1294
107 Ga0070712_101649387 3300006175 Bacteria 561
108 Ga0075366_10500753 3300006195 Bacteria 751
109 Ga0075366_10602624 3300006195 Unclassified 681
110 Ga0097621_100000277 3300006237 Bacteria 34682
111 Ga0097621_100064624 3300006237 Bacteria 3010
112 Ga0068871_100000119 3300006358 Bacteria 49103
113 Ga0068871_100013100 3300006358 Bacteria 6148
114 Ga0068871_100013852 3300006358 Bacteria 5996
115 Ga0068871_100309603 3300006358 Bacteria 1388
116 Ga0068871_100621434 3300006358 Bacteria 984
117 Ga0068871_100869878 3300006358 Unclassified 834
118 Ga0068871_101253034 3300006358 Unclassified 697
119 Ga0068865_100068174 3300006881 Bacteria 2515
120 Ga0068865_100265742 3300006881 Bacteria 1360
121 Ga0068865_100329674 3300006881 Bacteria 1230
122 Ga0068865_100832471 3300006881 Bacteria 798
123 Ga0097620_100000045 3300006931 Bacteria 143607
124 Ga0097620_100879071 3300006931 Unclassified 982
125 Ga0111539_10120365 3300009094 Bacteria 3076
126 Ga0111539_10204249 3300009094 Unclassified 2303
127 Ga0105245_10090778 3300009098 Unclassified 2810
128 Ga0105245_13173064 3300009098 Bacteria 509
129 Ga0114129_10065258 3300009147 Bacteria 5081
130 Ga0105243_10151761 3300009148 Bacteria 1988
131 Ga0105243_10236535 3300009148 Unclassified 1623
132 Ga0105241_10003471 3300009174 Bacteria 11732
133 Ga0105241_10033969 3300009174 Bacteria 3831
134 Ga0105241_10158828 3300009174 Bacteria 1856
135 Ga0105241_11053722 3300009174 Bacteria 763
136 Ga0105242_10088647 3300009176 Bacteria 2599
137 Ga0105242_10357971 3300009176 Bacteria 1350
138 Ga0105242_10610102 3300009176 Bacteria 1055
139 Ga0105237_10002015 3300009545 Bacteria 25851
140 Ga0105237_10133969 3300009545 Bacteria 2472
141 Ga0105249_10001437 3300009553 Bacteria 20858
142 Ga0105249_10011652 3300009553 Bacteria 7732
143 Ga0105249_10189265 3300009553 Bacteria 2008
144 Ga0105239_10053700 3300010375 Bacteria 4419
145 Ga0105239_10149953 3300010375 Bacteria 2602
146 Ga0105246_10012782 3300011119 Bacteria 5248
147 Ga0157373_10019740 3300013100 Bacteria 4902
148 Ga0157373_10094905 3300013100 Bacteria 2099
149 Ga0157373_10176472 3300013100 Bacteria 1504
150 Ga0157373_10185471 3300013100 Unclassified 1466
151 Ga0157373_10286220 3300013100 Bacteria 1169
152 Ga0157373_10441408 3300013100 Bacteria 936
153 Ga0157373_10819505 3300013100 Bacteria 687
154 Ga0157371_10001002 3300013102 Bacteria 31205
155 Ga0157371_10001146 3300013102 Bacteria 28558
156 Ga0157371_10002749 3300013102 Bacteria 16544
157 Ga0157371_10012485 3300013102 Bacteria 6491
158 Ga0157371_10053576 3300013102 Bacteria 2864
159 Ga0157371_10056910 3300013102 Bacteria 2773
160 Ga0157371_10083692 3300013102 Bacteria 2259
161 Ga0157371_10085973 3300013102 Bacteria 2228
162 Ga0157370_10004098 3300013104 Bacteria 16897
163 Ga0157370_10010279 3300013104 Bacteria 9879
164 Ga0157370_10213984 3300013104 Bacteria 1786
165 Ga0157370_10284623 3300013104 Unclassified 1527
166 Ga0157369_10006046 3300013105 Bacteria 14052
167 Ga0157369_10034679 3300013105 Bacteria 5535
168 Ga0157369_10034916 3300013105 Bacteria 5515
169 Ga0157369_10042617 3300013105 Bacteria 4950
170 Ga0157369_10218146 3300013105 Bacteria 1997
171 Ga0157374_10570775 3300013296 Unclassified 1140
172 Ga0157378_10016416 3300013297 Bacteria 6483
173 Ga0157378_10024992 3300013297 Bacteria 5261
174 Ga0157378_10076362 3300013297 Bacteria 3019
175 Ga0157378_10127414 3300013297 Bacteria 2353
176 Ga0157378_10172198 3300013297 Bacteria 2031
177 Ga0157378_10326584 3300013297 Unclassified 1492
178 Ga0157378_12027309 3300013297 Unclassified 626
179 Ga0163162_10000915 3300013306 Bacteria 27424
180 Ga0163162_10005822 3300013306 Bacteria 11920
181 Ga0163162_10021357 3300013306 Bacteria 6374
182 Ga0163162_10055641 3300013306 Bacteria 3984
183 Ga0163162_11842584 3300013306 Unclassified 692
184 Ga0157372_10023785 3300013307 Bacteria 6647
185 Ga0157372_10034549 3300013307 Bacteria 5559
186 Ga0157372_10041409 3300013307 Bacteria 5094
187 Ga0157372_10058319 3300013307 Bacteria 4315
188 Ga0157372_10070405 3300013307 Bacteria 3935
189 Ga0157372_10076055 3300013307 Bacteria 3790
190 Ga0157372_10171674 3300013307 Unclassified 2509
191 Ga0157372_10256408 3300013307 Unclassified 2030
192 Ga0157372_10275123 3300013307 Bacteria 1957
193 Ga0157375_10000166 3300013308 Bacteria 61836
194 Ga0157375_10012039 3300013308 Bacteria 7660
195 Ga0163163_10352597 3300014325 Unclassified 1528
196 Ga0157380_10000704 3300014326 Bacteria 20846
197 Ga0157380_10064001 3300014326 Bacteria 2950
198 Ga0157380_10494252 3300014326 Bacteria 1187
199 Ga0157379_10031537 3300014968 Bacteria 4722
200 Ga0157379_10051974 3300014968 Bacteria 3659
201 Ga0157379_10174788 3300014968 Bacteria 1939
202 Ga0157376_10000136 3300014969 Bacteria 50249
203 Ga0157376_10014733 3300014969 Bacteria 5881
204 Ga0157376_10017001 3300014969 Bacteria 5538
205 Ga0163161_10348952 3300017792 Bacteria 1176
206 Ga0163161_10364590 3300017792 Unclassified 1151
207 Ga0163161_10724005 3300017792 Bacteria 830
208 Ga0207656_10001167 3300025321 Bacteria 8636
209 Ga0207642_10705695 3300025899 Unclassified 636
210 Ga0207680_10000627 3300025903 Bacteria 16642
211 Ga0207680_10215040 3300025903 Bacteria 1316
212 Ga0207645_10045768 3300025907 Bacteria 2796
213 Ga0207705_10004003 3300025909 Bacteria 11212
214 Ga0207705_10013943 3300025909 Bacteria 5796
215 Ga0207705_10062612 3300025909 Bacteria 2687
216 Ga0207705_10075988 3300025909 Bacteria 2441
217 Ga0207705_10104750 3300025909 Bacteria 2084
218 Ga0207705_10308613 3300025909 Bacteria 1214
219 Ga0207705_10488392 3300025909 Unclassified 956
220 Ga0207654_10008432 3300025911 Bacteria 5210
221 Ga0207654_10070914 3300025911 Unclassified 2070
222 Ga0207707_10002754 3300025912 Bacteria 15674
223 Ga0207707_10046918 3300025912 Bacteria 3763
224 Ga0207707_10089661 3300025912 Bacteria 2688
225 Ga0207707_10438427 3300025912 Bacteria 1118
226 Ga0207707_11168930 3300025912 Bacteria 624
227 Ga0207695_10052702 3300025913 Bacteria 4260
228 Ga0207671_10001627 3300025914 Bacteria 25569
229 Ga0207660_10001851 3300025917 Bacteria 14094
230 Ga0207660_10152701 3300025917 Bacteria 1775
231 Ga0207662_10981278 3300025918 Unclassified 599
232 Ga0207657_10020298 3300025919 Bacteria 6284
233 Ga0207657_10048400 3300025919 Bacteria 3712
234 Ga0207657_10111296 3300025919 Bacteria 2261
235 Ga0207657_10146678 3300025919 Unclassified 1924
236 Ga0207657_10151846 3300025919 Bacteria 1886
237 Ga0207652_10000074 3300025921 Bacteria 108397
238 Ga0207652_10000101 3300025921 Bacteria 93033
239 Ga0207652_10001480 3300025921 Bacteria 20773
240 Ga0207652_10165452 3300025921 Bacteria 1983
241 Ga0207652_10258002 3300025921 Bacteria 1572
242 Ga0207652_10341591 3300025921 Unclassified 1351
243 Ga0207652_10412236 3300025921 Bacteria 1219
244 Ga0207650_10190165 3300025925 Bacteria 1640
245 Ga0207650_10209718 3300025925 Bacteria 1564
246 Ga0207650_10280391 3300025925 Bacteria 1357
247 Ga0207687_10202073 3300025927 Unclassified 1554
248 Ga0207644_10131989 3300025931 Bacteria 1913
249 Ga0207644_10864971 3300025931 Bacteria 757
250 Ga0207690_10028052 3300025932 Bacteria 3564
251 Ga0207690_10959909 3300025932 Bacteria 710
252 Ga0207686_10247919 3300025934 Bacteria 1300
253 Ga0207709_10346799 3300025935 Unclassified 1119
254 Ga0207704_10091455 3300025938 Unclassified 2000
255 Ga0207704_10340855 3300025938 Bacteria 1163
256 Ga0207691_10096282 3300025940 Bacteria 2646
257 Ga0207691_10110387 3300025940 Bacteria 2446
258 Ga0207689_10000740 3300025942 Bacteria 31390
259 Ga0207689_10001881 3300025942 Bacteria 19847
260 Ga0207689_10057033 3300025942 Bacteria 3213
261 Ga0207689_10431427 3300025942 Bacteria 1100
262 Ga0207661_10203634 3300025944 Bacteria 1741
263 Ga0207667_10016655 3300025949 Bacteria 8296
264 Ga0207667_10092281 3300025949 Bacteria 3128
265 Ga0207667_10104314 3300025949 Bacteria 2924
266 Ga0207667_10124685 3300025949 Bacteria 2653
267 Ga0207667_10343380 3300025949 Bacteria 1523
268 Ga0207667_10448790 3300025949 Bacteria 1311
269 Ga0207667_10460749 3300025949 Unclassified 1291
270 Ga0207651_10719632 3300025960 Unclassified 881
271 Ga0207651_10732828 3300025960 Bacteria 873
272 Ga0207712_10004692 3300025961 Bacteria 8639
273 Ga0207712_10141973 3300025961 Bacteria 1844
274 Ga0207712_10265106 3300025961 Unclassified 1395
275 Ga0207668_10172764 3300025972 Bacteria 1696
276 Ga0207668_10221819 3300025972 Bacteria 1519
277 Ga0207640_10306067 3300025981 Bacteria 1259
278 Ga0207640_10624594 3300025981 Bacteria 915
279 Ga0207658_10023428 3300025986 Bacteria 4309
280 Ga0207658_10078316 3300025986 Bacteria 2525
281 Ga0207658_10088972 3300025986 Bacteria 2389
282 Ga0207677_10020716 3300026023 Bacteria 3999
283 Ga0207677_10576358 3300026023 Bacteria 984
284 Ga0207677_10598675 3300026023 Unclassified 967
285 Ga0207703_10003137 3300026035 Bacteria 13955
286 Ga0207639_10155803 3300026041 Bacteria 1919
287 Ga0207639_10162437 3300026041 Bacteria 1884
288 Ga0207678_10006232 3300026067 Bacteria 10594
289 Ga0207702_10031213 3300026078 Bacteria 4440
290 Ga0207702_10062588 3300026078 Bacteria 3178
291 Ga0207641_10000146 3300026088 Bacteria 100666
292 Ga0207641_10230281 3300026088 Bacteria 1722
293 Ga0207641_10695894 3300026088 Bacteria 1001
294 Ga0207648_10101011 3300026089 Bacteria 2527
295 Ga0207676_10007680 3300026095 Bacteria 7660
296 Ga0207676_10355198 3300026095 Bacteria 1357
297 Ga0207674_10045087 3300026116 Bacteria 4538
298 Ga0207674_11436152 3300026116 Bacteria 659
299 Ga0207675_100115252 3300026118 Bacteria 2539
300 Ga0207675_100639968 3300026118 Bacteria 1069
301 Ga0207675_101488150 3300026118 Bacteria 698
302 Ga0207683_10744902 3300026121 Bacteria 909
303 Ga0207698_10008508 3300026142 Bacteria 6498
304 Ga0207698_10041356 3300026142 Bacteria 3434
305 Ga0207698_11328581 3300026142 Bacteria 734
306 Ga0207428_10294427 3300027907 Bacteria 1202
307 Ga0207428_10476208 3300027907 Bacteria 909
308 Ga0268264_10004639 3300028381 Bacteria 11675
309 Ga0268264_10014915 3300028381 Bacteria 6382
310 Ga0268264_10045408 3300028381 Bacteria 3647
311 Ga0268264_10257335 3300028381 Bacteria 1624
312 Ga0307515_10000024 3300028794 Bacteria 393119
313 Ga0307513_10665526 3300031456 Bacteria 748
314 Ga0307410_11235716 3300031852 Unclassified 652
315 Ga0307406_10017013 3300031901 Bacteria 4232
316 Ga0307412_10351783 3300031911 Bacteria 1183
317 Ga0307414_10938719 3300032004 Unclassified 794
318 Ga0307414_10956242 3300032004 Unclassified 787
319 Ga0307411_10101637 3300032005 Unclassified 2035
320 Ga0316580_10213148 3300032139 Unclassified 596
321 Ga0316582_0171575 3300036647 Unclassified 1473
322 Ga0395899_0000526 3300037312 Bacteria 42013
323 Ga0395899_0010797 3300037312 Bacteria 7001
324 Ga0395899_0042281 3300037312 Bacteria 3402
325 Ga0395899_0111392 3300037312 Bacteria 1967
326 Ga0395900_0001242 3300037418 Bacteria 31305
327 Ga0395900_0010016 3300037418 Bacteria 9699
328 Ga0395900_0068277 3300037418 Bacteria 3652
329 Ga0395900_0089838 3300037418 Bacteria 3157
330 Ga0395900_0262623 3300037418 Bacteria 1723
331 Ga0395898_0002289 3300037466 Bacteria 23046
332 Ga0395898_0008734 3300037466 Bacteria 10688
333 Ga0395898_0013555 3300037466 Bacteria 8391
334 Ga0395898_0013786 3300037466 Bacteria 8309
335 Ga0395898_0065263 3300037466 Bacteria 3529
336 Ga0395898_0561651 3300037466 Unclassified 1083
337 Ga0395905_0772577 3300037471 Bacteria 863
338 Ga0395901_0003026 3300038443 Bacteria 16951
339 Ga0395901_0005468 3300038443 Bacteria 12862
340 Ga0395901_0129667 3300038443 Bacteria 2649
341 Ga0395901_0260475 3300038443 Bacteria 1805
342 Ga0395901_0280073 3300038443 Bacteria 1732
343 Ga0395901_0390764 3300038443 Bacteria 1430
344 Ga0395901_0745410 3300038443 Unclassified 973
345 Ga0439439_0036678 3300041406 Bacteria 1262
346 Ga0439465_0035777 3300041413 Unclassified 1593
347 Ga0439465_0240802 3300041413 Unclassified 667
348 Ga0451837_0501751 3300041494 Unclassified 614
349 Ga0439431_0012964 3300041997 Bacteria 1920
350 Ga0439445_0098690 3300042004 Bacteria 827
351 Ga0439449_0001549 3300042007 Bacteria 9004
352 Ga0439457_011794 3300042014 Bacteria 1978
353 Ga0439462_0103948 3300042015 Unclassified 784
354 Ga0450894_001740 3300042131 Bacteria 3057
355 Ga0450898_007408 3300042134 Bacteria 1708
356 Ga0450899_000663 3300042135 Bacteria 3915
357 Ga0439434_0028705 3300042435 Bacteria 1686
358 Ga0495581_0150512 3300047315 Bacteria 1359
359 Ga0495672_0132049 3300047320 Unclassified 1312
360 Ga0496104_0681873 3300048907 Bacteria 936
361 Ga0496105_0168743 3300048908 Bacteria 1795
362 Ga0496109_0401095 3300048912 Bacteria 1296
363 Ga0501034_0107432 3300049571 Bacteria 2783
364 Ga0501034_0169933 3300049571 Bacteria 2148
365 Ga0501034_0190524 3300049571 Unclassified 2013
366 Ga0501037_0339423 3300049573 Bacteria 1038
367 Ga0501043_0217108 3300049579 Bacteria 1481
368 Ga0501202_004101 3300049652 Bacteria 2536
369 Ga0501243_016068 3300049675 Bacteria 1207
370 Ga0501225_0185071 3300049705 Bacteria 653
371 Ga0501035_0115026 3300049822 Bacteria 2355
372 Ga0501044_1147896 3300049823 Bacteria 645
373 nmdc:mga0k408_473611_c1 3300050493 Bacteria 743
374 nmdc:mga0k408_534261_c1 3300050493 Unclassified 694
375 nmdc:mga05p37_156037_c1 3300050507 Bacteria 2789
376 nmdc:mga08y16_118935_c1 3300050511 Bacteria 2750
377 nmdc:mga08y16_320778_c1 3300050511 Bacteria 1595
378 nmdc:mga08y16_759864_c1 3300050511 Unclassified 965
379 Ga0500661_012279 3300055283 Bacteria 1547

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300032004 Ga0307414_10956242 Ga0307414_109562421 150
2 3300005331 Ga0070670_100030147 Ga0070670_1000301475 151
3 3300005331 Ga0070670_100091297 Ga0070670_1000912973 151
4 3300005338 Ga0068868_100016736 Ga0068868_1000167364 151
5 3300005365 Ga0070688_100546097 Ga0070688_1005460972 151
6 3300005367 Ga0070667_100005582 Ga0070667_10000558212 151
7 3300005548 Ga0070665_102107123 Ga0070665_1021071231 151
8 3300005617 Ga0068859_100879035 Ga0068859_1008790352 151
9 3300005841 Ga0068863_100783183 Ga0068863_1007831831 151
10 3300005843 Ga0068860_100004015 Ga0068860_10000401515 151
11 3300006175 Ga0070712_101649387 Ga0070712_1016493871 151
12 3300006358 Ga0068871_101253034 Ga0068871_1012530342 151
13 3300006931 Ga0097620_100879071 Ga0097620_1008790712 151
14 3300013297 Ga0157378_10024992 Ga0157378_100249926 151
15 3300013297 Ga0157378_10076362 Ga0157378_100763624 151
16 3300014968 Ga0157379_10174788 Ga0157379_101747883 151
17 3300025321 Ga0207656_10001167 Ga0207656_100011677 151
18 3300025925 Ga0207650_10209718 Ga0207650_102097181 151
19 3300025986 Ga0207658_10023428 Ga0207658_100234285 151
20 3300026023 Ga0207677_10020716 Ga0207677_100207163 151
21 3300026088 Ga0207641_10230281 Ga0207641_102302812 151
22 3300028381 Ga0268264_10014915 Ga0268264_100149155 151
23 3300028794 Ga0307515_10000024 Ga0307515_1000002497 151
24 3300005327 Ga0070658_10641370 Ga0070658_106413702 152
25 3300005334 Ga0068869_100006366 Ga0068869_1000063665 152
26 3300005335 Ga0070666_10000031 Ga0070666_1000003179 152
27 3300005338 Ga0068868_100038534 Ga0068868_1000385345 152
28 3300005343 Ga0070687_100239258 Ga0070687_1002392582 152
29 3300005364 Ga0070673_100513905 Ga0070673_1005139052 152
30 3300005365 Ga0070688_100062631 Ga0070688_1000626314 152
31 3300005367 Ga0070667_100022891 Ga0070667_1000228914 152
32 3300005456 Ga0070678_101808674 Ga0070678_1018086741 152
33 3300005616 Ga0068852_100089960 Ga0068852_1000899604 152
34 3300005617 Ga0068859_100000045 Ga0068859_10000004557 152
35 3300005618 Ga0068864_100001153 Ga0068864_1000011534 152
36 3300005834 Ga0068851_10016891 Ga0068851_100168914 152
37 3300005841 Ga0068863_100002071 Ga0068863_10000207114 152
38 3300005842 Ga0068858_100002469 Ga0068858_1000024699 152
39 3300005843 Ga0068860_100004776 Ga0068860_1000047767 152
40 3300006237 Ga0097621_100064624 Ga0097621_1000646242 152
41 3300006358 Ga0068871_100013852 Ga0068871_1000138524 152
42 3300006358 Ga0068871_100869878 Ga0068871_1008698782 152
43 3300006881 Ga0068865_100265742 Ga0068865_1002657422 152
44 3300006931 Ga0097620_100000045 Ga0097620_10000004584 152
45 3300009098 Ga0105245_10090778 Ga0105245_100907783 152
46 3300009148 Ga0105243_10236535 Ga0105243_102365352 152
47 3300009174 Ga0105241_10003471 Ga0105241_100034719 152
48 3300009545 Ga0105237_10002015 Ga0105237_1000201514 152
49 3300009553 Ga0105249_10001437 Ga0105249_1000143716 152
50 3300010375 Ga0105239_10053700 Ga0105239_100537004 152
51 3300011119 Ga0105246_10012782 Ga0105246_100127824 152
52 3300013297 Ga0157378_10127414 Ga0157378_101274144 152
53 3300013297 Ga0157378_10326584 Ga0157378_103265841 152
54 3300013306 Ga0163162_10021357 Ga0163162_100213577 152
55 3300013308 Ga0157375_10012039 Ga0157375_100120399 152
56 3300014325 Ga0163163_10352597 Ga0163163_103525971 152
57 3300014968 Ga0157379_10031537 Ga0157379_100315374 152
58 3300014969 Ga0157376_10014733 Ga0157376_100147337 152
59 3300014969 Ga0157376_10017001 Ga0157376_100170013 152
60 3300025903 Ga0207680_10000627 Ga0207680_100006276 152
61 3300025909 Ga0207705_10488392 Ga0207705_104883921 152
62 3300025911 Ga0207654_10008432 Ga0207654_100084323 152
63 3300025914 Ga0207671_10001627 Ga0207671_1000162713 152
64 3300025918 Ga0207662_10981278 Ga0207662_109812781 152
65 3300025927 Ga0207687_10202073 Ga0207687_102020733 152
66 3300025935 Ga0207709_10346799 Ga0207709_103467991 152
67 3300025938 Ga0207704_10091455 Ga0207704_100914553 152
68 3300025942 Ga0207689_10000740 Ga0207689_1000074028 152
69 3300025960 Ga0207651_10732828 Ga0207651_107328282 152
70 3300025961 Ga0207712_10004692 Ga0207712_100046923 152
71 3300025986 Ga0207658_10078316 Ga0207658_100783164 152
72 3300026023 Ga0207677_10598675 Ga0207677_105986752 152
73 3300026035 Ga0207703_10003137 Ga0207703_100031378 152
74 3300026088 Ga0207641_10000146 Ga0207641_1000014652 152
75 3300026095 Ga0207676_10007680 Ga0207676_100076808 152
76 3300026142 Ga0207698_10041356 Ga0207698_100413564 152
77 3300028381 Ga0268264_10004639 Ga0268264_100046394 152
78 3300047315 Ga0495581_0150512 Ga0495581_0150512_626_1084 152
79 3300055283 Ga0500661_012279 Ga0500661_012279_383_841 152
80 3300005719 Ga0068861_101834155 Ga0068861_1018341551 153
81 3300006881 Ga0068865_100329674 Ga0068865_1003296743 153
82 3300009176 Ga0105242_10610102 Ga0105242_106101022 153
83 3300009553 Ga0105249_10011652 Ga0105249_100116521 153
84 3300013306 Ga0163162_10005822 Ga0163162_100058222 153
85 3300017792 Ga0163161_10348952 Ga0163161_103489523 153
86 3300026118 Ga0207675_100639968 Ga0207675_1006399682 153
87 3300041406 Ga0439439_0036678 Ga0439439_0036678_193_654 153
88 3300041413 Ga0439465_0240802 Ga0439465_0240802_60_521 153
89 3300041997 Ga0439431_0012964 Ga0439431_0012964_240_701 153
90 3300042004 Ga0439445_0098690 Ga0439445_0098690_106_567 153
91 3300042015 Ga0439462_0103948 Ga0439462_0103948_55_516 153
92 3300042131 Ga0450894_001740 Ga0450894_001740_2434_2895 153
93 3300042134 Ga0450898_007408 Ga0450898_007408_537_998 153
94 3300042135 Ga0450899_000663 Ga0450899_000663_364_825 153
95 3300042435 Ga0439434_0028705 Ga0439434_0028705_1192_1653 153
96 3300048907 Ga0496104_0681873 Ga0496104_0681873_436_897 153
97 3300005327 Ga0070658_10222313 Ga0070658_102223132 155
98 3300005347 Ga0070668_101328478 Ga0070668_1013284781 155
99 3300005530 Ga0070679_100087355 Ga0070679_1000873553 155
100 3300005539 Ga0068853_100177305 Ga0068853_1001773052 155
101 3300005549 Ga0070704_101263429 Ga0070704_1012634292 155
102 3300005563 Ga0068855_100286577 Ga0068855_1002865772 155
103 3300005563 Ga0068855_100654250 Ga0068855_1006542502 155
104 3300005616 Ga0068852_100001769 Ga0068852_10000176912 155
105 3300009147 Ga0114129_10065258 Ga0114129_100652581 155
106 3300013102 Ga0157371_10085973 Ga0157371_100859734 155
107 3300025909 Ga0207705_10075988 Ga0207705_100759882 155
108 3300025909 Ga0207705_10104750 Ga0207705_101047502 155
109 3300025912 Ga0207707_10438427 Ga0207707_104384272 155
110 3300025921 Ga0207652_10001480 Ga0207652_1000148012 155
111 3300025949 Ga0207667_10124685 Ga0207667_101246852 155
112 3300025949 Ga0207667_10448790 Ga0207667_104487902 155
113 3300025961 Ga0207712_10265106 Ga0207712_102651063 155
114 3300026041 Ga0207639_10155803 Ga0207639_101558033 155
115 3300026142 Ga0207698_10008508 Ga0207698_100085085 155
116 3300027907 Ga0207428_10476208 Ga0207428_104762081 155
117 3300050507 nmdc:mga05p37_156037_c1 nmdc:mga05p37_156037_c1_2089_2556 155
118 3300005354 Ga0070675_100265200 Ga0070675_1002652002 156
119 3300009098 Ga0105245_13173064 Ga0105245_131730641 156
120 3300025940 Ga0207691_10096282 Ga0207691_100962823 156
121 3300048908 Ga0496105_0168743 Ga0496105_0168743_1271_1741 156
122 3300048912 Ga0496109_0401095 Ga0496109_0401095_191_661 156
123 3300026095 Ga0207676_10355198 Ga0207676_103551982 157
124 3300005335 Ga0070666_10253557 Ga0070666_102535572 158
125 3300005339 Ga0070660_100009253 Ga0070660_1000092536 158
126 3300005355 Ga0070671_100050201 Ga0070671_1000502012 158
127 3300005367 Ga0070667_100051824 Ga0070667_1000518242 158
128 3300005436 Ga0070713_100474372 Ga0070713_1004743721 158
129 3300005841 Ga0068863_100143385 Ga0068863_1001433853 158
130 3300006195 Ga0075366_10500753 Ga0075366_105007532 158
131 3300006237 Ga0097621_100000277 Ga0097621_10000027728 158
132 3300006358 Ga0068871_100000119 Ga0068871_10000011913 158
133 3300006358 Ga0068871_100013100 Ga0068871_1000131002 158
134 3300009094 Ga0111539_10120365 Ga0111539_101203653 158
135 3300009174 Ga0105241_11053722 Ga0105241_110537221 158
136 3300013297 Ga0157378_10016416 Ga0157378_100164162 158
137 3300013306 Ga0163162_10000915 Ga0163162_1000091521 158
138 3300013308 Ga0157375_10000166 Ga0157375_1000016611 158
139 3300014968 Ga0157379_10051974 Ga0157379_100519745 158
140 3300014969 Ga0157376_10000136 Ga0157376_1000013615 158
141 3300017792 Ga0163161_10364590 Ga0163161_103645901 158
142 3300025919 Ga0207657_10020298 Ga0207657_100202982 158
143 3300026142 Ga0207698_11328581 Ga0207698_113285811 158
144 3300032004 Ga0307414_10938719 Ga0307414_109387192 158
145 3300050493 nmdc:mga0k408_473611_c1 nmdc:mga0k408_473611_c1_165_641 158
146 3300050511 nmdc:mga08y16_118935_c1 nmdc:mga08y16_118935_c1_1386_1862 158
147 3300005334 Ga0068869_100084900 Ga0068869_1000849002 159
148 3300005339 Ga0070660_100027628 Ga0070660_1000276285 159
149 3300005366 Ga0070659_100128473 Ga0070659_1001284734 159
150 3300005459 Ga0068867_100216317 Ga0068867_1002163172 159
151 3300005563 Ga0068855_100009310 Ga0068855_10000931010 159
152 3300005719 Ga0068861_101471927 Ga0068861_1014719271 159
153 3300005842 Ga0068858_101062353 Ga0068858_1010623531 159
154 3300005843 Ga0068860_100156159 Ga0068860_1001561594 159
155 3300009148 Ga0105243_10151761 Ga0105243_101517612 159
156 3300009174 Ga0105241_10158828 Ga0105241_101588284 159
157 3300009176 Ga0105242_10357971 Ga0105242_103579713 159
158 3300013100 Ga0157373_10819505 Ga0157373_108195051 159
159 3300013104 Ga0157370_10010279 Ga0157370_100102798 159
160 3300013104 Ga0157370_10284623 Ga0157370_102846232 159
161 3300013297 Ga0157378_10172198 Ga0157378_101721982 159
162 3300013307 Ga0157372_10058319 Ga0157372_100583194 159
163 3300025919 Ga0207657_10048400 Ga0207657_100484004 159
164 3300025925 Ga0207650_10190165 Ga0207650_101901652 159
165 3300025934 Ga0207686_10247919 Ga0207686_102479193 159
166 3300025942 Ga0207689_10057033 Ga0207689_100570332 159
167 3300025949 Ga0207667_10460749 Ga0207667_104607491 159
168 3300025972 Ga0207668_10221819 Ga0207668_102218192 159
169 3300026088 Ga0207641_10695894 Ga0207641_106958942 159
170 3300026118 Ga0207675_101488150 Ga0207675_1014881502 159
171 3300031852 Ga0307410_11235716 Ga0307410_112357161 159
172 3300031911 Ga0307412_10351783 Ga0307412_103517833 159
173 3300032005 Ga0307411_10101637 Ga0307411_101016373 159
174 3300032139 Ga0316580_10213148 Ga0316580_102131481 159
175 3300036647 Ga0316582_0171575 Ga0316582_0171575_540_1019 159
176 3300037312 Ga0395899_0042281 Ga0395899_0042281_214_693 159
177 3300037418 Ga0395900_0262623 Ga0395900_0262623_296_775 159
178 3300037466 Ga0395898_0013555 Ga0395898_0013555_1207_1686 159
179 3300038443 Ga0395901_0003026 Ga0395901_0003026_6164_6643 159
180 3300049652 Ga0501202_004101 Ga0501202_004101_1910_2425 159
181 3300049675 Ga0501243_016068 Ga0501243_016068_16_495 159
182 3300049705 Ga0501225_0185071 Ga0501225_0185071_43_558 159
183 3300005327 Ga0070658_10070071 Ga0070658_100700714 160
184 3300005339 Ga0070660_100028267 Ga0070660_1000282676 160
185 3300005366 Ga0070659_100024285 Ga0070659_1000242855 160
186 3300005530 Ga0070679_100000517 Ga0070679_10000051710 160
187 3300005539 Ga0068853_100129643 Ga0068853_1001296434 160
188 3300005577 Ga0068857_100076770 Ga0068857_1000767705 160
189 3300013100 Ga0157373_10094905 Ga0157373_100949053 160
190 3300013100 Ga0157373_10185471 Ga0157373_101854713 160
191 3300013102 Ga0157371_10001002 Ga0157371_1000100216 160
192 3300013102 Ga0157371_10002749 Ga0157371_100027497 160
193 3300013307 Ga0157372_10070405 Ga0157372_100704053 160
194 3300013307 Ga0157372_10076055 Ga0157372_100760553 160
195 3300013307 Ga0157372_10171674 Ga0157372_101716744 160
196 3300025909 Ga0207705_10013943 Ga0207705_100139434 160
197 3300025912 Ga0207707_11168930 Ga0207707_111689301 160
198 3300025919 Ga0207657_10146678 Ga0207657_101466784 160
199 3300025921 Ga0207652_10000101 Ga0207652_1000010114 160
200 3300025921 Ga0207652_10412236 Ga0207652_104122362 160
201 3300025932 Ga0207690_10028052 Ga0207690_100280524 160
202 3300026041 Ga0207639_10162437 Ga0207639_101624373 160
203 3300026116 Ga0207674_10045087 Ga0207674_100450876 160
204 3300037312 Ga0395899_0000526 Ga0395899_0000526_26360_26842 160
205 3300037312 Ga0395899_0111392 Ga0395899_0111392_1228_1710 160
206 3300037418 Ga0395900_0001242 Ga0395900_0001242_8909_9391 160
207 3300037418 Ga0395900_0010016 Ga0395900_0010016_2392_2874 160
208 3300037418 Ga0395900_0068277 Ga0395900_0068277_462_944 160
209 3300037466 Ga0395898_0002289 Ga0395898_0002289_1733_2215 160
210 3300037466 Ga0395898_0008734 Ga0395898_0008734_9061_9543 160
211 3300037466 Ga0395898_0561651 Ga0395898_0561651_589_1071 160
212 3300037471 Ga0395905_0772577 Ga0395905_0772577_145_627 160
213 3300038443 Ga0395901_0005468 Ga0395901_0005468_8379_8861 160
214 3300038443 Ga0395901_0129667 Ga0395901_0129667_209_691 160
215 3300038443 Ga0395901_0280073 Ga0395901_0280073_878_1360 160
216 3300038443 Ga0395901_0390764 Ga0395901_0390764_258_740 160
217 3300038443 Ga0395901_0745410 Ga0395901_0745410_132_614 160
218 3300004799 Ga0058863_11478956 Ga0058863_114789561 161
219 3300005288 Ga0065714_10279225 Ga0065714_102792252 161
220 3300005295 Ga0065707_10179642 Ga0065707_101796423 161
221 3300005327 Ga0070658_10009081 Ga0070658_100090815 161
222 3300005327 Ga0070658_10013656 Ga0070658_100136567 161
223 3300005336 Ga0070680_100001109 Ga0070680_10000110912 161
224 3300005336 Ga0070680_100340368 Ga0070680_1003403683 161
225 3300005339 Ga0070660_100104292 Ga0070660_1001042923 161
226 3300005339 Ga0070660_100254095 Ga0070660_1002540952 161
227 3300005343 Ga0070687_100086203 Ga0070687_1000862032 161
228 3300005347 Ga0070668_100134014 Ga0070668_1001340142 161
229 3300005354 Ga0070675_101075339 Ga0070675_1010753391 161
230 3300005354 Ga0070675_101475983 Ga0070675_1014759831 161
231 3300005355 Ga0070671_100168793 Ga0070671_1001687931 161
232 3300005356 Ga0070674_100140670 Ga0070674_1001406702 161
233 3300005356 Ga0070674_100190035 Ga0070674_1001900353 161
234 3300005364 Ga0070673_100142306 Ga0070673_1001423062 161
235 3300005366 Ga0070659_100020736 Ga0070659_1000207366 161
236 3300005366 Ga0070659_100105794 Ga0070659_1001057944 161
237 3300005367 Ga0070667_100114246 Ga0070667_1001142464 161
238 3300005367 Ga0070667_100313590 Ga0070667_1003135902 161
239 3300005455 Ga0070663_100078181 Ga0070663_1000781813 161
240 3300005455 Ga0070663_100715552 Ga0070663_1007155522 161
241 3300005456 Ga0070678_100459356 Ga0070678_1004593563 161
242 3300005457 Ga0070662_100386791 Ga0070662_1003867912 161
243 3300005458 Ga0070681_10005409 Ga0070681_100054097 161
244 3300005458 Ga0070681_10044990 Ga0070681_100449903 161
245 3300005458 Ga0070681_10094317 Ga0070681_100943172 161
246 3300005459 Ga0068867_100252096 Ga0068867_1002520962 161
247 3300005530 Ga0070679_100019775 Ga0070679_1000197756 161
248 3300005530 Ga0070679_100107378 Ga0070679_1001073781 161
249 3300005530 Ga0070679_100152568 Ga0070679_1001525682 161
250 3300005535 Ga0070684_100073078 Ga0070684_1000730784 161
251 3300005535 Ga0070684_101540359 Ga0070684_1015403591 161
252 3300005539 Ga0068853_100046207 Ga0068853_1000462074 161
253 3300005539 Ga0068853_101118651 Ga0068853_1011186511 161
254 3300005539 Ga0068853_101166124 Ga0068853_1011661241 161
255 3300005543 Ga0070672_100402251 Ga0070672_1004022513 161
256 3300005543 Ga0070672_100683665 Ga0070672_1006836652 161
257 3300005544 Ga0070686_100083642 Ga0070686_1000836422 161
258 3300005563 Ga0068855_100063955 Ga0068855_1000639556 161
259 3300005563 Ga0068855_100174877 Ga0068855_1001748774 161
260 3300005577 Ga0068857_100172125 Ga0068857_1001721252 161
261 3300005578 Ga0068854_101255955 Ga0068854_1012559551 161
262 3300005614 Ga0068856_100056506 Ga0068856_1000565064 161
263 3300005614 Ga0068856_100660664 Ga0068856_1006606642 161
264 3300005616 Ga0068852_100083555 Ga0068852_1000835554 161
265 3300005719 Ga0068861_100200953 Ga0068861_1002009532 161
266 3300005842 Ga0068858_100101461 Ga0068858_1001014612 161
267 3300005843 Ga0068860_100059064 Ga0068860_1000590644 161
268 3300005844 Ga0068862_100394428 Ga0068862_1003944282 161
269 3300006195 Ga0075366_10602624 Ga0075366_106026242 161
270 3300006358 Ga0068871_100309603 Ga0068871_1003096032 161
271 3300006358 Ga0068871_100621434 Ga0068871_1006214341 161
272 3300006881 Ga0068865_100068174 Ga0068865_1000681742 161
273 3300006881 Ga0068865_100832471 Ga0068865_1008324712 161
274 3300009094 Ga0111539_10204249 Ga0111539_102042492 161
275 3300009174 Ga0105241_10033969 Ga0105241_100339695 161
276 3300009176 Ga0105242_10088647 Ga0105242_100886473 161
277 3300009545 Ga0105237_10133969 Ga0105237_101339692 161
278 3300009553 Ga0105249_10189265 Ga0105249_101892652 161
279 3300010375 Ga0105239_10149953 Ga0105239_101499534 161
280 3300013100 Ga0157373_10019740 Ga0157373_100197406 161
281 3300013100 Ga0157373_10176472 Ga0157373_101764721 161
282 3300013100 Ga0157373_10286220 Ga0157373_102862201 161
283 3300013100 Ga0157373_10441408 Ga0157373_104414082 161
284 3300013102 Ga0157371_10001146 Ga0157371_1000114613 161
285 3300013102 Ga0157371_10012485 Ga0157371_100124855 161
286 3300013102 Ga0157371_10053576 Ga0157371_100535763 161
287 3300013102 Ga0157371_10056910 Ga0157371_100569102 161
288 3300013102 Ga0157371_10083692 Ga0157371_100836922 161
289 3300013104 Ga0157370_10004098 Ga0157370_100040989 161
290 3300013104 Ga0157370_10213984 Ga0157370_102139842 161
291 3300013105 Ga0157369_10006046 Ga0157369_100060467 161
292 3300013105 Ga0157369_10034679 Ga0157369_100346794 161
293 3300013105 Ga0157369_10034916 Ga0157369_100349168 161
294 3300013105 Ga0157369_10042617 Ga0157369_100426172 161
295 3300013105 Ga0157369_10218146 Ga0157369_102181462 161
296 3300013296 Ga0157374_10570775 Ga0157374_105707752 161
297 3300013297 Ga0157378_12027309 Ga0157378_120273091 161
298 3300013306 Ga0163162_10055641 Ga0163162_100556414 161
299 3300013306 Ga0163162_11842584 Ga0163162_118425841 161
300 3300013307 Ga0157372_10023785 Ga0157372_100237856 161
301 3300013307 Ga0157372_10034549 Ga0157372_100345496 161
302 3300013307 Ga0157372_10041409 Ga0157372_100414092 161
303 3300013307 Ga0157372_10256408 Ga0157372_102564082 161
304 3300013307 Ga0157372_10275123 Ga0157372_102751232 161
305 3300014326 Ga0157380_10000704 Ga0157380_1000070419 161
306 3300014326 Ga0157380_10064001 Ga0157380_100640015 161
307 3300014326 Ga0157380_10494252 Ga0157380_104942522 161
308 3300017792 Ga0163161_10724005 Ga0163161_107240052 161
309 3300025899 Ga0207642_10705695 Ga0207642_107056952 161
310 3300025903 Ga0207680_10215040 Ga0207680_102150403 161
311 3300025907 Ga0207645_10045768 Ga0207645_100457684 161
312 3300025909 Ga0207705_10004003 Ga0207705_1000400314 161
313 3300025909 Ga0207705_10062612 Ga0207705_100626122 161
314 3300025909 Ga0207705_10308613 Ga0207705_103086132 161
315 3300025911 Ga0207654_10070914 Ga0207654_100709143 161
316 3300025912 Ga0207707_10002754 Ga0207707_100027547 161
317 3300025912 Ga0207707_10046918 Ga0207707_100469183 161
318 3300025912 Ga0207707_10089661 Ga0207707_100896614 161
319 3300025913 Ga0207695_10052702 Ga0207695_100527024 161
320 3300025917 Ga0207660_10001851 Ga0207660_1000185113 161
321 3300025917 Ga0207660_10152701 Ga0207660_101527012 161
322 3300025919 Ga0207657_10111296 Ga0207657_101112963 161
323 3300025919 Ga0207657_10151846 Ga0207657_101518463 161
324 3300025921 Ga0207652_10000074 Ga0207652_1000007488 161
325 3300025921 Ga0207652_10165452 Ga0207652_101654522 161
326 3300025921 Ga0207652_10258002 Ga0207652_102580023 161
327 3300025921 Ga0207652_10341591 Ga0207652_103415913 161
328 3300025925 Ga0207650_10280391 Ga0207650_102803911 161
329 3300025931 Ga0207644_10131989 Ga0207644_101319892 161
330 3300025931 Ga0207644_10864971 Ga0207644_108649711 161
331 3300025932 Ga0207690_10959909 Ga0207690_109599091 161
332 3300025938 Ga0207704_10340855 Ga0207704_103408553 161
333 3300025940 Ga0207691_10110387 Ga0207691_101103872 161
334 3300025942 Ga0207689_10001881 Ga0207689_1000188115 161
335 3300025942 Ga0207689_10431427 Ga0207689_104314272 161
336 3300025944 Ga0207661_10203634 Ga0207661_102036343 161
337 3300025949 Ga0207667_10016655 Ga0207667_100166557 161
338 3300025949 Ga0207667_10092281 Ga0207667_100922812 161
339 3300025949 Ga0207667_10104314 Ga0207667_101043144 161
340 3300025949 Ga0207667_10343380 Ga0207667_103433801 161
341 3300025960 Ga0207651_10719632 Ga0207651_107196322 161
342 3300025961 Ga0207712_10141973 Ga0207712_101419732 161
343 3300025972 Ga0207668_10172764 Ga0207668_101727642 161
344 3300025981 Ga0207640_10306067 Ga0207640_103060672 161
345 3300025981 Ga0207640_10624594 Ga0207640_106245942 161
346 3300025986 Ga0207658_10088972 Ga0207658_100889724 161
347 3300026023 Ga0207677_10576358 Ga0207677_105763582 161
348 3300026067 Ga0207678_10006232 Ga0207678_100062323 161
349 3300026078 Ga0207702_10031213 Ga0207702_100312136 161
350 3300026078 Ga0207702_10062588 Ga0207702_100625883 161
351 3300026089 Ga0207648_10101011 Ga0207648_101010112 161
352 3300026116 Ga0207674_11436152 Ga0207674_114361521 161
353 3300026118 Ga0207675_100115252 Ga0207675_1001152523 161
354 3300026121 Ga0207683_10744902 Ga0207683_107449021 161
355 3300027907 Ga0207428_10294427 Ga0207428_102944272 161
356 3300028381 Ga0268264_10045408 Ga0268264_100454084 161
357 3300028381 Ga0268264_10257335 Ga0268264_102573353 161
358 3300031456 Ga0307513_10665526 Ga0307513_106655262 161
359 3300031901 Ga0307406_10017013 Ga0307406_100170135 161
360 3300037312 Ga0395899_0010797 Ga0395899_0010797_5708_6193 161
361 3300037418 Ga0395900_0089838 Ga0395900_0089838_1859_2344 161
362 3300037466 Ga0395898_0013786 Ga0395898_0013786_5712_6197 161
363 3300037466 Ga0395898_0065263 Ga0395898_0065263_1987_2493 161
364 3300038443 Ga0395901_0260475 Ga0395901_0260475_407_892 161
365 3300041413 Ga0439465_0035777 Ga0439465_0035777_469_954 161
366 3300041494 Ga0451837_0501751 Ga0451837_0501751_45_536 161
367 3300042007 Ga0439449_0001549 Ga0439449_0001549_996_1487 161
368 3300042014 Ga0439457_011794 Ga0439457_011794_1420_1911 161
369 3300047320 Ga0495672_0132049 Ga0495672_0132049_422_922 161
370 3300049571 Ga0501034_0107432 Ga0501034_0107432_215_706 161
371 3300049571 Ga0501034_0169933 Ga0501034_0169933_970_1455 161
372 3300049571 Ga0501034_0190524 Ga0501034_0190524_553_1038 161
373 3300049573 Ga0501037_0339423 Ga0501037_0339423_312_797 161
374 3300049579 Ga0501043_0217108 Ga0501043_0217108_846_1331 161
375 3300049822 Ga0501035_0115026 Ga0501035_0115026_151_636 161
376 3300049823 Ga0501044_1147896 Ga0501044_1147896_48_533 161
377 3300050493 nmdc:mga0k408_534261_c1 nmdc:mga0k408_534261_c1_77_613 161
378 3300050511 nmdc:mga08y16_320778_c1 nmdc:mga08y16_320778_c1_997_1482 161
379 3300050511 nmdc:mga08y16_759864_c1 nmdc:mga08y16_759864_c1_451_954 161

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02082

Rrf2

Iron-dependent Transcriptional regulator

3

138

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
4awx-assembly1.cif.gz_B moonlighting functions of feoc in the regulation of ferrous iron transport in feo 0.9343 26 67
1mkm-assembly1.cif.gz_B crystal structure of the thermotoga maritima iclr 0.9238 8 67
4ija-assembly1.cif.gz_B structure of s. aureus methicillin resistance factor mecr2 0.9185 10 68
7oyk-assembly1.cif.gz_AAA dna-binding domain of cggr in complex with the dna operator 0.9021 7 67
4wcg-assembly1.cif.gz_B the binding mode of cyprinid herpesvirus3 orf112-zalpha to z-dna 0.9011 7 67
ID Description Score Start End Superfamily
4awxB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9343 26 67 1.10.10.10
af_P77569_1_73_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9267 1 67 1.10.10.10
1mkmB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9238 8 67 1.10.10.10
af_P77732_3_78_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9217 6 67 1.10.10.10
af_P76540_107_166_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9157 8 67 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A1G0QQ30-F1-model_v4 Rrf2 family transcriptional regulator 0.8694 1 151 GO:0003700
GO:0005829
AF-H3NNK0-F1-model_v4 Rrf2 family protein 0.8686 1 132 GO:0003700
GO:0005829
AF-A0A7V2ZM40-F1-model_v4 Rrf2 family transcriptional regulator 0.863 1 151 GO:0003700
GO:0005829
AF-A0A1M4U431-F1-model_v4 Transcriptional regulator, BadM/Rrf2 family 0.8617 2 151 GO:0003700
GO:0005829
AF-A0A6N6SQY9-F1-model_v4 Rrf2 family transcriptional regulator 0.8614 1 151 GO:0003700
GO:0005829

Feature Viewer

pLDDT pTM Quality
76.98 0.69 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map