metagRoot

F428380

General Info

Members	Datasets	Scaffolds	Average Seq Length
379	240	379	326

Family's Representative Sequence

Representative Sequence	3300025940\|Ga0207691_10153268\|Ga0207691_101532683
Length	355
Sequence	MKTPNGGSSRLIRPWYNRPPQTAIEAVMPVRPPVFTPPFNVVRASHVELTVRDLARSRAFYVDCLGYLISAEEPEALYLRAVEERNHHSIVLRKGKEPAAHTLGFKVASDEDLDRAADWFKRRNLPVTFPDVPYQGRTLRTADVTGMPLEFYFKMDQGERMLQRYTAYQGARIQRIDHINCFTPDVQASYDFYTELGFRLTEYTETDDTRDPKLWAVWLHRKGNVHDLAFTNGRGPRLHHIGVWTAGTLDILHLCDVMATSGYLANMERGPGRHGISNAFFLYIRDPDGHRVELFTSDYLTVDPDLEPLRWSLTDPQRQTLWGHPAPKSWFEEGSEFPSVPIREPVLEARPVVAR

Samples

	Sample ID	Description	Type	Environment
1	3300003203	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
2	3300003215	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF	Metagenome	Endosphere
3	3300003323	Sugarcane root Sample H1	Metagenome	Unclassified
4	3300003659	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Metagenome	Rhizosphere
5	3300005293	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
6	3300005295	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2)	Metagenome	Rhizosphere
7	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
8	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
9	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
10	3300005333	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG	Metagenome	Rhizosphere
11	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
12	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
13	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
14	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
15	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
16	3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Metagenome	Rhizosphere
17	3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Metagenome	Rhizosphere
18	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
19	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
20	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
21	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
22	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
23	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
24	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
25	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
26	3300005437	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG	Metagenome	Rhizosphere
27	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
28	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
29	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
30	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
31	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
32	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
33	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
34	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
35	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
36	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
37	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
38	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
39	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
40	3300005983	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Metagenome	Rhizosphere
41	3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
42	3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Metagenome	Rhizosphere
43	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
44	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
45	3300006177	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2	Metagenome	Endosphere
46	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
47	3300006186	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4	Metagenome	Endosphere
48	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
49	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
50	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
51	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
52	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
53	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
54	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
55	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
56	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
57	3300007265	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1	Metagenome	Rhizosphere
58	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
59	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
60	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
61	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
62	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
63	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
64	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
65	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
66	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
67	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
68	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
69	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
70	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
71	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
72	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
73	3300021384	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9	Metagenome	Unclassified
74	3300025297	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2)	Metagenome	Endosphere
75	3300025893	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
76	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
77	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
78	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
79	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
80	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
81	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
82	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
83	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
84	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
85	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
86	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
87	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
88	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
89	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
90	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
91	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
92	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
93	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
94	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
95	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
96	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
97	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
98	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
99	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
100	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
101	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
102	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
103	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
104	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
105	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
106	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
107	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
108	3300027512	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2)	Metagenome	Rhizosphere
109	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
110	3300028023	Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5	Metagenome	Rhizosphere
111	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
112	3300028577	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG	Metagenome	Rhizosphere
113	3300030763	Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
114	3300031235	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG	Metagenome	Rhizosphere
115	3300031241	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG	Metagenome	Rhizosphere
116	3300031242	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG	Metagenome	Rhizosphere
117	3300031249	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG	Metagenome	Rhizosphere
118	3300031344	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG	Metagenome	Rhizosphere
119	3300031456	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM	Metagenome	Unclassified
120	3300031595	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG	Metagenome	Rhizosphere
121	3300031711	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG	Metagenome	Rhizosphere
122	3300031712	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG	Metagenome	Rhizosphere
123	3300035111	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11	Metagenome	Rhizosphere
124	3300035113	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12	Metagenome	Rhizosphere
125	3300035115	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11	Metagenome	Rhizosphere
126	3300035116	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3	Metagenome	Rhizosphere
127	3300035117	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1	Metagenome	Rhizosphere
128	3300035118	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2	Metagenome	Rhizosphere
129	3300035119	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4	Metagenome	Rhizosphere
130	3300035170	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1	Metagenome	Rhizosphere
131	3300035171	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4	Metagenome	Rhizosphere
132	3300035172	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3	Metagenome	Rhizosphere
133	3300035410	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12	Metagenome	Rhizosphere
134	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
135	3300035692	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11	Metagenome	Rhizosphere
136	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
137	3300035724	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1	Metagenome	Rhizosphere
138	3300035725	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8	Metagenome	Rhizosphere
139	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
140	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
141	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
142	3300039438	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2	Metagenome	Rhizosphere
143	3300041408	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195	Metagenome	Rhizosphere
144	3300042003	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551	Metagenome	Rhizosphere
145	3300042156	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593	Metagenome	Rhizosphere
146	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
147	3300046454	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere	Metagenome	Rhizosphere
148	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
149	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
150	3300046462	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere	Metagenome	Rhizosphere
151	3300046463	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere	Metagenome	Rhizosphere
152	3300046476	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere	Metagenome	Rhizosphere
153	3300046477	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere	Metagenome	Rhizosphere
154	3300046491	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere	Metagenome	Rhizosphere
155	3300046511	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere	Metagenome	Rhizosphere
156	3300046514	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere	Metagenome	Rhizosphere
157	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
158	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
159	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
160	3300046533	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere	Metagenome	Rhizosphere
161	3300046536	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere	Metagenome	Rhizosphere
162	3300046537	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere	Metagenome	Rhizosphere
163	3300046543	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere	Metagenome	Rhizosphere
164	3300046559	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere	Metagenome	Rhizosphere
165	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
166	3300046642	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere	Metagenome	Rhizosphere
167	3300046663	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere	Metagenome	Rhizosphere
168	3300046675	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere	Metagenome	Rhizosphere
169	3300046678	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere	Metagenome	Rhizosphere
170	3300046679	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere	Metagenome	Rhizosphere
171	3300046680	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere	Metagenome	Rhizosphere
172	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
173	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
174	3300046690	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere	Metagenome	Rhizosphere
175	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
176	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
177	3300047318	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere	Metagenome	Rhizosphere
178	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
179	3300047320	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere	Metagenome	Rhizosphere
180	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
181	3300047444	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere	Metagenome	Rhizosphere
182	3300047471	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere	Metagenome	Rhizosphere
183	3300047673	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere	Metagenome	Rhizosphere
184	3300048088	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere	Metagenome	Rhizosphere
185	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
186	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
187	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
188	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
189	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
190	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
191	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
192	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
193	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
194	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
195	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
196	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
197	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
198	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
199	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
200	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
201	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
202	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
203	3300049583	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01	Metagenome	Rhizosphere
204	3300049585	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03	Metagenome	Rhizosphere
205	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
206	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
207	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
208	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
209	3300049591	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03	Metagenome	Rhizosphere
210	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
211	3300049593	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02	Metagenome	Rhizosphere
212	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
213	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
214	3300049743	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03	Metagenome	Rhizosphere
215	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
216	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
217	3300050489	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation	Metagenome	Endosphere
218	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
219	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
220	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
221	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
222	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
223	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
224	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
225	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
226	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
227	3300050514	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation	Metagenome	Rhizosphere
228	3300050516	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation	Metagenome	Endosphere
229	3300053077	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere	Metagenome	Rhizosphere
230	3300053078	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere	Metagenome	Rhizosphere
231	3300053083	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere	Metagenome	Rhizosphere
232	3300053084	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere	Metagenome	Rhizosphere
233	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
234	3300053098	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere	Metagenome	Endosphere
235	3300053131	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere	Metagenome	Endosphere
236	3300053153	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere	Metagenome	Endosphere
237	3300053158	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere	Metagenome	Endosphere
238	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
239	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
240	3300061734	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2)	Metagenome	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	99.74
Metatranscriptomes	0.26
Isolates	0

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	6.6
Nodule	0
Rhizoplane	5.01
Rhizosphere	87.07
Stem	0
Stem Tuber	0
Unclassified	1.32

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI25406J46586_10003557	3300003203	Bacteria	7304
2	JGI25153J46596_10010031	3300003215	Bacteria	4323
3	rootH1_10047050	3300003323	Bacteria	2888
4	JGI25404J52841_10007040	3300003659	Bacteria	2368
5	Ga0065715_10182881	3300005293	Bacteria	1428
6	Ga0065707_10095885	3300005295	Bacteria	3323
7	Ga0070658_10044726	3300005327	Bacteria	3579
8	Ga0070658_10106811	3300005327	Bacteria	2316
9	Ga0070676_10015775	3300005328	Bacteria	4168
10	Ga0070670_100039077	3300005331	Bacteria	4080
11	Ga0070677_10002349	3300005333	Bacteria	6046
12	Ga0068869_100242293	3300005334	Bacteria	1437
13	Ga0070680_100082134	3300005336	Bacteria	2659
14	Ga0068868_100239230	3300005338	Bacteria	1525
15	Ga0070660_100019473	3300005339	Bacteria	4974
16	Ga0070689_100201970	3300005340	Bacteria	1623
17	Ga0070689_100217074	3300005340	Bacteria	1567
18	Ga0070689_100321103	3300005340	Bacteria	1293
19	Ga0070691_10083745	3300005341	Bacteria	1565
20	Ga0070687_100101633	3300005343	Bacteria	1611
21	Ga0070661_100103947	3300005344	Bacteria	2116
22	Ga0070669_100089744	3300005353	Bacteria	2303
23	Ga0070671_100005517	3300005355	Bacteria	10077
24	Ga0070674_100013404	3300005356	Bacteria	5067
25	Ga0070673_100111293	3300005364	Bacteria	2271
26	Ga0070673_100404981	3300005364	Bacteria	1220
27	Ga0070688_100057793	3300005365	Bacteria	2440
28	Ga0070714_100147070	3300005435	Bacteria	2120
29	Ga0070713_100433107	3300005436	Bacteria	1232
30	Ga0070710_10120640	3300005437	Bacteria	1587
31	Ga0070678_100008678	3300005456	Bacteria	6099
32	Ga0070662_100204330	3300005457	Bacteria	1569
33	Ga0070681_10201755	3300005458	Bacteria	1907
34	Ga0070681_10298308	3300005458	Bacteria	1522
35	Ga0068867_100090898	3300005459	Bacteria	2316
36	Ga0070679_100230746	3300005530	Bacteria	1810
37	Ga0070684_100292946	3300005535	Bacteria	1492
38	Ga0070672_100031326	3300005543	Bacteria	4002
39	Ga0070672_100307539	3300005543	Bacteria	1345
40	Ga0068855_100034984	3300005563	Bacteria	5986
41	Ga0068855_100062963	3300005563	Bacteria	4329
42	Ga0068855_100240590	3300005563	Bacteria	2023
43	Ga0068852_100021410	3300005616	Bacteria	5162
44	Ga0068852_100065016	3300005616	Bacteria	3181
45	Ga0068859_100189524	3300005617	Bacteria	2141
46	Ga0068864_100085739	3300005618	Bacteria	2769
47	Ga0068861_100336497	3300005719	Bacteria	1320
48	Ga0081455_10000086	3300005937	Bacteria	101126
49	Ga0081455_10060907	3300005937	Bacteria	3179
50	Ga0081455_10187871	3300005937	Bacteria	1559
51	Ga0081540_1000282	3300005983	Bacteria	52922
52	Ga0081539_10001225	3300005985	Bacteria	45858
53	Ga0070717_10037763	3300006028	Bacteria	3923
54	Ga0075365_10006860	3300006038	Bacteria	6317
55	Ga0075365_10171098	3300006038	Bacteria	1516
56	Ga0075364_10024792	3300006051	Bacteria	3812
57	Ga0075362_10010665	3300006177	Bacteria	3595
58	Ga0075362_10018894	3300006177	Bacteria	2860
59	Ga0075367_10016011	3300006178	Bacteria	4089
60	Ga0075369_10020170	3300006186	Bacteria	2729
61	Ga0075369_10041972	3300006186	Bacteria	1959
62	Ga0075366_10031366	3300006195	Bacteria	3127
63	Ga0075366_10058196	3300006195	Bacteria	2296
64	Ga0097621_100087400	3300006237	Bacteria	2603
65	Ga0097621_100090024	3300006237	Bacteria	2567
66	Ga0068871_100091527	3300006358	Bacteria	2535
67	Ga0075428_100002292	3300006844	Bacteria	20711
68	Ga0075428_100009523	3300006844	Bacteria	10786
69	Ga0075428_100278392	3300006844	Bacteria	1800
70	Ga0075428_100284921	3300006844	Bacteria	1777
71	Ga0075430_100093993	3300006846	Bacteria	2506
72	Ga0075431_100000098	3300006847	Bacteria	54303
73	Ga0075431_100153139	3300006847	Bacteria	2373
74	Ga0075434_100127882	3300006871	Bacteria	2558
75	Ga0075434_100168876	3300006871	Bacteria	2208
76	Ga0075429_100005098	3300006880	Bacteria	11295
77	Ga0097620_100189530	3300006931	Bacteria	2141
78	Ga0099794_10014506	3300007265	Bacteria	3454
79	Ga0105240_10039692	3300009093	Bacteria	6026
80	Ga0105240_10492608	3300009093	Bacteria	1364
81	Ga0111539_10000703	3300009094	Bacteria	43347
82	Ga0111539_10053501	3300009094	Bacteria	4805
83	Ga0105245_10161548	3300009098	Bacteria	2126
84	Ga0105245_10455249	3300009098	Bacteria	1289
85	Ga0114129_10000057	3300009147	Bacteria	99258
86	Ga0114129_10224105	3300009147	Bacteria	2535
87	Ga0105242_10169871	3300009176	Bacteria	1915
88	Ga0105248_10016879	3300009177	Bacteria	8038
89	Ga0105248_10041324	3300009177	Bacteria	5169
90	Ga0105237_10103446	3300009545	Bacteria	2840
91	Ga0105238_10073752	3300009551	Bacteria	3407
92	Ga0105238_10293999	3300009551	Bacteria	1607
93	Ga0157370_10280485	3300013104	Bacteria	1540
94	Ga0157369_10229582	3300013105	Bacteria	1941
95	Ga0157374_10370960	3300013296	Bacteria	1424
96	Ga0157372_10230629	3300013307	Bacteria	2146
97	Ga0163163_10375625	3300014325	Bacteria	1479
98	Ga0163163_10609960	3300014325	Bacteria	1154
99	Ga0157380_10123754	3300014326	Bacteria	2195
100	Ga0157380_10461456	3300014326	Bacteria	1223
101	Ga0157376_10370949	3300014969	Bacteria	1376
102	Ga0213876_10020461	3300021384	Bacteria	3497
103	Ga0209758_1000294	3300025297	Bacteria	98618
104	Ga0207682_10003835	3300025893	Bacteria	6453
105	Ga0207680_10097843	3300025903	Bacteria	1879
106	Ga0207647_10036481	3300025904	Bacteria	3123
107	Ga0207705_10059241	3300025909	Bacteria	2763
108	Ga0207707_10381633	3300025912	Bacteria	1211
109	Ga0207671_10038318	3300025914	Bacteria	3552
110	Ga0207693_10152327	3300025915	Bacteria	1819
111	Ga0207662_10167017	3300025918	Bacteria	1409
112	Ga0207657_10012765	3300025919	Bacteria	8273
113	Ga0207681_10092949	3300025923	Bacteria	2158
114	Ga0207681_10331908	3300025923	Bacteria	1212
115	Ga0207694_10320177	3300025924	Bacteria	1280
116	Ga0207650_10002592	3300025925	Bacteria	12508
117	Ga0207659_10363736	3300025926	Bacteria	1203
118	Ga0207687_10020336	3300025927	Bacteria	4403
119	Ga0207687_10286250	3300025927	Bacteria	1323
120	Ga0207644_10054130	3300025931	Bacteria	2889
121	Ga0207644_10073623	3300025931	Bacteria	2505
122	Ga0207706_10013337	3300025933	Bacteria	7475
123	Ga0207686_10274195	3300025934	Bacteria	1242
124	Ga0207709_10109774	3300025935	Bacteria	1842
125	Ga0207670_10032243	3300025936	Bacteria	3367
126	Ga0207669_10023271	3300025937	Bacteria	3306
127	Ga0207669_10104198	3300025937	Bacteria	1883
128	Ga0207665_10249779	3300025939	Bacteria	1310
129	Ga0207691_10021364	3300025940	Bacteria	6113
130	Ga0207691_10153268	3300025940	Bacteria	2026
131	Ga0207711_10017468	3300025941	Bacteria	5960
132	Ga0207711_10152673	3300025941	Bacteria	2085
133	Ga0207711_10199726	3300025941	Bacteria	1824
134	Ga0207667_10013288	3300025949	Bacteria	9430
135	Ga0207667_10028603	3300025949	Bacteria	6052
136	Ga0207651_10076456	3300025960	Bacteria	2393
137	Ga0207712_10123005	3300025961	Bacteria	1966
138	Ga0207712_10286110	3300025961	Bacteria	1347
139	Ga0207658_10210559	3300025986	Bacteria	1629
140	Ga0207677_10057342	3300026023	Bacteria	2674
141	Ga0207678_10102626	3300026067	Bacteria	2441
142	Ga0207641_10160277	3300026088	Bacteria	2045
143	Ga0207676_10129965	3300026095	Bacteria	2140
144	Ga0207676_10172520	3300026095	Bacteria	1886
145	Ga0207676_10178879	3300026095	Bacteria	1855
146	Ga0207674_10243211	3300026116	Bacteria	1746
147	Ga0207675_100071219	3300026118	Bacteria	3250
148	Ga0209179_1003241	3300027512	Bacteria	2319
149	Ga0207428_10003301	3300027907	Bacteria	15690
150	Ga0265357_1004147	3300028023	Bacteria	1292
151	Ga0268266_10180359	3300028379	Bacteria	1922
152	Ga0265318_10095659	3300028577	Bacteria	1093
153	Ga0265763_1001782	3300030763	Bacteria	1584
154	Ga0265330_10095655	3300031235	Bacteria	1273
155	Ga0265325_10004090	3300031241	Bacteria	9294
156	Ga0265325_10090719	3300031241	Bacteria	1507
157	Ga0265329_10038639	3300031242	Bacteria	1535
158	Ga0265339_10038327	3300031249	Bacteria	2675
159	Ga0265339_10080423	3300031249	Bacteria	1723
160	Ga0265316_10239768	3300031344	Bacteria	1333
161	Ga0307513_10267710	3300031456	Bacteria	1494
162	Ga0265313_10014983	3300031595	Bacteria	4547
163	Ga0265314_10230331	3300031711	Bacteria	1075
164	Ga0265342_10001257	3300031712	Bacteria	23945
165	Ga0265342_10184936	3300031712	Bacteria	1139
166	Ga0373923_0001039	3300035111	Bacteria	7579
167	Ga0373923_0015452	3300035111	Bacteria	2883
168	Ga0373936_0001685	3300035113	Bacteria	8099
169	Ga0373941_0026450	3300035115	Bacteria	1685
170	Ga0373945_0002265	3300035116	Bacteria	6023
171	Ga0373953_0032763	3300035117	Bacteria	2029
172	Ga0373953_0063210	3300035117	Bacteria	1517
173	Ga0373954_0000707	3300035118	Bacteria	12831
174	Ga0373954_0026099	3300035118	Bacteria	2676
175	Ga0373956_0022485	3300035119	Bacteria	2699
176	Ga0373956_0031805	3300035119	Bacteria	2314
177	Ga0373956_0038223	3300035119	Bacteria	2123
178	Ga0373943_0000997	3300035170	Bacteria	12584
179	Ga0373943_0022838	3300035170	Bacteria	2904
180	Ga0373946_0001728	3300035171	Bacteria	7617
181	Ga0373955_0000527	3300035172	Bacteria	16159
182	Ga0373955_0030660	3300035172	Bacteria	2810
183	Ga0373955_0080528	3300035172	Bacteria	1839
184	Ga0373924_0001735	3300035410	Bacteria	7200
185	Ga0373924_0024602	3300035410	Bacteria	2374
186	Ga0373931_0005062	3300035691	Bacteria	6063
187	Ga0373931_0065255	3300035691	Bacteria	1973
188	Ga0373935_0000377	3300035692	Bacteria	22883
189	Ga0373935_0048322	3300035692	Bacteria	2694
190	Ga0373935_0251828	3300035692	Bacteria	1236
191	Ga0373927_0020277	3300035695	Bacteria	4360
192	Ga0373927_0039625	3300035695	Bacteria	3058
193	Ga0373933_0001289	3300035724	Bacteria	14771
194	Ga0373933_0012005	3300035724	Bacteria	4783
195	Ga0373933_0082504	3300035724	Bacteria	1973
196	Ga0373947_0002269	3300035725	Bacteria	11620
197	Ga0373947_0038117	3300035725	Bacteria	2854
198	Ga0373947_0050304	3300035725	Bacteria	2506
199	Ga0373947_0058501	3300035725	Bacteria	2336
200	Ga0373937_0001849	3300036401	Bacteria	17776
201	Ga0373937_0011217	3300036401	Bacteria	7856
202	Ga0373937_0281771	3300036401	Bacteria	1570
203	Ga0373925_0000075	3300037068	Bacteria	105395
204	Ga0373925_0100688	3300037068	Bacteria	2221
205	Ga0373925_0169104	3300037068	Bacteria	1725
206	Ga0436365_0346127	3300039437	Bacteria	1481
207	Ga0436360_0239240	3300039438	Bacteria	1752
208	Ga0439453_0002565	3300041408	Bacteria	2518
209	Ga0439453_0005002	3300041408	Bacteria	2000
210	Ga0439443_003797	3300042003	Bacteria	1932
211	Ga0439446_0017046	3300042156	Bacteria	2028
212	Ga0466967_0238073	3300045976	Bacteria	1735
213	Ga0495592_0000060	3300046454	Bacteria	100113
214	Ga0495592_0003744	3300046454	Bacteria	10970
215	Ga0495629_0006448	3300046459	Bacteria	8696
216	Ga0495629_0006772	3300046459	Bacteria	8470
217	Ga0495638_0005811	3300046460	Bacteria	9073
218	Ga0495651_0000181	3300046462	Bacteria	46803
219	Ga0495651_0000289	3300046462	Bacteria	38999
220	Ga0495653_0000806	3300046463	Bacteria	24083
221	Ga0495653_0005761	3300046463	Bacteria	10144
222	Ga0495662_0006253	3300046476	Bacteria	5953
223	Ga0495662_0043100	3300046476	Bacteria	2179
224	Ga0495662_0058034	3300046476	Bacteria	1870
225	Ga0495664_0000003	3300046477	Bacteria	551602
226	Ga0495664_0004736	3300046477	Bacteria	7435
227	Ga0495584_0006384	3300046491	Bacteria	6177
228	Ga0495608_0000005	3300046511	Bacteria	350726
229	Ga0495608_0009841	3300046511	Bacteria	6672
230	Ga0495608_0089730	3300046511	Bacteria	1989
231	Ga0495618_0000044	3300046514	Bacteria	95526
232	Ga0495618_0001553	3300046514	Bacteria	15406
233	Ga0495618_0022574	3300046514	Bacteria	3887
234	Ga0495628_0000001	3300046516	Bacteria	917742
235	Ga0495628_0108218	3300046516	Bacteria	2140
236	Ga0495628_0150577	3300046516	Bacteria	1773
237	Ga0495630_0000574	3300046517	Bacteria	26824
238	Ga0495630_0185791	3300046517	Bacteria	1586
239	Ga0495652_0000002	3300046529	Bacteria	946606
240	Ga0495652_0009716	3300046529	Bacteria	8725
241	Ga0495640_0000001	3300046533	Bacteria	853827
242	Ga0495587_0000001	3300046536	Bacteria	724132
243	Ga0495587_0002135	3300046536	Bacteria	13224
244	Ga0495587_0148623	3300046536	Bacteria	1335
245	Ga0495598_0049998	3300046537	Unclassified	1255
246	Ga0495645_0000002	3300046543	Bacteria	651644
247	Ga0495645_0007583	3300046543	Bacteria	7549
248	Ga0495667_0000039	3300046559	Bacteria	131308
249	Ga0495667_0000975	3300046559	Bacteria	18505
250	Ga0495668_0218042	3300046616	Bacteria	1045
251	Ga0495634_0000010	3300046642	Bacteria	143792
252	Ga0495634_0008760	3300046642	Bacteria	7499
253	Ga0495635_0000001	3300046663	Bacteria	704901
254	Ga0495635_0002814	3300046663	Bacteria	11938
255	Ga0495635_0103536	3300046663	Bacteria	1945
256	Ga0495657_0000042	3300046675	Bacteria	114669
257	Ga0495657_0022696	3300046675	Bacteria	4491
258	Ga0495599_0000013	3300046678	Bacteria	179828
259	Ga0495599_0004454	3300046678	Bacteria	8291
260	Ga0495623_0000050	3300046679	Bacteria	72959
261	Ga0495623_0002373	3300046679	Bacteria	12519
262	Ga0495623_0010993	3300046679	Bacteria	5858
263	Ga0495646_0000009	3300046680	Bacteria	200698
264	Ga0495646_0002725	3300046680	Bacteria	10917
265	Ga0495658_0042127	3300046683	Bacteria	2548
266	Ga0495613_0135929	3300046689	Bacteria	1759
267	Ga0495624_0016942	3300046690	Bacteria	4901
268	Ga0495624_0033657	3300046690	Bacteria	3319
269	Ga0495600_0000035	3300046809	Bacteria	80552
270	Ga0495600_0005141	3300046809	Bacteria	7865
271	Ga0495604_0000069	3300047317	Bacteria	89935
272	Ga0495604_0005786	3300047317	Bacteria	9809
273	Ga0495604_0069660	3300047317	Bacteria	2665
274	Ga0495636_0067344	3300047318	Bacteria	1524
275	Ga0495674_0000002	3300047319	Bacteria	642785
276	Ga0495674_0002160	3300047319	Bacteria	19306
277	Ga0495674_0157149	3300047319	Bacteria	1904
278	Ga0495672_0057338	3300047320	Bacteria	2263
279	Ga0495680_0000328	3300047322	Bacteria	53287
280	Ga0495680_0002022	3300047322	Bacteria	21271
281	Ga0495680_0045774	3300047322	Bacteria	3453
282	Ga0495680_0325752	3300047322	Bacteria	1074
283	Ga0495675_0000245	3300047444	Bacteria	39142
284	Ga0495675_0030636	3300047444	Bacteria	3432
285	Ga0495684_0000016	3300047471	Bacteria	169338
286	Ga0495684_0036598	3300047471	Bacteria	3762
287	Ga0495593_0001500	3300047673	Bacteria	13713
288	Ga0495593_0011263	3300047673	Bacteria	5140
289	Ga0495602_0000024	3300048088	Bacteria	151162
290	Ga0495602_0014816	3300048088	Bacteria	7894
291	Ga0495602_0059793	3300048088	Bacteria	3324
292	Ga0495602_0113020	3300048088	Bacteria	2202
293	Ga0496101_0005706	3300048904	Bacteria	7948
294	Ga0496101_0173844	3300048904	Bacteria	1656
295	Ga0496104_0002306	3300048907	Bacteria	16475
296	Ga0496106_0074089	3300048909	Bacteria	2606
297	Ga0496106_0226136	3300048909	Bacteria	1493
298	Ga0496107_0117613	3300048910	Bacteria	1957
299	Ga0496108_0034755	3300048911	Bacteria	4187
300	Ga0496108_0136627	3300048911	Bacteria	2110
301	Ga0496109_0049616	3300048912	Bacteria	3822
302	Ga0496110_0005741	3300048913	Bacteria	9749
303	Ga0496110_0038228	3300048913	Bacteria	4175
304	Ga0496110_0325622	3300048913	Bacteria	1400
305	Ga0496111_0183116	3300048914	Bacteria	1557
306	Ga0496111_0228985	3300048914	Bacteria	1381
307	Ga0496112_0003916	3300048915	Bacteria	12459
308	Ga0496112_0171095	3300048915	Bacteria	2137
309	Ga0496113_0032273	3300048916	Bacteria	3806
310	Ga0496114_0368226	3300048917	Bacteria	1272
311	Ga0496115_0142874	3300048918	Bacteria	1974
312	Ga0496126_0437984	3300048929	Bacteria	1054
313	Ga0501034_0112174	3300049571	Bacteria	2717
314	Ga0501038_0052435	3300049574	Bacteria	3517
315	Ga0501042_0097525	3300049578	Bacteria	2113
316	Ga0501046_0234786	3300049580	Bacteria	1354
317	Ga0501047_0014411	3300049581	Bacteria	7517
318	Ga0501047_0071616	3300049581	Bacteria	3336
319	Ga0501047_0122943	3300049581	Bacteria	2476
320	Ga0501067_0092686	3300049583	Bacteria	1677
321	Ga0501069_0025795	3300049585	Bacteria	3214
322	Ga0501070_0006598	3300049586	Bacteria	9876
323	Ga0501071_0023476	3300049587	Bacteria	4308
324	Ga0501072_0333285	3300049588	Bacteria	1205
325	Ga0501073_0202075	3300049589	Bacteria	1374
326	Ga0501075_0034246	3300049591	Bacteria	3781
327	Ga0501076_0022833	3300049592	Bacteria	4813
328	Ga0501076_0031251	3300049592	Bacteria	4152
329	Ga0501077_0006570	3300049593	Bacteria	7140
330	Ga0501079_0162114	3300049741	Bacteria	1744
331	Ga0501080_0402588	3300049742	Bacteria	1231
332	Ga0501081_0010927	3300049743	Bacteria	5934
333	Ga0501083_0039235	3300049744	Bacteria	3216
334	Ga0501083_0084382	3300049744	Bacteria	2103
335	Ga0501044_0005514	3300049823	Bacteria	14047
336	nmdc:mga03683_46162_c1	3300050489	Bacteria	1805
337	nmdc:mga03683_65095_c1	3300050489	Bacteria	1548
338	nmdc:mga00v17_13952_c1	3300050491	Bacteria	4473
339	nmdc:mga00v17_75052_c1	3300050491	Bacteria	2102
340	nmdc:mga0k408_1498_c1	3300050493	Bacteria	12606
341	nmdc:mga0k408_28451_c1	3300050493	Bacteria	3178
342	nmdc:mga06z11_53020_c1	3300050494	Bacteria	2084
343	nmdc:mga05p37_2362_c1	3300050507	Bacteria	21952
344	nmdc:mga09592_2450_c1	3300050508	Bacteria	14966
345	nmdc:mga0qj67_102841_c1	3300050509	Bacteria	2304
346	nmdc:mga06r32_1073_c1	3300050510	Bacteria	24549
347	nmdc:mga06r32_72212_c1	3300050510	Bacteria	3341
348	nmdc:mga08y16_107_c1	3300050511	Bacteria	69847
349	nmdc:mga08y16_18961_c1	3300050511	Bacteria	7244
350	nmdc:mga08y16_231773_c1	3300050511	Bacteria	1910
351	nmdc:mga0n895_101911_c1	3300050512	Bacteria	2881
352	nmdc:mga08x19_265480_c1	3300050514	Bacteria	1187
353	nmdc:mga0sz30_23676_c1	3300050516	Bacteria	2501
354	Ga0495601_0000001	3300053077	Bacteria	549454
355	Ga0495601_0000942	3300053077	Bacteria	15829
356	Ga0495601_0020958	3300053077	Bacteria	3997
357	Ga0495612_0000017	3300053078	Bacteria	152112
358	Ga0495612_0012710	3300053078	Bacteria	3393
359	Ga0495612_0018106	3300053078	Bacteria	2819
360	Ga0495655_0005292	3300053083	Bacteria	2271
361	Ga0495595_0000010	3300053084	Bacteria	178819
362	Ga0495595_0002486	3300053084	Bacteria	7219
363	Ga0495595_0004254	3300053084	Bacteria	5756
364	Ga0495595_0033792	3300053084	Bacteria	2310
365	Ga0495619_0000004	3300053085	Bacteria	500068
366	Ga0495619_0000968	3300053085	Bacteria	18820
367	Ga0495619_0022990	3300053085	Bacteria	3992
368	Ga0495619_0096937	3300053085	Bacteria	2003
369	Ga0500650_0016000	3300053098	Bacteria	3208
370	Ga0500652_000029	3300053131	Bacteria	91212
371	Ga0500616_0011582	3300053153	Bacteria	5199
372	Ga0500616_0053490	3300053153	Bacteria	2118
373	Ga0500627_0120231	3300053158	Bacteria	1185
374	Ga0501084_0112317	3300054114	Bacteria	2290
375	Ga0501084_0132280	3300054114	Bacteria	2100
376	Ga0501082_0003928	3300060353	Bacteria	12975
377	Ga0501082_0016298	3300060353	Bacteria	6397
378	Ga0501082_0107764	3300060353	Bacteria	2410
379	Ga0530510_0121420	3300061734	Bacteria	1918

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300025939	Ga0207665_10249779	Ga0207665_102497792	279
2	3300005937	Ga0081455_10187871	Ga0081455_101878713	281
3	3300009147	Ga0114129_10224105	Ga0114129_102241052	296
4	3300046537	Ga0495598_0049998	Ga0495598_0049998_52_1035	303
5	3300035724	Ga0373933_0082504	Ga0373933_0082504_1011_1928	304
6	3300006844	Ga0075428_100002292	Ga0075428_10000229216	308
7	3300006847	Ga0075431_100000098	Ga0075431_10000009818	308
8	3300006880	Ga0075429_100005098	Ga0075429_10000509815	308
9	3300009094	Ga0111539_10000703	Ga0111539_1000070324	308
10	3300009147	Ga0114129_10000057	Ga0114129_1000005717	308
11	3300027907	Ga0207428_10003301	Ga0207428_1000330112	308
12	3300050507	nmdc:mga05p37_2362_c1	nmdc:mga05p37_2362_c1_709_1692	308
13	3300050508	nmdc:mga09592_2450_c1	nmdc:mga09592_2450_c1_13360_14343	308
14	3300050510	nmdc:mga06r32_1073_c1	nmdc:mga06r32_1073_c1_10868_11851	308
15	3300050511	nmdc:mga08y16_107_c1	nmdc:mga08y16_107_c1_8264_9247	308
16	3300053077	Ga0495601_0000942	Ga0495601_0000942_14887_15813	308
17	3300047322	Ga0495680_0325752	Ga0495680_0325752_99_1052	309
18	3300053084	Ga0495595_0033792	Ga0495595_0033792_617_1570	309
19	3300035692	Ga0373935_0251828	Ga0373935_0251828_208_1176	321
20	3300035725	Ga0373947_0038117	Ga0373947_0038117_1330_2298	321
21	3300031711	Ga0265314_10230331	Ga0265314_102303311	322
22	3300049744	Ga0501083_0084382	Ga0501083_0084382_35_1018	322
23	3300060353	Ga0501082_0003928	Ga0501082_0003928_11844_12827	322
24	3300005338	Ga0068868_100239230	Ga0068868_1002392302	326
25	3300005340	Ga0070689_100217074	Ga0070689_1002170742	326
26	3300005343	Ga0070687_100101633	Ga0070687_1001016332	326
27	3300005356	Ga0070674_100013404	Ga0070674_1000134045	326
28	3300005543	Ga0070672_100307539	Ga0070672_1003075392	326
29	3300009098	Ga0105245_10161548	Ga0105245_101615482	326
30	3300025918	Ga0207662_10167017	Ga0207662_101670171	326
31	3300025937	Ga0207669_10023271	Ga0207669_100232714	326
32	3300025941	Ga0207711_10199726	Ga0207711_101997263	326
33	3300047318	Ga0495636_0067344	Ga0495636_0067344_483_1463	326
34	3300049585	Ga0501069_0025795	Ga0501069_0025795_2211_3191	326
35	3300003203	JGI25406J46586_10003557	JGI25406J46586_100035572	327
36	3300003215	JGI25153J46596_10010031	JGI25153J46596_100100312	327
37	3300003323	rootH1_10047050	rootH1_100470502	327
38	3300003659	JGI25404J52841_10007040	JGI25404J52841_100070402	327
39	3300005293	Ga0065715_10182881	Ga0065715_101828812	327
40	3300005295	Ga0065707_10095885	Ga0065707_100958852	327
41	3300005327	Ga0070658_10044726	Ga0070658_100447264	327
42	3300005327	Ga0070658_10106811	Ga0070658_101068111	327
43	3300005328	Ga0070676_10015775	Ga0070676_100157755	327
44	3300005331	Ga0070670_100039077	Ga0070670_1000390772	327
45	3300005333	Ga0070677_10002349	Ga0070677_100023496	327
46	3300005334	Ga0068869_100242293	Ga0068869_1002422931	327
47	3300005336	Ga0070680_100082134	Ga0070680_1000821344	327
48	3300005339	Ga0070660_100019473	Ga0070660_1000194736	327
49	3300005340	Ga0070689_100201970	Ga0070689_1002019701	327
50	3300005340	Ga0070689_100321103	Ga0070689_1003211031	327
51	3300005341	Ga0070691_10083745	Ga0070691_100837452	327
52	3300005344	Ga0070661_100103947	Ga0070661_1001039473	327
53	3300005353	Ga0070669_100089744	Ga0070669_1000897443	327
54	3300005355	Ga0070671_100005517	Ga0070671_1000055177	327
55	3300005364	Ga0070673_100111293	Ga0070673_1001112932	327
56	3300005364	Ga0070673_100404981	Ga0070673_1004049811	327
57	3300005365	Ga0070688_100057793	Ga0070688_1000577933	327
58	3300005435	Ga0070714_100147070	Ga0070714_1001470703	327
59	3300005436	Ga0070713_100433107	Ga0070713_1004331071	327
60	3300005437	Ga0070710_10120640	Ga0070710_101206402	327
61	3300005456	Ga0070678_100008678	Ga0070678_1000086784	327
62	3300005457	Ga0070662_100204330	Ga0070662_1002043302	327
63	3300005458	Ga0070681_10201755	Ga0070681_102017552	327
64	3300005458	Ga0070681_10298308	Ga0070681_102983081	327
65	3300005459	Ga0068867_100090898	Ga0068867_1000908982	327
66	3300005530	Ga0070679_100230746	Ga0070679_1002307462	327
67	3300005535	Ga0070684_100292946	Ga0070684_1002929462	327
68	3300005543	Ga0070672_100031326	Ga0070672_1000313264	327
69	3300005563	Ga0068855_100034984	Ga0068855_1000349844	327
70	3300005563	Ga0068855_100062963	Ga0068855_1000629633	327
71	3300005563	Ga0068855_100240590	Ga0068855_1002405902	327
72	3300005616	Ga0068852_100021410	Ga0068852_1000214106	327
73	3300005616	Ga0068852_100065016	Ga0068852_1000650164	327
74	3300005617	Ga0068859_100189524	Ga0068859_1001895241	327
75	3300005618	Ga0068864_100085739	Ga0068864_1000857393	327
76	3300005719	Ga0068861_100336497	Ga0068861_1003364971	327
77	3300005937	Ga0081455_10000086	Ga0081455_1000008655	327
78	3300005937	Ga0081455_10060907	Ga0081455_100609073	327
79	3300005983	Ga0081540_1000282	Ga0081540_10002829	327
80	3300005985	Ga0081539_10001225	Ga0081539_1000122528	327
81	3300006028	Ga0070717_10037763	Ga0070717_100377632	327
82	3300006038	Ga0075365_10006860	Ga0075365_100068602	327
83	3300006038	Ga0075365_10171098	Ga0075365_101710982	327
84	3300006051	Ga0075364_10024792	Ga0075364_100247923	327
85	3300006177	Ga0075362_10010665	Ga0075362_100106653	327
86	3300006177	Ga0075362_10018894	Ga0075362_100188942	327
87	3300006178	Ga0075367_10016011	Ga0075367_100160114	327
88	3300006186	Ga0075369_10020170	Ga0075369_100201703	327
89	3300006186	Ga0075369_10041972	Ga0075369_100419722	327
90	3300006195	Ga0075366_10031366	Ga0075366_100313663	327
91	3300006195	Ga0075366_10058196	Ga0075366_100581962	327
92	3300006237	Ga0097621_100087400	Ga0097621_1000874002	327
93	3300006237	Ga0097621_100090024	Ga0097621_1000900242	327
94	3300006358	Ga0068871_100091527	Ga0068871_1000915272	327
95	3300006844	Ga0075428_100009523	Ga0075428_1000095237	327
96	3300006844	Ga0075428_100278392	Ga0075428_1002783922	327
97	3300006844	Ga0075428_100284921	Ga0075428_1002849211	327
98	3300006846	Ga0075430_100093993	Ga0075430_1000939933	327
99	3300006847	Ga0075431_100153139	Ga0075431_1001531392	327
100	3300006871	Ga0075434_100127882	Ga0075434_1001278822	327
101	3300006871	Ga0075434_100168876	Ga0075434_1001688762	327
102	3300006931	Ga0097620_100189530	Ga0097620_1001895301	327
103	3300007265	Ga0099794_10014506	Ga0099794_100145062	327
104	3300009093	Ga0105240_10039692	Ga0105240_100396928	327
105	3300009093	Ga0105240_10492608	Ga0105240_104926082	327
106	3300009094	Ga0111539_10053501	Ga0111539_100535015	327
107	3300009098	Ga0105245_10455249	Ga0105245_104552491	327
108	3300009176	Ga0105242_10169871	Ga0105242_101698713	327
109	3300009177	Ga0105248_10016879	Ga0105248_100168798	327
110	3300009177	Ga0105248_10041324	Ga0105248_100413244	327
111	3300009545	Ga0105237_10103446	Ga0105237_101034462	327
112	3300009551	Ga0105238_10073752	Ga0105238_100737522	327
113	3300009551	Ga0105238_10293999	Ga0105238_102939992	327
114	3300013104	Ga0157370_10280485	Ga0157370_102804852	327
115	3300013105	Ga0157369_10229582	Ga0157369_102295821	327
116	3300013296	Ga0157374_10370960	Ga0157374_103709601	327
117	3300013307	Ga0157372_10230629	Ga0157372_102306292	327
118	3300014325	Ga0163163_10375625	Ga0163163_103756252	327
119	3300014325	Ga0163163_10609960	Ga0163163_106099601	327
120	3300014326	Ga0157380_10123754	Ga0157380_101237542	327
121	3300014326	Ga0157380_10461456	Ga0157380_104614562	327
122	3300014969	Ga0157376_10370949	Ga0157376_103709492	327
123	3300021384	Ga0213876_10020461	Ga0213876_100204614	327
124	3300025297	Ga0209758_1000294	Ga0209758_100029489	327
125	3300025893	Ga0207682_10003835	Ga0207682_100038351	327
126	3300025903	Ga0207680_10097843	Ga0207680_100978432	327
127	3300025904	Ga0207647_10036481	Ga0207647_100364813	327
128	3300025909	Ga0207705_10059241	Ga0207705_100592412	327
129	3300025912	Ga0207707_10381633	Ga0207707_103816331	327
130	3300025914	Ga0207671_10038318	Ga0207671_100383182	327
131	3300025915	Ga0207693_10152327	Ga0207693_101523272	327
132	3300025919	Ga0207657_10012765	Ga0207657_100127656	327
133	3300025923	Ga0207681_10092949	Ga0207681_100929492	327
134	3300025923	Ga0207681_10331908	Ga0207681_103319081	327
135	3300025924	Ga0207694_10320177	Ga0207694_103201772	327
136	3300025925	Ga0207650_10002592	Ga0207650_100025929	327
137	3300025926	Ga0207659_10363736	Ga0207659_103637362	327
138	3300025927	Ga0207687_10020336	Ga0207687_100203362	327
139	3300025927	Ga0207687_10286250	Ga0207687_102862501	327
140	3300025931	Ga0207644_10054130	Ga0207644_100541302	327
141	3300025931	Ga0207644_10073623	Ga0207644_100736233	327
142	3300025933	Ga0207706_10013337	Ga0207706_100133377	327
143	3300025934	Ga0207686_10274195	Ga0207686_102741952	327
144	3300025935	Ga0207709_10109774	Ga0207709_101097743	327
145	3300025936	Ga0207670_10032243	Ga0207670_100322432	327
146	3300025937	Ga0207669_10104198	Ga0207669_101041983	327
147	3300025940	Ga0207691_10021364	Ga0207691_100213641	327
148	3300025940	Ga0207691_10153268	Ga0207691_101532683	327
149	3300025941	Ga0207711_10017468	Ga0207711_100174684	327
150	3300025941	Ga0207711_10152673	Ga0207711_101526732	327
151	3300025949	Ga0207667_10013288	Ga0207667_100132887	327
152	3300025949	Ga0207667_10028603	Ga0207667_100286035	327
153	3300025960	Ga0207651_10076456	Ga0207651_100764561	327
154	3300025961	Ga0207712_10123005	Ga0207712_101230052	327
155	3300025961	Ga0207712_10286110	Ga0207712_102861102	327
156	3300025986	Ga0207658_10210559	Ga0207658_102105592	327
157	3300026023	Ga0207677_10057342	Ga0207677_100573422	327
158	3300026067	Ga0207678_10102626	Ga0207678_101026263	327
159	3300026088	Ga0207641_10160277	Ga0207641_101602772	327
160	3300026095	Ga0207676_10129965	Ga0207676_101299652	327
161	3300026095	Ga0207676_10172520	Ga0207676_101725203	327
162	3300026095	Ga0207676_10178879	Ga0207676_101788792	327
163	3300026116	Ga0207674_10243211	Ga0207674_102432112	327
164	3300026118	Ga0207675_100071219	Ga0207675_1000712192	327
165	3300027512	Ga0209179_1003241	Ga0209179_10032412	327
166	3300028023	Ga0265357_1004147	Ga0265357_10041471	327
167	3300028379	Ga0268266_10180359	Ga0268266_101803591	327
168	3300028577	Ga0265318_10095659	Ga0265318_100956591	327
169	3300030763	Ga0265763_1001782	Ga0265763_10017821	327
170	3300031235	Ga0265330_10095655	Ga0265330_100956552	327
171	3300031241	Ga0265325_10004090	Ga0265325_100040902	327
172	3300031241	Ga0265325_10090719	Ga0265325_100907193	327
173	3300031242	Ga0265329_10038639	Ga0265329_100386393	327
174	3300031249	Ga0265339_10038327	Ga0265339_100383272	327
175	3300031249	Ga0265339_10080423	Ga0265339_100804232	327
176	3300031344	Ga0265316_10239768	Ga0265316_102397681	327
177	3300031456	Ga0307513_10267710	Ga0307513_102677101	327
178	3300031595	Ga0265313_10014983	Ga0265313_100149832	327
179	3300031712	Ga0265342_10001257	Ga0265342_100012578	327
180	3300031712	Ga0265342_10184936	Ga0265342_101849361	327
181	3300035111	Ga0373923_0001039	Ga0373923_0001039_2300_3283	327
182	3300035111	Ga0373923_0015452	Ga0373923_0015452_726_1709	327
183	3300035113	Ga0373936_0001685	Ga0373936_0001685_6252_7235	327
184	3300035115	Ga0373941_0026450	Ga0373941_0026450_82_1068	327
185	3300035116	Ga0373945_0002265	Ga0373945_0002265_2492_3475	327
186	3300035117	Ga0373953_0032763	Ga0373953_0032763_646_1629	327
187	3300035117	Ga0373953_0063210	Ga0373953_0063210_207_1190	327
188	3300035118	Ga0373954_0000707	Ga0373954_0000707_2814_3797	327
189	3300035118	Ga0373954_0026099	Ga0373954_0026099_1555_2538	327
190	3300035119	Ga0373956_0022485	Ga0373956_0022485_1218_2201	327
191	3300035119	Ga0373956_0031805	Ga0373956_0031805_619_1602	327
192	3300035119	Ga0373956_0038223	Ga0373956_0038223_1063_2046	327
193	3300035170	Ga0373943_0000997	Ga0373943_0000997_7767_8750	327
194	3300035170	Ga0373943_0022838	Ga0373943_0022838_1732_2715	327
195	3300035171	Ga0373946_0001728	Ga0373946_0001728_362_1345	327
196	3300035172	Ga0373955_0000527	Ga0373955_0000527_4732_5715	327
197	3300035172	Ga0373955_0030660	Ga0373955_0030660_1109_2092	327
198	3300035172	Ga0373955_0080528	Ga0373955_0080528_293_1276	327
199	3300035410	Ga0373924_0001735	Ga0373924_0001735_5736_6719	327
200	3300035410	Ga0373924_0024602	Ga0373924_0024602_439_1422	327
201	3300035691	Ga0373931_0005062	Ga0373931_0005062_2769_3755	327
202	3300035691	Ga0373931_0065255	Ga0373931_0065255_101_1087	327
203	3300035692	Ga0373935_0000377	Ga0373935_0000377_8547_9530	327
204	3300035692	Ga0373935_0048322	Ga0373935_0048322_1060_2043	327
205	3300035695	Ga0373927_0020277	Ga0373927_0020277_388_1371	327
206	3300035695	Ga0373927_0039625	Ga0373927_0039625_394_1377	327
207	3300035724	Ga0373933_0001289	Ga0373933_0001289_7973_8956	327
208	3300035724	Ga0373933_0012005	Ga0373933_0012005_547_1530	327
209	3300035725	Ga0373947_0002269	Ga0373947_0002269_1301_2284	327
210	3300035725	Ga0373947_0050304	Ga0373947_0050304_1482_2465	327
211	3300035725	Ga0373947_0058501	Ga0373947_0058501_1273_2256	327
212	3300036401	Ga0373937_0001849	Ga0373937_0001849_1910_2893	327
213	3300036401	Ga0373937_0011217	Ga0373937_0011217_2503_3486	327
214	3300036401	Ga0373937_0281771	Ga0373937_0281771_489_1475	327
215	3300037068	Ga0373925_0000075	Ga0373925_0000075_34810_35793	327
216	3300037068	Ga0373925_0100688	Ga0373925_0100688_770_1753	327
217	3300037068	Ga0373925_0169104	Ga0373925_0169104_176_1159	327
218	3300039437	Ga0436365_0346127	Ga0436365_0346127_483_1466	327
219	3300039438	Ga0436360_0239240	Ga0436360_0239240_85_1068	327
220	3300041408	Ga0439453_0002565	Ga0439453_0002565_1244_2230	327
221	3300041408	Ga0439453_0005002	Ga0439453_0005002_193_1176	327
222	3300042003	Ga0439443_003797	Ga0439443_003797_113_1096	327
223	3300042156	Ga0439446_0017046	Ga0439446_0017046_818_1801	327
224	3300045976	Ga0466967_0238073	Ga0466967_0238073_196_1179	327
225	3300046454	Ga0495592_0000060	Ga0495592_0000060_30724_31707	327
226	3300046454	Ga0495592_0003744	Ga0495592_0003744_7198_8181	327
227	3300046459	Ga0495629_0006448	Ga0495629_0006448_2473_3456	327
228	3300046459	Ga0495629_0006772	Ga0495629_0006772_1009_1992	327
229	3300046460	Ga0495638_0005811	Ga0495638_0005811_6432_7415	327
230	3300046462	Ga0495651_0000181	Ga0495651_0000181_15156_16139	327
231	3300046462	Ga0495651_0000289	Ga0495651_0000289_15695_16678	327
232	3300046463	Ga0495653_0000806	Ga0495653_0000806_20559_21542	327
233	3300046463	Ga0495653_0005761	Ga0495653_0005761_3376_4359	327
234	3300046476	Ga0495662_0006253	Ga0495662_0006253_2083_3066	327
235	3300046476	Ga0495662_0043100	Ga0495662_0043100_219_1202	327
236	3300046476	Ga0495662_0058034	Ga0495662_0058034_703_1686	327
237	3300046477	Ga0495664_0000003	Ga0495664_0000003_52026_53009	327
238	3300046477	Ga0495664_0004736	Ga0495664_0004736_3687_4670	327
239	3300046491	Ga0495584_0006384	Ga0495584_0006384_4433_5416	327
240	3300046511	Ga0495608_0000005	Ga0495608_0000005_1115_2098	327
241	3300046511	Ga0495608_0009841	Ga0495608_0009841_1037_2020	327
242	3300046511	Ga0495608_0089730	Ga0495608_0089730_149_1132	327
243	3300046514	Ga0495618_0000044	Ga0495618_0000044_63859_64842	327
244	3300046514	Ga0495618_0001553	Ga0495618_0001553_11646_12629	327
245	3300046514	Ga0495618_0022574	Ga0495618_0022574_146_1129	327
246	3300046516	Ga0495628_0000001	Ga0495628_0000001_541427_542410	327
247	3300046516	Ga0495628_0108218	Ga0495628_0108218_296_1282	327
248	3300046516	Ga0495628_0150577	Ga0495628_0150577_211_1194	327
249	3300046517	Ga0495630_0000574	Ga0495630_0000574_9324_10307	327
250	3300046517	Ga0495630_0185791	Ga0495630_0185791_80_1066	327
251	3300046529	Ga0495652_0000002	Ga0495652_0000002_755961_756944	327
252	3300046529	Ga0495652_0009716	Ga0495652_0009716_3288_4271	327
253	3300046533	Ga0495640_0000001	Ga0495640_0000001_849965_850948	327
254	3300046536	Ga0495587_0000001	Ga0495587_0000001_68696_69679	327
255	3300046536	Ga0495587_0002135	Ga0495587_0002135_8778_9761	327
256	3300046536	Ga0495587_0148623	Ga0495587_0148623_216_1199	327
257	3300046543	Ga0495645_0000002	Ga0495645_0000002_541440_542423	327
258	3300046543	Ga0495645_0007583	Ga0495645_0007583_1437_2420	327
259	3300046559	Ga0495667_0000039	Ga0495667_0000039_99585_100568	327
260	3300046559	Ga0495667_0000975	Ga0495667_0000975_14803_15786	327
261	3300046616	Ga0495668_0218042	Ga0495668_0218042_28_1011	327
262	3300046642	Ga0495634_0000010	Ga0495634_0000010_100072_101055	327
263	3300046642	Ga0495634_0008760	Ga0495634_0008760_5363_6346	327
264	3300046663	Ga0495635_0000001	Ga0495635_0000001_54520_55503	327
265	3300046663	Ga0495635_0002814	Ga0495635_0002814_3966_4949	327
266	3300046663	Ga0495635_0103536	Ga0495635_0103536_853_1836	327
267	3300046675	Ga0495657_0000042	Ga0495657_0000042_83106_84089	327
268	3300046675	Ga0495657_0022696	Ga0495657_0022696_2969_3952	327
269	3300046678	Ga0495599_0000013	Ga0495599_0000013_109203_110186	327
270	3300046678	Ga0495599_0004454	Ga0495599_0004454_7222_8205	327
271	3300046679	Ga0495623_0000050	Ga0495623_0000050_15454_16437	327
272	3300046679	Ga0495623_0002373	Ga0495623_0002373_520_1503	327
273	3300046679	Ga0495623_0010993	Ga0495623_0010993_862_1845	327
274	3300046680	Ga0495646_0000009	Ga0495646_0000009_69529_70512	327
275	3300046680	Ga0495646_0002725	Ga0495646_0002725_2675_3658	327
276	3300046683	Ga0495658_0042127	Ga0495658_0042127_48_1031	327
277	3300046689	Ga0495613_0135929	Ga0495613_0135929_476_1459	327
278	3300046690	Ga0495624_0016942	Ga0495624_0016942_3499_4482	327
279	3300046690	Ga0495624_0033657	Ga0495624_0033657_2314_3297	327
280	3300046809	Ga0495600_0000035	Ga0495600_0000035_73079_74062	327
281	3300046809	Ga0495600_0005141	Ga0495600_0005141_4342_5325	327
282	3300047317	Ga0495604_0000069	Ga0495604_0000069_43445_44428	327
283	3300047317	Ga0495604_0005786	Ga0495604_0005786_4327_5310	327
284	3300047317	Ga0495604_0069660	Ga0495604_0069660_342_1325	327
285	3300047319	Ga0495674_0000002	Ga0495674_0000002_541428_542411	327
286	3300047319	Ga0495674_0002160	Ga0495674_0002160_2961_3944	327
287	3300047319	Ga0495674_0157149	Ga0495674_0157149_241_1224	327
288	3300047320	Ga0495672_0057338	Ga0495672_0057338_1002_1985	327
289	3300047322	Ga0495680_0000328	Ga0495680_0000328_21548_22531	327
290	3300047322	Ga0495680_0002022	Ga0495680_0002022_2497_3480	327
291	3300047322	Ga0495680_0045774	Ga0495680_0045774_2134_3117	327
292	3300047444	Ga0495675_0000245	Ga0495675_0000245_34797_35780	327
293	3300047444	Ga0495675_0030636	Ga0495675_0030636_565_1548	327
294	3300047471	Ga0495684_0000016	Ga0495684_0000016_133144_134127	327
295	3300047471	Ga0495684_0036598	Ga0495684_0036598_2443_3426	327
296	3300047673	Ga0495593_0001500	Ga0495593_0001500_9439_10422	327
297	3300047673	Ga0495593_0011263	Ga0495593_0011263_3104_4087	327
298	3300048088	Ga0495602_0000024	Ga0495602_0000024_146836_147819	327
299	3300048088	Ga0495602_0014816	Ga0495602_0014816_2415_3398	327
300	3300048088	Ga0495602_0059793	Ga0495602_0059793_736_1719	327
301	3300048088	Ga0495602_0113020	Ga0495602_0113020_1076_2059	327
302	3300048904	Ga0496101_0005706	Ga0496101_0005706_3056_4051	327
303	3300048904	Ga0496101_0173844	Ga0496101_0173844_444_1427	327
304	3300048907	Ga0496104_0002306	Ga0496104_0002306_2335_3318	327
305	3300048909	Ga0496106_0074089	Ga0496106_0074089_1404_2387	327
306	3300048909	Ga0496106_0226136	Ga0496106_0226136_141_1136	327
307	3300048910	Ga0496107_0117613	Ga0496107_0117613_548_1543	327
308	3300048911	Ga0496108_0034755	Ga0496108_0034755_266_1249	327
309	3300048911	Ga0496108_0136627	Ga0496108_0136627_935_1918	327
310	3300048912	Ga0496109_0049616	Ga0496109_0049616_2547_3533	327
311	3300048913	Ga0496110_0005741	Ga0496110_0005741_2449_3444	327
312	3300048913	Ga0496110_0038228	Ga0496110_0038228_2804_3787	327
313	3300048913	Ga0496110_0325622	Ga0496110_0325622_293_1276	327
314	3300048914	Ga0496111_0183116	Ga0496111_0183116_281_1264	327
315	3300048914	Ga0496111_0228985	Ga0496111_0228985_308_1291	327
316	3300048915	Ga0496112_0003916	Ga0496112_0003916_9840_10823	327
317	3300048915	Ga0496112_0171095	Ga0496112_0171095_51_1034	327
318	3300048916	Ga0496113_0032273	Ga0496113_0032273_649_1632	327
319	3300048917	Ga0496114_0368226	Ga0496114_0368226_46_1029	327
320	3300048918	Ga0496115_0142874	Ga0496115_0142874_141_1136	327
321	3300048929	Ga0496126_0437984	Ga0496126_0437984_60_1043	327
322	3300049571	Ga0501034_0112174	Ga0501034_0112174_753_1736	327
323	3300049574	Ga0501038_0052435	Ga0501038_0052435_234_1217	327
324	3300049578	Ga0501042_0097525	Ga0501042_0097525_1078_2061	327
325	3300049580	Ga0501046_0234786	Ga0501046_0234786_213_1196	327
326	3300049581	Ga0501047_0014411	Ga0501047_0014411_785_1768	327
327	3300049581	Ga0501047_0071616	Ga0501047_0071616_1176_2162	327
328	3300049581	Ga0501047_0122943	Ga0501047_0122943_995_1978	327
329	3300049583	Ga0501067_0092686	Ga0501067_0092686_226_1209	327
330	3300049586	Ga0501070_0006598	Ga0501070_0006598_2187_3170	327
331	3300049587	Ga0501071_0023476	Ga0501071_0023476_284_1267	327
332	3300049588	Ga0501072_0333285	Ga0501072_0333285_117_1100	327
333	3300049589	Ga0501073_0202075	Ga0501073_0202075_237_1220	327
334	3300049591	Ga0501075_0034246	Ga0501075_0034246_1652_2635	327
335	3300049592	Ga0501076_0022833	Ga0501076_0022833_1240_2223	327
336	3300049592	Ga0501076_0031251	Ga0501076_0031251_458_1441	327
337	3300049593	Ga0501077_0006570	Ga0501077_0006570_2900_3883	327
338	3300049741	Ga0501079_0162114	Ga0501079_0162114_31_1014	327
339	3300049742	Ga0501080_0402588	Ga0501080_0402588_91_1074	327
340	3300049743	Ga0501081_0010927	Ga0501081_0010927_3574_4557	327
341	3300049744	Ga0501083_0039235	Ga0501083_0039235_277_1260	327
342	3300049823	Ga0501044_0005514	Ga0501044_0005514_4060_5043	327
343	3300050489	nmdc:mga03683_46162_c1	nmdc:mga03683_46162_c1_156_1139	327
344	3300050489	nmdc:mga03683_65095_c1	nmdc:mga03683_65095_c1_324_1307	327
345	3300050491	nmdc:mga00v17_13952_c1	nmdc:mga00v17_13952_c1_1925_2908	327
346	3300050491	nmdc:mga00v17_75052_c1	nmdc:mga00v17_75052_c1_32_1015	327
347	3300050493	nmdc:mga0k408_1498_c1	nmdc:mga0k408_1498_c1_3715_4698	327
348	3300050493	nmdc:mga0k408_28451_c1	nmdc:mga0k408_28451_c1_524_1510	327
349	3300050494	nmdc:mga06z11_53020_c1	nmdc:mga06z11_53020_c1_1029_2012	327
350	3300050509	nmdc:mga0qj67_102841_c1	nmdc:mga0qj67_102841_c1_1238_2221	327
351	3300050510	nmdc:mga06r32_72212_c1	nmdc:mga06r32_72212_c1_981_1964	327
352	3300050511	nmdc:mga08y16_18961_c1	nmdc:mga08y16_18961_c1_5199_6182	327
353	3300050511	nmdc:mga08y16_231773_c1	nmdc:mga08y16_231773_c1_113_1096	327
354	3300050512	nmdc:mga0n895_101911_c1	nmdc:mga0n895_101911_c1_967_1950	327
355	3300050514	nmdc:mga08x19_265480_c1	nmdc:mga08x19_265480_c1_137_1120	327
356	3300050516	nmdc:mga0sz30_23676_c1	nmdc:mga0sz30_23676_c1_1051_2034	327
357	3300053077	Ga0495601_0000001	Ga0495601_0000001_489916_490899	327
358	3300053077	Ga0495601_0020958	Ga0495601_0020958_1281_2264	327
359	3300053078	Ga0495612_0000017	Ga0495612_0000017_81701_82684	327
360	3300053078	Ga0495612_0012710	Ga0495612_0012710_321_1304	327
361	3300053078	Ga0495612_0018106	Ga0495612_0018106_1132_2115	327
362	3300053083	Ga0495655_0005292	Ga0495655_0005292_20_1006	327
363	3300053084	Ga0495595_0000010	Ga0495595_0000010_109179_110162	327
364	3300053084	Ga0495595_0002486	Ga0495595_0002486_445_1428	327
365	3300053084	Ga0495595_0004254	Ga0495595_0004254_2659_3642	327
366	3300053085	Ga0495619_0000004	Ga0495619_0000004_489953_490936	327
367	3300053085	Ga0495619_0000968	Ga0495619_0000968_14190_15173	327
368	3300053085	Ga0495619_0022990	Ga0495619_0022990_2884_3867	327
369	3300053085	Ga0495619_0096937	Ga0495619_0096937_149_1132	327
370	3300053098	Ga0500650_0016000	Ga0500650_0016000_310_1293	327
371	3300053131	Ga0500652_000029	Ga0500652_000029_59315_60298	327
372	3300053153	Ga0500616_0011582	Ga0500616_0011582_194_1177	327
373	3300053153	Ga0500616_0053490	Ga0500616_0053490_981_1964	327
374	3300053158	Ga0500627_0120231	Ga0500627_0120231_174_1157	327
375	3300054114	Ga0501084_0112317	Ga0501084_0112317_749_1774	327
376	3300054114	Ga0501084_0132280	Ga0501084_0132280_121_1104	327
377	3300060353	Ga0501082_0016298	Ga0501082_0016298_1188_2171	327
378	3300060353	Ga0501082_0107764	Ga0501082_0107764_1009_1992	327
379	3300061734	Ga0530510_0121420	Ga0530510_0121420_898_1881	327

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

175

294

0.9 PF22677

Ble-like_N

Bleomycin resistance protein-like N-terminal

43

76

0.89 PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

43

151

0.88 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
4ghh-assembly1.cif.gz_A	structure of homoprotocatechuate 2,3-dioxygenase from b.fuscum in complex with 4-nitrocatechol at 1.55 ang resolution	0.9218	4	321
1f1u-assembly1.cif.gz_A	crystal structure of homoprotocatechuate 2,3-dioxygenase from arthrobacter globiformis (native, low temperature)	0.9204	6	314
4z6o-assembly1.cif.gz_B	structure of h200e variant of homoprotocatechuate 2,3-dioxygenase from b.fuscum in complex with hpca at 1.63 ang resolution	0.9085	4	316
4z6v-assembly1.cif.gz_B	structure of h200q variant of homoprotocatechuate 2,3-dioxygenase from b.fuscum in complex with 4-nitrocatechol at 1.37 ang resolution	0.9071	2	316
5bwg-assembly1.cif.gz_D	structure of h200c variant of homoprotocatechuate 2,3-dioxygenase from b.fuscum at 1.75 ang resolution	0.9052	2	321

ID	Description	Score	Start	End	Superfamily
1q0cA02	Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1	0.9218	148	308	3.10.180.10
1f1yA02	Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1	0.9156	148	287	3.10.180.10
3hpvB01	Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1	0.915	12	133	3.10.180.10
1mpyD01	Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1	0.9146	13	133	3.10.180.10
5zszA01	Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1	0.9101	13	134	3.10.180.10

ID	Description	Score	Start	End	GO Terms
AF-A0A435AT92-F1-model_v4	3,4-dihydroxyphenylacetate 2,3-dioxygenase (EC 1.13.11.15)	0.9661	1	323	GO:0004462 GO:0008687 GO:0046872
AF-A0A5R2N7E1-F1-model_v4	3,4-dihydroxyphenylacetate 2,3-dioxygenase	0.966	1	175	GO:0004462 GO:0046872 GO:0051213
AF-A0A350AGD8-F1-model_v4	3,4-dihydroxyphenylacetate 2,3-dioxygenase	0.9648	1	244	GO:0004462 GO:0046872 GO:0051213
AF-A0A440FXN8-F1-model_v4	deleted	0.9636	1	187
AF-A0A435AT92-F1-model_v4	3,4-dihydroxyphenylacetate 2,3-dioxygenase (EC 1.13.11.15)	0.9631	1	323	GO:0004462 GO:0008687 GO:0046872

Feature Viewer

pLDDT	pTM	Quality
87.3	0.89	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F428380

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

175

294

0.9

PF22677

Ble-like_N

Bleomycin resistance protein-like N-terminal

43

76

0.89

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

43

151

0.88

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map