F428371

General Info

Members Datasets Scaffolds Average Seq Length
379 166 758 158

Family's Representative Sequence

Representative Sequence 3300025905|Ga0207685_10057733|Ga0207685_100577333
Length 178
Sequence VPGGLLTLSPSVLSHMLPAVGLDDWLLALHVLSAFAYVAGIVLFWVLIVAVRTTDTPEGTIRMEPIVKVGNAAVGIGAAGTILLGIWLAFRLDSYAIWDGWIIAALVLWAIAAAVGQRSGVEYTKGMTKAKELEAAGQTGPSSELLALNRTSAGVALHALASTAVLLILLDMIFKPGA

Samples

Sample ID Description Type Environment
1 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
17 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
24 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
25 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
26 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
29 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
30 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
31 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
32 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
33 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
34 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
35 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
36 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
37 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
38 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
39 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
40 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
41 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
42 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
43 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
44 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
45 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
47 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
49 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
50 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
51 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
52 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
53 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
54 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
55 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
56 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
57 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
58 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
59 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
60 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
61 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
78 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
79 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
81 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
82 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
83 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
84 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
85 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
86 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
87 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
88 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
89 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
90 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
91 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
92 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
93 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
94 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
95 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
96 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
97 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
98 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
99 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
100 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
101 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
102 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
103 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
104 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
105 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
106 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
107 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
108 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
109 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
110 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
111 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
112 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
113 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
114 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
115 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
116 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
117 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
119 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
120 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
122 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
123 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
124 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
125 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
127 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
128 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
129 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
131 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
132 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
133 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
134 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
135 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
136 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
137 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
138 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
139 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
140 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
141 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
142 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
143 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
144 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
145 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
146 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
149 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
150 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
151 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
152 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
153 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
154 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
155 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
156 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
157 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
158 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
159 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
160 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
161 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
162 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
163 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
164 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
165 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
166 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.74
Metatranscriptomes 0.26
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.37
Nodule 0
Rhizoplane 5.01
Rhizosphere 92.61
Stem 0
Stem Tuber 0
Unclassified 14.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207685_10057733 3300025905 Bacteria 1524
2 JGI25407J50210_10010245 3300003373 Bacteria 2383
3 JGI25407J50210_10035870 3300003373 Bacteria 1277
4 JGI25407J50210_10061280 3300003373 Bacteria 945
5 JGI25405J52794_10019763 3300003911 Bacteria 1353
6 Ga0070683_101256995 3300005329 Bacteria 711
7 Ga0068869_101084323 3300005334 Unclassified 700
8 Ga0068868_100193381 3300005338 Bacteria 1693
9 Ga0070660_100912624 3300005339 Bacteria 741
10 Ga0070692_10417587 3300005345 Bacteria 851
11 Ga0070669_100842035 3300005353 Bacteria 781
12 Ga0070675_101842605 3300005354 Unclassified 558
13 Ga0070674_100310258 3300005356 Bacteria 1261
14 Ga0070709_10116088 3300005434 Bacteria 1807
15 Ga0070713_100372192 3300005436 Bacteria 1329
16 Ga0070713_100470399 3300005436 Bacteria 1183
17 Ga0070710_10129717 3300005437 Bacteria 1536
18 Ga0070708_100056426 3300005445 Bacteria 3494
19 Ga0070662_100337450 3300005457 Unclassified 1232
20 Ga0068867_100230737 3300005459 Bacteria 1496
21 Ga0068867_100953263 3300005459 Bacteria 775
22 Ga0070706_100363885 3300005467 Bacteria 1348
23 Ga0070707_100105758 3300005468 Bacteria 2729
24 Ga0070707_100839255 3300005468 Bacteria 883
25 Ga0070698_100117119 3300005471 Plasmid 2626
26 Ga0070699_100277276 3300005518 Bacteria 1501
27 Ga0070684_100062038 3300005535 Bacteria 3274
28 Ga0070684_100445552 3300005535 Bacteria 1196
29 Ga0070697_100260576 3300005536 Bacteria 1484
30 Ga0070672_101523459 3300005543 Unclassified 599
31 Ga0070695_100066150 3300005545 Bacteria 2355
32 Ga0070695_101243125 3300005545 Unclassified 614
33 Ga0070696_100129954 3300005546 Bacteria 1832
34 Ga0070696_100459889 3300005546 Bacteria 1006
35 Ga0070664_100246522 3300005564 Bacteria 1605
36 Ga0068861_100089943 3300005719 Bacteria 2420
37 Ga0068862_100629233 3300005844 Bacteria 1033
38 Ga0081455_10002950 3300005937 Bacteria 19909
39 Ga0081455_10006399 3300005937 Bacteria 12641
40 Ga0081455_10026385 3300005937 Bacteria 5344
41 Ga0081455_10027643 3300005937 Bacteria 5197
42 Ga0081455_10374427 3300005937 Bacteria 997
43 Ga0081538_10000063 3300005981 Bacteria 99624
44 Ga0081538_10000324 3300005981 Bacteria 54756
45 Ga0081538_10000461 3300005981 Bacteria 45573
46 Ga0081538_10000967 3300005981 Bacteria 30667
47 Ga0081538_10002089 3300005981 Bacteria 19911
48 Ga0081538_10003287 3300005981 Bacteria 15342
49 Ga0081538_10008751 3300005981 Bacteria 8538
50 Ga0081538_10018126 3300005981 Bacteria 5307
51 Ga0081538_10026704 3300005981 Bacteria 4029
52 Ga0081538_10049916 3300005981 Bacteria 2533
53 Ga0081538_10149233 3300005981 Bacteria 1062
54 Ga0081538_10156814 3300005981 Bacteria 1019
55 Ga0081540_1004016 3300005983 Bacteria 11392
56 Ga0075365_10198475 3300006038 Bacteria 1405
57 Ga0075364_10254176 3300006051 Bacteria 1194
58 Ga0075432_10049035 3300006058 Bacteria 1487
59 Ga0075432_10062647 3300006058 Unclassified 1327
60 Ga0075362_10182091 3300006177 Bacteria 1018
61 Ga0075366_10393337 3300006195 Bacteria 853
62 Ga0075428_100099578 3300006844 Bacteria 3169
63 Ga0075428_100256598 3300006844 Bacteria 1883
64 Ga0075428_100328635 3300006844 Bacteria 1642
65 Ga0075428_102018592 3300006844 Bacteria 597
66 Ga0075430_100219394 3300006846 Bacteria 1578
67 Ga0075430_100221557 3300006846 Bacteria 1569
68 Ga0075430_100282011 3300006846 Unclassified 1374
69 Ga0075430_100494564 3300006846 Unclassified 1009
70 Ga0075431_100056040 3300006847 Bacteria 4066
71 Ga0075431_100088411 3300006847 Bacteria 3197
72 Ga0075431_100576977 3300006847 Bacteria 1110
73 Ga0075434_100008541 3300006871 Bacteria 9526
74 Ga0075434_100767345 3300006871 Unclassified 981
75 Ga0075429_100106681 3300006880 Bacteria 2447
76 Ga0075429_100189645 3300006880 Bacteria 1801
77 Ga0075429_100471087 3300006880 Bacteria 1100
78 Ga0068865_100052443 3300006881 Bacteria 2827
79 Ga0075436_100005283 3300006914 Bacteria 8884
80 Ga0111539_10148573 3300009094 Bacteria 2744
81 Ga0111539_10224002 3300009094 Bacteria 2190
82 Ga0105245_10021495 3300009098 Bacteria 5661
83 Ga0105245_10045093 3300009098 Bacteria 3937
84 Ga0105245_11128315 3300009098 Unclassified 831
85 Ga0105245_11188485 3300009098 Bacteria 810
86 Ga0105245_12862430 3300009098 Bacteria 535
87 Ga0114129_10012391 3300009147 Bacteria 12137
88 Ga0114129_10124607 3300009147 Bacteria 3543
89 Ga0114129_10373480 3300009147 Bacteria 1884
90 Ga0114129_10462162 3300009147 Bacteria 1663
91 Ga0114129_11358773 3300009147 Bacteria 878
92 Ga0114129_11673996 3300009147 Unclassified 777
93 Ga0114129_12102794 3300009147 Bacteria 681
94 Ga0105243_10014915 3300009148 Bacteria 5881
95 Ga0105243_10042263 3300009148 Bacteria 3568
96 Ga0105242_10576329 3300009176 Bacteria 1083
97 Ga0105242_10631651 3300009176 Bacteria 1039
98 Ga0105237_11193662 3300009545 Unclassified 767
99 Ga0105239_10260329 3300010375 Bacteria 1949
100 Ga0105239_10378921 3300010375 Bacteria 1599
101 Ga0105246_10996410 3300011119 Bacteria 758
102 Ga0157316_1011618 3300012510 Bacteria 830
103 Ga0157378_11525507 3300013297 Bacteria 713
104 Ga0163162_10996263 3300013306 Bacteria 947
105 Ga0157375_10295638 3300013308 Bacteria 1783
106 Ga0157377_10186302 3300014745 Bacteria 1308
107 Ga0157379_10791634 3300014968 Bacteria 894
108 Ga0163161_11442843 3300017792 Unclassified 602
109 Ga0224712_10052325 3300022467 Bacteria 1594
110 Ga0207688_10004416 3300025901 Bacteria 7653
111 Ga0207688_10254142 3300025901 Unclassified 1065
112 Ga0207684_10171473 3300025910 Bacteria 1870
113 Ga0207684_10679998 3300025910 Unclassified 876
114 Ga0207693_10014422 3300025915 Bacteria 6355
115 Ga0207646_10115441 3300025922 Bacteria 2411
116 Ga0207681_10914614 3300025923 Bacteria 735
117 Ga0207687_10056251 3300025927 Bacteria 2759
118 Ga0207700_10411413 3300025928 Bacteria 1186
119 Ga0207664_10400611 3300025929 Bacteria 1220
120 Ga0207709_10792050 3300025935 Bacteria 765
121 Ga0207665_10215867 3300025939 Bacteria 1404
122 Ga0207691_11246912 3300025940 Unclassified 615
123 Ga0207661_10231295 3300025944 Bacteria 1637
124 Ga0207661_10244490 3300025944 Bacteria 1593
125 Ga0207679_10375290 3300025945 Bacteria 1245
126 Ga0207668_10881048 3300025972 Unclassified 796
127 Ga0207668_11106575 3300025972 Unclassified 710
128 Ga0207708_10241038 3300026075 Bacteria 1454
129 Ga0207648_10241714 3300026089 Bacteria 1607
130 Ga0207648_11710068 3300026089 Unclassified 591
131 Ga0209966_1016584 3300027695 Bacteria 1395
132 Ga0207428_10003236 3300027907 Bacteria 15898
133 Ga0207428_10129993 3300027907 Bacteria 1928
134 Ga0207428_10224362 3300027907 Bacteria 1407
135 Ga0268265_10401718 3300028380 Bacteria 1267
136 Ga0307409_100087103 3300031995 Bacteria 2544
137 Ga0307416_100238720 3300032002 Bacteria 1759
138 Ga0307415_100591516 3300032126 Bacteria 986
139 Ga0307415_100593093 3300032126 Bacteria 985
140 Ga0307415_100832615 3300032126 Bacteria 845
141 Ga0373958_0027193 3300034819 Unclassified 1100
142 Ga0373951_0126370 3300035091 Unclassified 700
143 Ga0373960_0109842 3300035121 Unclassified 903
144 Ga0373931_0306532 3300035691 Unclassified 982
145 Ga0395899_0006069 3300037312 Bacteria 9381
146 Ga0395899_0019973 3300037312 Bacteria 5082
147 Ga0395899_0028496 3300037312 Bacteria 4205
148 Ga0395899_0063430 3300037312 Bacteria 2718
149 Ga0395899_0108620 3300037312 Bacteria 1996
150 Ga0395899_0219920 3300037312 Bacteria 1316
151 Ga0395899_0567780 3300037312 Bacteria 727
152 Ga0395900_0005258 3300037418 Bacteria 13578
153 Ga0395900_0035690 3300037418 Bacteria 5122
154 Ga0395900_0058941 3300037418 Unclassified 3952
155 Ga0395900_0152986 3300037418 Bacteria 2356
156 Ga0395900_0181667 3300037418 Bacteria 2137
157 Ga0395900_0302336 3300037418 Bacteria 1586
158 Ga0395900_0729662 3300037418 Bacteria 922
159 Ga0395900_1020324 3300037418 Bacteria 747
160 Ga0395898_0007653 3300037466 Bacteria 11470
161 Ga0395898_0040421 3300037466 Bacteria 4611
162 Ga0395898_0058891 3300037466 Bacteria 3738
163 Ga0395898_0100157 3300037466 Bacteria 2783
164 Ga0395898_0105487 3300037466 Bacteria 2702
165 Ga0395898_0400960 3300037466 Bacteria 1308
166 Ga0395898_0809584 3300037466 Bacteria 877
167 Ga0395905_0005887 3300037471 Bacteria 12444
168 Ga0395905_0026352 3300037471 Bacteria 5481
169 Ga0395905_0027671 3300037471 Bacteria 5346
170 Ga0395905_0047061 3300037471 Bacteria 4044
171 Ga0395905_0185057 3300037471 Archaea 1955
172 Ga0395905_0878391 3300037471 Bacteria 800
173 Ga0395901_0003322 3300038443 Bacteria 16210
174 Ga0395901_0016700 3300038443 Bacteria 7479
175 Ga0395901_0116956 3300038443 Bacteria 2801
176 Ga0395901_0151865 3300038443 Bacteria 2433
177 Ga0395901_0226963 3300038443 Bacteria 1950
178 Ga0395901_0328704 3300038443 Bacteria 1581
179 Ga0395901_0386146 3300038443 Bacteria 1440
180 Ga0439441_131957 3300042001 Bacteria 579
181 Ga0439448_0000363 3300042005 Bacteria 10214
182 Ga0439463_123193 3300042016 Bacteria 670
183 Ga0450888_010363 3300042126 Bacteria 1079
184 Ga0450888_013088 3300042126 Bacteria 990
185 Ga0450907_034947 3300042146 Bacteria 857
186 Ga0439458_0005916 3300042157 Bacteria 2741
187 Ga0439435_0129111 3300042436 Unclassified 797
188 Ga0439460_0012322 3300042461 Unclassified 2217
189 Ga0450918_009209 3300042531 Bacteria 1734
190 Ga0466960_0010440 3300044901 Unclassified 3858
191 Ga0495585_0084956 3300046492 Unclassified 1711
192 Ga0495634_0581050 3300046642 Bacteria 651
193 Ga0495613_0776162 3300046689 Unclassified 627
194 Ga0495600_0601997 3300046809 Bacteria 668
195 Ga0496101_0321602 3300048904 Unclassified 1214
196 Ga0496104_0707886 3300048907 Unclassified 915
197 Ga0496106_0628411 3300048909 Bacteria 859
198 Ga0496107_0482665 3300048910 Bacteria 920
199 Ga0496107_0745140 3300048910 Bacteria 719
200 Ga0496108_0049972 3300048911 Bacteria 3499
201 Ga0496108_0479054 3300048911 Bacteria 1087
202 Ga0496108_0858351 3300048911 Bacteria 781
203 Ga0496109_0071142 3300048912 Plasmid 3193
204 Ga0496110_0081474 3300048913 Bacteria 2885
205 Ga0496110_0087256 3300048913 Bacteria 2787
206 Ga0496110_0177970 3300048913 Bacteria 1931
207 Ga0496110_0252908 3300048913 Bacteria 1604
208 Ga0496111_0679820 3300048914 Bacteria 750
209 Ga0496112_0232133 3300048915 Unclassified 1799
210 Ga0496112_0409755 3300048915 Unclassified 1295
211 Ga0496112_0906689 3300048915 Bacteria 803
212 Ga0496113_0078550 3300048916 Bacteria 2525
213 Ga0496114_1763091 3300048917 Unclassified 507
214 Ga0501031_0002223 3300049568 Bacteria 12266
215 Ga0501031_0011516 3300049568 Bacteria 5765
216 Ga0501031_0132569 3300049568 Unclassified 1628
217 Ga0501031_0715464 3300049568 Bacteria 643
218 Ga0501032_0003316 3300049569 Bacteria 12384
219 Ga0501032_0125349 3300049569 Bacteria 1697
220 Ga0501033_0001739 3300049570 Bacteria 19035
221 Ga0501034_0018996 3300049571 Bacteria 7039
222 Ga0501034_0035447 3300049571 Bacteria 5058
223 Ga0501036_0000369 3300049572 Bacteria 31683
224 Ga0501036_0017696 3300049572 Bacteria 5964
225 Ga0501036_0024087 3300049572 Bacteria 5130
226 Ga0501036_0049280 3300049572 Bacteria 3566
227 Ga0501037_0001484 3300049573 Bacteria 17164
228 Ga0501037_0053229 3300049573 Bacteria 2960
229 Ga0501037_0373200 3300049573 Unclassified 981
230 Ga0501037_0909643 3300049573 Bacteria 576
231 Ga0501038_0000268 3300049574 Bacteria 44025
232 Ga0501038_0025589 3300049574 Bacteria 5259
233 Ga0501038_0105885 3300049574 Bacteria 2335
234 Ga0501038_0343284 3300049574 Unclassified 1164
235 Ga0501039_0007359 3300049575 Bacteria 8392
236 Ga0501039_0032105 3300049575 Bacteria 4047
237 Ga0501039_0047638 3300049575 Bacteria 3313
238 Ga0501039_0224999 3300049575 Unclassified 1475
239 Ga0501040_0000018 3300049576 Bacteria 74530
240 Ga0501040_0001316 3300049576 Bacteria 15749
241 Ga0501040_0001397 3300049576 Bacteria 15258
242 Ga0501040_0210451 3300049576 Bacteria 1382
243 Ga0501041_0000008 3300049577 Bacteria 63313
244 Ga0501041_0000858 3300049577 Bacteria 16372
245 Ga0501041_0010009 3300049577 Bacteria 5587
246 Ga0501041_0045062 3300049577 Bacteria 2680
247 Ga0501041_0397846 3300049577 Bacteria 872
248 Ga0501041_0463730 3300049577 Bacteria 805
249 Ga0501042_0000140 3300049578 Bacteria 31715
250 Ga0501042_0000492 3300049578 Bacteria 20529
251 Ga0501042_0015014 3300049578 Bacteria 5296
252 Ga0501042_0084896 3300049578 Bacteria 2270
253 Ga0501042_0209427 3300049578 Bacteria 1406
254 Ga0501042_0764178 3300049578 Unclassified 703
255 Ga0501043_0006242 3300049579 Bacteria 9568
256 Ga0501043_0134070 3300049579 Bacteria 1940
257 Ga0501043_0543796 3300049579 Unclassified 863
258 Ga0501046_0000252 3300049580 Bacteria 55045
259 Ga0501046_0002580 3300049580 Bacteria 16944
260 Ga0501046_0027488 3300049580 Bacteria 4639
261 Ga0501046_0123902 3300049580 Bacteria 1965
262 Ga0501046_0846469 3300049580 Unclassified 640
263 Ga0501047_0019268 3300049581 Bacteria 6546
264 Ga0501047_0094973 3300049581 Bacteria 2860
265 Ga0501047_0654305 3300049581 Bacteria 870
266 Ga0501048_0000669 3300049582 Bacteria 24822
267 Ga0501048_0000694 3300049582 Bacteria 24482
268 Ga0501048_0004220 3300049582 Bacteria 10951
269 Ga0501048_0158305 3300049582 Bacteria 1602
270 Ga0501068_0006414 3300049584 Bacteria 6483
271 Ga0501068_0059983 3300049584 Bacteria 2309
272 Ga0501069_0001678 3300049585 Bacteria 10997
273 Ga0501069_0002500 3300049585 Bacteria 9380
274 Ga0501069_0549924 3300049585 Bacteria 691
275 Ga0501070_0000379 3300049586 Bacteria 40548
276 Ga0501070_1139047 3300049586 Unclassified 600
277 Ga0501071_0000029 3300049587 Bacteria 47815
278 Ga0501071_0006166 3300049587 Bacteria 7773
279 Ga0501071_0014413 3300049587 Bacteria 5407
280 Ga0501071_0083806 3300049587 Bacteria 2335
281 Ga0501071_0484375 3300049587 Bacteria 948
282 Ga0501072_0000586 3300049588 Bacteria 26228
283 Ga0501072_0001314 3300049588 Bacteria 18625
284 Ga0501072_0002661 3300049588 Bacteria 13389
285 Ga0501072_0009770 3300049588 Bacteria 7294
286 Ga0501072_0245295 3300049588 Bacteria 1427
287 Ga0501072_0283674 3300049588 Bacteria 1317
288 Ga0501073_0001124 3300049589 Bacteria 19412
289 Ga0501074_0000928 3300049590 Bacteria 18830
290 Ga0501074_0018237 3300049590 Bacteria 5099
291 Ga0501074_0046509 3300049590 Bacteria 3137
292 Ga0501074_0708251 3300049590 Bacteria 710
293 Ga0501075_0001207 3300049591 Bacteria 16734
294 Ga0501075_0001241 3300049591 Bacteria 16539
295 Ga0501075_0002191 3300049591 Bacteria 12925
296 Ga0501075_0009888 3300049591 Bacteria 6683
297 Ga0501076_0000273 3300049592 Bacteria 32129
298 Ga0501076_0000355 3300049592 Bacteria 28426
299 Ga0501076_0001936 3300049592 Bacteria 14138
300 Ga0501076_0030150 3300049592 Bacteria 4224
301 Ga0501076_0120952 3300049592 Bacteria 2120
302 Ga0501076_0369754 3300049592 Bacteria 1178
303 Ga0501076_0635228 3300049592 Unclassified 881
304 Ga0501077_0000144 3300049593 Bacteria 39257
305 Ga0501077_0000427 3300049593 Bacteria 25498
306 Ga0501077_0006645 3300049593 Bacteria 7104
307 Ga0501077_0010843 3300049593 Bacteria 5677
308 Ga0501077_0190169 3300049593 Unclassified 1304
309 Ga0501079_0000263 3300049741 Bacteria 32250
310 Ga0501079_0001280 3300049741 Bacteria 17654
311 Ga0501079_0006247 3300049741 Bacteria 8941
312 Ga0501079_0154872 3300049741 Bacteria 1786
313 Ga0501079_0213492 3300049741 Bacteria 1507
314 Ga0501079_0246111 3300049741 Bacteria 1397
315 Ga0501080_0000155 3300049742 Bacteria 49054
316 Ga0501080_0117232 3300049742 Bacteria 2468
317 Ga0501081_0000009 3300049743 Bacteria 70386
318 Ga0501081_0002539 3300049743 Bacteria 11500
319 Ga0501081_0002922 3300049743 Bacteria 10836
320 Ga0501081_0077413 3300049743 Bacteria 2324
321 Ga0501081_0128949 3300049743 Bacteria 1806
322 Ga0501081_0345233 3300049743 Unclassified 1096
323 Ga0501083_0000447 3300049744 Bacteria 26467
324 Ga0501083_0043266 3300049744 Bacteria 3051
325 Ga0501083_0441096 3300049744 Bacteria 847
326 Ga0501035_0007098 3300049822 Bacteria 10475
327 Ga0501035_0008684 3300049822 Bacteria 9458
328 Ga0501035_0639377 3300049822 Unclassified 863
329 Ga0501044_0289572 3300049823 Bacteria 1569
330 Ga0501044_1197559 3300049823 Unclassified 627
331 Ga0501045_0000349 3300049824 Bacteria 27341
332 Ga0501045_0001432 3300049824 Bacteria 15909
333 Ga0501045_0001541 3300049824 Bacteria 15353
334 Ga0501045_0047926 3300049824 Bacteria 3113
335 Ga0501045_0598271 3300049824 Bacteria 817
336 nmdc:mga03683_228544_c1 3300050489 Bacteria 860
337 nmdc:mga03683_541170_c1 3300050489 Unclassified 566
338 nmdc:mga0yw44_313981_c1 3300050492 Bacteria 1052
339 nmdc:mga0yw44_79871_c1 3300050492 Bacteria 2047
340 nmdc:mga0k408_306694_c1 3300050493 Bacteria 947
341 nmdc:mga05p37_166304_c1 3300050507 Bacteria 2692
342 nmdc:mga05p37_463_c2 3300050507 Bacteria 24481
343 nmdc:mga05p37_544078_c1 3300050507 Bacteria 1323
344 nmdc:mga05p37_639690_c1 3300050507 Bacteria 1193
345 nmdc:mga09592_11235_c1 3300050508 Bacteria 7286
346 nmdc:mga09592_1223306_c1 3300050508 Bacteria 620
347 nmdc:mga09592_32409_c1 3300050508 Unclassified 4356
348 nmdc:mga09592_70411_c1 3300050508 Bacteria 1369
349 nmdc:mga0qj67_185748_c1 3300050509 Bacteria 1689
350 nmdc:mga0qj67_216740_c1 3300050509 Bacteria 1554
351 nmdc:mga0qj67_359455_c1 3300050509 Unclassified 1177
352 nmdc:mga0qj67_818670_c1 3300050509 Unclassified 736
353 nmdc:mga06r32_320434_c1 3300050510 Bacteria 1536
354 nmdc:mga06r32_518585_c1 3300050510 Bacteria 1168
355 nmdc:mga08y16_180262_c1 3300050511 Bacteria 2194
356 nmdc:mga0n895_256517_c1 3300050512 Bacteria 1774
357 nmdc:mga0n895_273995_c1 3300050512 Unclassified 1712
358 nmdc:mga0n895_802593_c1 3300050512 Bacteria 931
359 nmdc:mga0n895_956046_c1 3300050512 Bacteria 840
360 nmdc:mga0rr50_15731_c1 3300050513 Bacteria 5002
361 nmdc:mga0rr50_187832_c1 3300050513 Unclassified 1692
362 nmdc:mga08x19_72549_c1 3300050514 Bacteria 2246
363 nmdc:mga08x19_961111_c1 3300050514 Unclassified 607
364 nmdc:mga0a205_449119_c1 3300050515 Bacteria 1149
365 nmdc:mga0a205_4772_c1 3300050515 Bacteria 12179
366 Ga0495601_0491325 3300053077 Bacteria 792
367 Ga0495619_0093828 3300053085 Bacteria 2035
368 Ga0501084_0000416 3300054114 Bacteria 33003
369 Ga0501084_0000679 3300054114 Bacteria 25953
370 Ga0501084_0005537 3300054114 Bacteria 10365
371 Ga0501084_0483422 3300054114 Bacteria 1047
372 Ga0590075_018395 3300059424 Unclassified 1728
373 Ga0501082_0005072 3300060353 Bacteria 11479
374 Ga0501082_0006672 3300060353 Bacteria 9988
375 Ga0501082_0023125 3300060353 Bacteria 5360
376 Ga0530510_0000018 3300061734 Bacteria 81100
377 Ga0530510_0000853 3300061734 Bacteria 20124
378 Ga0530510_0004884 3300061734 Bacteria 9277
379 Ga0530510_0014599 3300061734 Bacteria 5542
380 Ga0207685_10057733
381 JGI25407J50210_10010245
382 JGI25407J50210_10035870
383 JGI25407J50210_10061280
384 JGI25405J52794_10019763
385 Ga0070683_101256995
386 Ga0068869_101084323
387 Ga0068868_100193381
388 Ga0070660_100912624
389 Ga0070692_10417587
390 Ga0070669_100842035
391 Ga0070675_101842605
392 Ga0070674_100310258
393 Ga0070709_10116088
394 Ga0070713_100372192
395 Ga0070713_100470399
396 Ga0070710_10129717
397 Ga0070708_100056426
398 Ga0070662_100337450
399 Ga0068867_100230737
400 Ga0068867_100953263
401 Ga0070706_100363885
402 Ga0070707_100105758
403 Ga0070707_100839255
404 Ga0070698_100117119
405 Ga0070699_100277276
406 Ga0070684_100062038
407 Ga0070684_100445552
408 Ga0070697_100260576
409 Ga0070672_101523459
410 Ga0070695_100066150
411 Ga0070695_101243125
412 Ga0070696_100129954
413 Ga0070696_100459889
414 Ga0070664_100246522
415 Ga0068861_100089943
416 Ga0068862_100629233
417 Ga0081455_10002950
418 Ga0081455_10006399
419 Ga0081455_10026385
420 Ga0081455_10027643
421 Ga0081455_10374427
422 Ga0081538_10000063
423 Ga0081538_10000324
424 Ga0081538_10000461
425 Ga0081538_10000967
426 Ga0081538_10002089
427 Ga0081538_10003287
428 Ga0081538_10008751
429 Ga0081538_10018126
430 Ga0081538_10026704
431 Ga0081538_10049916
432 Ga0081538_10149233
433 Ga0081538_10156814
434 Ga0081540_1004016
435 Ga0075365_10198475
436 Ga0075364_10254176
437 Ga0075432_10049035
438 Ga0075432_10062647
439 Ga0075362_10182091
440 Ga0075366_10393337
441 Ga0075428_100099578
442 Ga0075428_100256598
443 Ga0075428_100328635
444 Ga0075428_102018592
445 Ga0075430_100219394
446 Ga0075430_100221557
447 Ga0075430_100282011
448 Ga0075430_100494564
449 Ga0075431_100056040
450 Ga0075431_100088411
451 Ga0075431_100576977
452 Ga0075434_100008541
453 Ga0075434_100767345
454 Ga0075429_100106681
455 Ga0075429_100189645
456 Ga0075429_100471087
457 Ga0068865_100052443
458 Ga0075436_100005283
459 Ga0111539_10148573
460 Ga0111539_10224002
461 Ga0105245_10021495
462 Ga0105245_10045093
463 Ga0105245_11128315
464 Ga0105245_11188485
465 Ga0105245_12862430
466 Ga0114129_10012391
467 Ga0114129_10124607
468 Ga0114129_10373480
469 Ga0114129_10462162
470 Ga0114129_11358773
471 Ga0114129_11673996
472 Ga0114129_12102794
473 Ga0105243_10014915
474 Ga0105243_10042263
475 Ga0105242_10576329
476 Ga0105242_10631651
477 Ga0105237_11193662
478 Ga0105239_10260329
479 Ga0105239_10378921
480 Ga0105246_10996410
481 Ga0157316_1011618
482 Ga0157378_11525507
483 Ga0163162_10996263
484 Ga0157375_10295638
485 Ga0157377_10186302
486 Ga0157379_10791634
487 Ga0163161_11442843
488 Ga0224712_10052325
489 Ga0207688_10004416
490 Ga0207688_10254142
491 Ga0207684_10171473
492 Ga0207684_10679998
493 Ga0207693_10014422
494 Ga0207646_10115441
495 Ga0207681_10914614
496 Ga0207687_10056251
497 Ga0207700_10411413
498 Ga0207664_10400611
499 Ga0207709_10792050
500 Ga0207665_10215867
501 Ga0207691_11246912
502 Ga0207661_10231295
503 Ga0207661_10244490
504 Ga0207679_10375290
505 Ga0207668_10881048
506 Ga0207668_11106575
507 Ga0207708_10241038
508 Ga0207648_10241714
509 Ga0207648_11710068
510 Ga0209966_1016584
511 Ga0207428_10003236
512 Ga0207428_10129993
513 Ga0207428_10224362
514 Ga0268265_10401718
515 Ga0307409_100087103
516 Ga0307416_100238720
517 Ga0307415_100591516
518 Ga0307415_100593093
519 Ga0307415_100832615
520 Ga0373958_0027193
521 Ga0373951_0126370
522 Ga0373960_0109842
523 Ga0373931_0306532
524 Ga0395899_0006069
525 Ga0395899_0019973
526 Ga0395899_0028496
527 Ga0395899_0063430
528 Ga0395899_0108620
529 Ga0395899_0219920
530 Ga0395899_0567780
531 Ga0395900_0005258
532 Ga0395900_0035690
533 Ga0395900_0058941
534 Ga0395900_0152986
535 Ga0395900_0181667
536 Ga0395900_0302336
537 Ga0395900_0729662
538 Ga0395900_1020324
539 Ga0395898_0007653
540 Ga0395898_0040421
541 Ga0395898_0058891
542 Ga0395898_0100157
543 Ga0395898_0105487
544 Ga0395898_0400960
545 Ga0395898_0809584
546 Ga0395905_0005887
547 Ga0395905_0026352
548 Ga0395905_0027671
549 Ga0395905_0047061
550 Ga0395905_0185057
551 Ga0395905_0878391
552 Ga0395901_0003322
553 Ga0395901_0016700
554 Ga0395901_0116956
555 Ga0395901_0151865
556 Ga0395901_0226963
557 Ga0395901_0328704
558 Ga0395901_0386146
559 Ga0439441_131957
560 Ga0439448_0000363
561 Ga0439463_123193
562 Ga0450888_010363
563 Ga0450888_013088
564 Ga0450907_034947
565 Ga0439458_0005916
566 Ga0439435_0129111
567 Ga0439460_0012322
568 Ga0450918_009209
569 Ga0466960_0010440
570 Ga0495585_0084956
571 Ga0495634_0581050
572 Ga0495613_0776162
573 Ga0495600_0601997
574 Ga0496101_0321602
575 Ga0496104_0707886
576 Ga0496106_0628411
577 Ga0496107_0482665
578 Ga0496107_0745140
579 Ga0496108_0049972
580 Ga0496108_0479054
581 Ga0496108_0858351
582 Ga0496109_0071142
583 Ga0496110_0081474
584 Ga0496110_0087256
585 Ga0496110_0177970
586 Ga0496110_0252908
587 Ga0496111_0679820
588 Ga0496112_0232133
589 Ga0496112_0409755
590 Ga0496112_0906689
591 Ga0496113_0078550
592 Ga0496114_1763091
593 Ga0501031_0002223
594 Ga0501031_0011516
595 Ga0501031_0132569
596 Ga0501031_0715464
597 Ga0501032_0003316
598 Ga0501032_0125349
599 Ga0501033_0001739
600 Ga0501034_0018996
601 Ga0501034_0035447
602 Ga0501036_0000369
603 Ga0501036_0017696
604 Ga0501036_0024087
605 Ga0501036_0049280
606 Ga0501037_0001484
607 Ga0501037_0053229
608 Ga0501037_0373200
609 Ga0501037_0909643
610 Ga0501038_0000268
611 Ga0501038_0025589
612 Ga0501038_0105885
613 Ga0501038_0343284
614 Ga0501039_0007359
615 Ga0501039_0032105
616 Ga0501039_0047638
617 Ga0501039_0224999
618 Ga0501040_0000018
619 Ga0501040_0001316
620 Ga0501040_0001397
621 Ga0501040_0210451
622 Ga0501041_0000008
623 Ga0501041_0000858
624 Ga0501041_0010009
625 Ga0501041_0045062
626 Ga0501041_0397846
627 Ga0501041_0463730
628 Ga0501042_0000140
629 Ga0501042_0000492
630 Ga0501042_0015014
631 Ga0501042_0084896
632 Ga0501042_0209427
633 Ga0501042_0764178
634 Ga0501043_0006242
635 Ga0501043_0134070
636 Ga0501043_0543796
637 Ga0501046_0000252
638 Ga0501046_0002580
639 Ga0501046_0027488
640 Ga0501046_0123902
641 Ga0501046_0846469
642 Ga0501047_0019268
643 Ga0501047_0094973
644 Ga0501047_0654305
645 Ga0501048_0000669
646 Ga0501048_0000694
647 Ga0501048_0004220
648 Ga0501048_0158305
649 Ga0501068_0006414
650 Ga0501068_0059983
651 Ga0501069_0001678
652 Ga0501069_0002500
653 Ga0501069_0549924
654 Ga0501070_0000379
655 Ga0501070_1139047
656 Ga0501071_0000029
657 Ga0501071_0006166
658 Ga0501071_0014413
659 Ga0501071_0083806
660 Ga0501071_0484375
661 Ga0501072_0000586
662 Ga0501072_0001314
663 Ga0501072_0002661
664 Ga0501072_0009770
665 Ga0501072_0245295
666 Ga0501072_0283674
667 Ga0501073_0001124
668 Ga0501074_0000928
669 Ga0501074_0018237
670 Ga0501074_0046509
671 Ga0501074_0708251
672 Ga0501075_0001207
673 Ga0501075_0001241
674 Ga0501075_0002191
675 Ga0501075_0009888
676 Ga0501076_0000273
677 Ga0501076_0000355
678 Ga0501076_0001936
679 Ga0501076_0030150
680 Ga0501076_0120952
681 Ga0501076_0369754
682 Ga0501076_0635228
683 Ga0501077_0000144
684 Ga0501077_0000427
685 Ga0501077_0006645
686 Ga0501077_0010843
687 Ga0501077_0190169
688 Ga0501079_0000263
689 Ga0501079_0001280
690 Ga0501079_0006247
691 Ga0501079_0154872
692 Ga0501079_0213492
693 Ga0501079_0246111
694 Ga0501080_0000155
695 Ga0501080_0117232
696 Ga0501081_0000009
697 Ga0501081_0002539
698 Ga0501081_0002922
699 Ga0501081_0077413
700 Ga0501081_0128949
701 Ga0501081_0345233
702 Ga0501083_0000447
703 Ga0501083_0043266
704 Ga0501083_0441096
705 Ga0501035_0007098
706 Ga0501035_0008684
707 Ga0501035_0639377
708 Ga0501044_0289572
709 Ga0501044_1197559
710 Ga0501045_0000349
711 Ga0501045_0001432
712 Ga0501045_0001541
713 Ga0501045_0047926
714 Ga0501045_0598271
715 nmdc:mga03683_228544_c1
716 nmdc:mga03683_541170_c1
717 nmdc:mga0yw44_313981_c1
718 nmdc:mga0yw44_79871_c1
719 nmdc:mga0k408_306694_c1
720 nmdc:mga05p37_166304_c1
721 nmdc:mga05p37_463_c2
722 nmdc:mga05p37_544078_c1
723 nmdc:mga05p37_639690_c1
724 nmdc:mga09592_11235_c1
725 nmdc:mga09592_1223306_c1
726 nmdc:mga09592_32409_c1
727 nmdc:mga09592_70411_c1
728 nmdc:mga0qj67_185748_c1
729 nmdc:mga0qj67_216740_c1
730 nmdc:mga0qj67_359455_c1
731 nmdc:mga0qj67_818670_c1
732 nmdc:mga06r32_320434_c1
733 nmdc:mga06r32_518585_c1
734 nmdc:mga08y16_180262_c1
735 nmdc:mga0n895_256517_c1
736 nmdc:mga0n895_273995_c1
737 nmdc:mga0n895_802593_c1
738 nmdc:mga0n895_956046_c1
739 nmdc:mga0rr50_15731_c1
740 nmdc:mga0rr50_187832_c1
741 nmdc:mga08x19_72549_c1
742 nmdc:mga08x19_961111_c1
743 nmdc:mga0a205_449119_c1
744 nmdc:mga0a205_4772_c1
745 Ga0495601_0491325
746 Ga0495619_0093828
747 Ga0501084_0000416
748 Ga0501084_0000679
749 Ga0501084_0005537
750 Ga0501084_0483422
751 Ga0590075_018395
752 Ga0501082_0005072
753 Ga0501082_0006672
754 Ga0501082_0023125
755 Ga0530510_0000018
756 Ga0530510_0000853
757 Ga0530510_0004884
758 Ga0530510_0014599

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
2xra-assembly1.cif.gz_A crystal structure of the hk20 fab in complex with a gp41 mimetic 5- helix 0.7267 38 154
6bqg-assembly1.cif.gz_A crystal structure of 5-ht2c in complex with ergotamine 0.6635 11 152
6egc-assembly1.cif.gz_A single-chain version of 2l4hc2_23 (pdb 5j0k) 0.6631 9 155
5l7d-assembly1.cif.gz_A structure of human smoothened in complex with cholesterol 0.6596 5 151
7pp1-assembly1.cif.gz_AAA crystal structure of the p2y12 receptor in complex with the inverse agonist selatogrel. 0.6513 3 144
ID Description Score Start End Superfamily
af_Q9U2Y0_13_310_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.6563 40 144 1.20.1070.10
4er9A00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c/b562 0.6263 17 144 1.20.120.10
3gm3A00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Nucleotidyltransferases 0.6129 10 152 1.20.120.330
af_A0A0R4IDZ8_1844_1969_3.10.20.90 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 0.6106 7 151 3.10.20.90
4er9A00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c/b562 0.6102 17 144 1.20.120.10
ID Description Score Start End GO Terms
AF-A0A7W0PLV0-F1-model_v4 DUF2269 family protein 0.974 1 158 GO:0016020
AF-A0A7W0PLV0-F1-model_v4 DUF2269 family protein 0.968 1 158 GO:0016020
AF-A0A7Y5WZD1-F1-model_v4 DUF2269 family protein 0.9351 1 158 GO:0016020
AF-A0A1Q7UG30-F1-model_v4 DUF2269 domain-containing protein 0.932 1 158 GO:0016020
AF-A0A7V8XGM7-F1-model_v4 DUF2269 family protein 0.9308 1 158 GO:0016020

Map