F428354

General Info

Members Datasets Scaffolds Average Seq Length
379 213 758 98

Family's Representative Sequence

Representative Sequence 3300013105|Ga0157369_10632679|Ga0157369_106326791
Length 114
Sequence VSHEHSDDCLFAQQQEAHVALTWSRSVEWDTDDWRDVAACRDTDPDLFFPVGTTGPAIEQIEAAKAVCRACEAQPACLEFALATNQESGVWGGTSEEERRQLRKAWQARQRRAS

Samples

Sample ID Description Type Environment
1 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
2 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
3 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
4 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
7 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
24 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
25 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
30 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
31 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
32 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
33 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
34 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
35 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
36 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
37 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
38 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
39 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
41 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
42 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
44 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
46 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
47 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
48 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
49 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
50 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
51 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
52 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
53 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
54 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
55 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
56 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
57 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
58 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
59 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
60 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
61 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
62 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
63 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
64 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
65 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
66 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
67 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
68 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
69 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
70 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
71 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
72 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
73 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
89 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
91 3300030863 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
92 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
93 3300030889 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
94 3300030963 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
95 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
96 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
97 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
98 3300031636 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
99 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
100 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
101 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
102 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
103 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
104 3300036458 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
105 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
106 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
107 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
108 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
109 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
110 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
111 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
112 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
113 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
114 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
115 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
116 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
117 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
118 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
119 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
120 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
121 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
122 3300042119 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218L_E14_082316_1902 Metagenome Rhizosphere
123 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
124 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
125 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
126 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
127 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
128 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
129 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
130 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
131 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
132 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
133 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
134 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
135 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
136 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
137 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
138 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
139 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
140 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
141 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
142 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
143 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
144 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
145 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
146 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
147 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
148 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
149 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
150 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
151 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
152 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
153 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
154 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
155 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
156 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
157 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
158 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
159 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
160 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
161 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
162 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
163 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
164 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
165 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
166 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
167 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
181 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
182 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
183 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
184 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
185 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
186 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
187 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
188 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
189 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
190 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
191 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
192 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
195 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
196 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
197 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
198 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
199 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
200 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
201 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
202 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
203 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
204 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
205 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
206 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
207 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
208 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
209 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
210 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
211 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
212 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
213 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 88.13
Metatranscriptomes 11.87
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.11
Nodule 0
Rhizoplane 1.32
Rhizosphere 92.35
Stem 0
Stem Tuber 0
Unclassified 8.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157369_10632679 3300013105 Bacteria 1104
2 JGI25405J52794_10011265 3300003911 Bacteria 1711
3 Ga0058859_11559969 3300004798 Bacteria 739
4 Ga0058863_10020353 3300004799 Bacteria 805
5 Ga0058863_11803149 3300004799 Bacteria 640
6 Ga0058861_11940474 3300004800 Bacteria 500
7 Ga0058860_11943767 3300004801 Bacteria 527
8 Ga0058862_12823138 3300004803 Bacteria 537
9 Ga0070676_10217188 3300005328 Bacteria 1261
10 Ga0070680_101745459 3300005336 Bacteria 539
11 Ga0070661_100498666 3300005344 Bacteria 974
12 Ga0070669_101814428 3300005353 Bacteria 532
13 Ga0070675_102154292 3300005354 Bacteria 514
14 Ga0070673_101007199 3300005364 Bacteria 776
15 Ga0070714_100232891 3300005435 Unclassified 1697
16 Ga0070714_101804762 3300005435 Bacteria 597
17 Ga0070713_100375967 3300005436 Bacteria 1323
18 Ga0070713_100680077 3300005436 Bacteria 982
19 Ga0070694_101808136 3300005444 Bacteria 521
20 Ga0070708_100051233 3300005445 Bacteria 3657
21 Ga0070708_100581579 3300005445 Bacteria 1056
22 Ga0070678_100619958 3300005456 Bacteria 967
23 Ga0070662_100990552 3300005457 Bacteria 719
24 Ga0070706_100376132 3300005467 Bacteria 1323
25 Ga0070706_100449314 3300005467 Bacteria 1199
26 Ga0070699_100037566 3300005518 Bacteria 4192
27 Ga0070699_101058953 3300005518 Bacteria 744
28 Ga0070699_101846205 3300005518 Bacteria 553
29 Ga0070684_100816526 3300005535 Bacteria 872
30 Ga0070672_102085940 3300005543 Bacteria 511
31 Ga0070696_100311775 3300005546 Bacteria 1208
32 Ga0070693_101049177 3300005547 Bacteria 619
33 Ga0068855_100382512 3300005563 Bacteria 1545
34 Ga0068855_100798133 3300005563 Bacteria 1004
35 Ga0068856_100678038 3300005614 Bacteria 1051
36 Ga0068852_102485587 3300005616 Bacteria 538
37 Ga0068863_101262029 3300005841 Bacteria 745
38 Ga0081455_10007342 3300005937 Bacteria 11624
39 Ga0081455_10183168 3300005937 Bacteria 1584
40 Ga0081538_10000479 3300005981 Bacteria 44929
41 Ga0081538_10045027 3300005981 Bacteria 2741
42 Ga0081538_10059595 3300005981 Bacteria 2203
43 Ga0070717_11228547 3300006028 Bacteria 682
44 Ga0070717_11397036 3300006028 Bacteria 636
45 Ga0075367_10576403 3300006178 Bacteria 715
46 Ga0075428_100001321 3300006844 Bacteria 26248
47 Ga0075428_100031846 3300006844 Bacteria 5825
48 Ga0075428_100654397 3300006844 Bacteria 1120
49 Ga0075428_101607223 3300006844 Bacteria 680
50 Ga0075430_100021128 3300006846 Bacteria 5535
51 Ga0075430_100182644 3300006846 Bacteria 1744
52 Ga0075430_100340222 3300006846 Bacteria 1239
53 Ga0075430_100837545 3300006846 Unclassified 758
54 Ga0075430_101087101 3300006846 Bacteria 659
55 Ga0075430_101365900 3300006846 Bacteria 582
56 Ga0075431_100000794 3300006847 Bacteria 27545
57 Ga0075431_100049009 3300006847 Bacteria 4357
58 Ga0075431_100070089 3300006847 Bacteria 3617
59 Ga0075431_100382392 3300006847 Bacteria 1411
60 Ga0075431_100579404 3300006847 Unclassified 1108
61 Ga0075431_101005233 3300006847 Bacteria 801
62 Ga0075429_100000722 3300006880 Bacteria 25876
63 Ga0075429_100136488 3300006880 Bacteria 2147
64 Ga0075429_100152216 3300006880 Bacteria 2025
65 Ga0075429_100298133 3300006880 Bacteria 1411
66 Ga0075429_100876767 3300006880 Bacteria 785
67 Ga0075436_100231492 3300006914 Bacteria 1313
68 Ga0097620_100385980 3300006931 Bacteria 1496
69 Ga0075435_100265950 3300007076 Bacteria 1462
70 Ga0105240_12164261 3300009093 Unclassified 577
71 Ga0111539_10006247 3300009094 Bacteria 15375
72 Ga0111539_10095331 3300009094 Bacteria 3495
73 Ga0111539_10182686 3300009094 Bacteria 2449
74 Ga0111539_12995068 3300009094 Bacteria 546
75 Ga0105245_10480342 3300009098 Bacteria 1256
76 Ga0105245_11064903 3300009098 Bacteria 854
77 Ga0105245_13136823 3300009098 Bacteria 512
78 Ga0114129_10001368 3300009147 Bacteria 32779
79 Ga0114129_10083961 3300009147 Bacteria 4422
80 Ga0114129_10113215 3300009147 Bacteria 3741
81 Ga0114129_10279291 3300009147 Bacteria 2232
82 Ga0114129_10366245 3300009147 Bacteria 1906
83 Ga0105241_10042305 3300009174 Bacteria 3446
84 Ga0105241_12688661 3300009174 Bacteria 501
85 Ga0105242_10055456 3300009176 Bacteria 3242
86 Ga0105242_11324426 3300009176 Bacteria 745
87 Ga0105249_10544985 3300009553 Bacteria 1210
88 Ga0105239_10209874 3300010375 Bacteria 2183
89 Ga0105239_10814288 3300010375 Bacteria 1070
90 Ga0157370_10676295 3300013104 Bacteria 943
91 Ga0157369_10062990 3300013105 Bacteria 3996
92 Ga0157378_10566069 3300013297 Bacteria 1144
93 Ga0157378_12287334 3300013297 Bacteria 592
94 Ga0163162_11320747 3300013306 Bacteria 820
95 Ga0163162_11478368 3300013306 Bacteria 774
96 Ga0157372_10822224 3300013307 Bacteria 1079
97 Ga0163163_10529362 3300014325 Bacteria 1241
98 Ga0163163_12578253 3300014325 Unclassified 566
99 Ga0157380_10929605 3300014326 Bacteria 898
100 Ga0157377_10648461 3300014745 Bacteria 760
101 Ga0157376_10261573 3300014969 Bacteria 1621
102 Ga0157376_10516883 3300014969 Bacteria 1176
103 Ga0157376_11195537 3300014969 Bacteria 788
104 Ga0197907_10268845 3300020069 Unclassified 514
105 Ga0197907_10455053 3300020069 Bacteria 810
106 Ga0197907_10478353 3300020069 Bacteria 514
107 Ga0197907_10718342 3300020069 Bacteria 523
108 Ga0197907_11220531 3300020069 Bacteria 615
109 Ga0206356_10514399 3300020070 Bacteria 561
110 Ga0206356_10724875 3300020070 Bacteria 540
111 Ga0206356_11330522 3300020070 Bacteria 510
112 Ga0206356_11402279 3300020070 Unclassified 520
113 Ga0206349_1318353 3300020075 Bacteria 723
114 Ga0206355_1049508 3300020076 Bacteria 665
115 Ga0206355_1060289 3300020076 Bacteria 953
116 Ga0206355_1430424 3300020076 Unclassified 668
117 Ga0206351_10726852 3300020077 Bacteria 788
118 Ga0206352_10262115 3300020078 Bacteria 609
119 Ga0206352_10916732 3300020078 Unclassified 501
120 Ga0206352_11170890 3300020078 Bacteria 617
121 Ga0206350_10196607 3300020080 Bacteria 606
122 Ga0206350_10377604 3300020080 Bacteria 550
123 Ga0206350_10637443 3300020080 Bacteria 507
124 Ga0206354_10331552 3300020081 Bacteria 638
125 Ga0206354_10393149 3300020081 Bacteria 681
126 Ga0206354_10915317 3300020081 Unclassified 639
127 Ga0206353_10289586 3300020082 Bacteria 556
128 Ga0154015_1654138 3300020610 Bacteria 980
129 Ga0213873_10007939 3300021358 Bacteria 2147
130 Ga0213873_10020124 3300021358 Bacteria 1556
131 Ga0213876_10100307 3300021384 Bacteria 1535
132 Ga0213875_10020378 3300021388 Bacteria 3181
133 Ga0213875_10668216 3300021388 Bacteria 504
134 Ga0213871_10065799 3300021441 Bacteria 1016
135 Ga0224712_10340034 3300022467 Bacteria 708
136 Ga0224712_10517604 3300022467 Bacteria 578
137 Ga0224712_10578591 3300022467 Bacteria 547
138 Ga0224712_10629271 3300022467 Bacteria 525
139 Ga0224712_10682737 3300022467 Bacteria 505
140 Ga0224572_1064074 3300024225 Unclassified 679
141 Ga0207684_10155670 3300025910 Bacteria 1967
142 Ga0207684_10963263 3300025910 Bacteria 715
143 Ga0207654_10703697 3300025911 Bacteria 726
144 Ga0207657_10877156 3300025919 Bacteria 692
145 Ga0207649_10724400 3300025920 Bacteria 773
146 Ga0207687_10007018 3300025927 Bacteria 7425
147 Ga0207687_10551390 3300025927 Bacteria 967
148 Ga0207664_10247895 3300025929 Unclassified 1553
149 Ga0207664_11073129 3300025929 Bacteria 720
150 Ga0207706_11638573 3300025933 Unclassified 520
151 Ga0207686_10168284 3300025934 Unclassified 1543
152 Ga0207686_10957715 3300025934 Bacteria 693
153 Ga0207669_10823392 3300025937 Bacteria 771
154 Ga0207704_10262884 3300025938 Bacteria 1302
155 Ga0207667_10060693 3300025949 Bacteria 3958
156 Ga0207651_10875185 3300025960 Bacteria 799
157 Ga0207677_10512189 3300026023 Bacteria 1039
158 Ga0207702_11018779 3300026078 Bacteria 821
159 Ga0207641_11269689 3300026088 Bacteria 737
160 Ga0207428_10009345 3300027907 Bacteria 8794
161 Ga0207428_10119169 3300027907 Bacteria 2025
162 Ga0268264_10025670 3300028381 Bacteria 4813
163 Ga0265762_1098191 3300030760 Unclassified 646
164 Ga0265766_1015947 3300030863 Unclassified 585
165 Ga0265770_1115567 3300030878 Unclassified 560
166 Ga0265761_111909 3300030889 Unclassified 515
167 Ga0265768_114333 3300030963 Bacteria 543
168 Ga0265760_10350084 3300031090 Unclassified 529
169 Ga0265327_10000106 3300031251 Bacteria 184297
170 Ga0265327_10005406 3300031251 Bacteria 10661
171 Ga0265327_10093781 3300031251 Bacteria 1460
172 Ga0265327_10166237 3300031251 Bacteria 1016
173 Ga0265316_11153621 3300031344 Bacteria 537
174 Ga0310113_129137 3300031636 Bacteria 540
175 Ga0373939_0542298 3300035114 Bacteria 502
176 Ga0373953_0323917 3300035117 Bacteria 674
177 Ga0373955_0703474 3300035172 Bacteria 620
178 Ga0373933_0132956 3300035724 Bacteria 1566
179 Ga0373937_0032122 3300036401 Bacteria 4760
180 Ga0373937_0132230 3300036401 Bacteria 2331
181 Ga0373937_0859415 3300036401 Unclassified 856
182 Ga0373937_1651352 3300036401 Unclassified 588
183 Ga0310112_058949 3300036458 Unclassified 520
184 Ga0373925_1130736 3300037068 Unclassified 644
185 Ga0436364_0859107 3300037853 Bacteria 518
186 Ga0436364_1040690 3300037853 Bacteria 5419
187 Ga0400483_177964 3300039062 Bacteria 60146
188 Ga0436365_0082372 3300039437 Bacteria 610
189 Ga0436365_0430039 3300039437 Bacteria 8031
190 Ga0436365_1567540 3300039437 Bacteria 1547
191 Ga0436360_0254077 3300039438 Bacteria 1515
192 Ga0436360_1050025 3300039438 Bacteria 3182
193 Ga0436360_1216017 3300039438 Bacteria 693
194 Ga0436360_1310050 3300039438 Unclassified 508
195 Ga0436361_0806031 3300039447 Bacteria 1927
196 Ga0436363_1193462 3300039450 Bacteria 541
197 Ga0436363_1385771 3300039450 Bacteria 875
198 Ga0436362_0295615 3300039453 Bacteria 1899
199 Ga0436362_0428546 3300039453 Bacteria 17310
200 Ga0436362_0753771 3300039453 Bacteria 2702
201 Ga0436362_0779916 3300039453 Bacteria 604
202 Ga0436362_1158939 3300039453 Bacteria 541
203 Ga0451793_1126467 3300041452 Unclassified 1212
204 Ga0451800_0711587 3300041459 Bacteria 514
205 Ga0451802_2063312 3300041460 Bacteria 912
206 Ga0451853_0876186 3300041512 Bacteria 875
207 Ga0439448_0320381 3300042005 Bacteria 551
208 Ga0439450_026923 3300042008 Bacteria 1270
209 Ga0439451_016673 3300042009 Bacteria 1479
210 Ga0439455_0027786 3300042012 Bacteria 1389
211 Ga0439463_088148 3300042016 Bacteria 798
212 Ga0450915_018539 3300042119 Bacteria 543
213 Ga0450888_021909 3300042126 Bacteria 818
214 Ga0439435_0266927 3300042436 Bacteria 580
215 Ga0439444_0003732 3300042437 Bacteria 2171
216 Ga0439460_0145362 3300042461 Bacteria 788
217 Ga0439460_0357777 3300042461 Bacteria 515
218 Ga0450901_026005 3300042533 Bacteria 638
219 Ga0439440_0089963 3300042993 Bacteria 822
220 Ga0466969_0541094 3300044656 Bacteria 533
221 Ga0466966_0066342 3300044684 Bacteria 2268
222 Ga0466966_0249020 3300044684 Bacteria 1070
223 Ga0466966_0437130 3300044684 Unclassified 786
224 Ga0466961_0295001 3300044693 Bacteria 991
225 Ga0466968_0376412 3300044735 Bacteria 693
226 Ga0466959_0030793 3300045049 Bacteria 3973
227 Ga0466959_0325810 3300045049 Bacteria 1050
228 Ga0466959_0367359 3300045049 Bacteria 980
229 Ga0466958_0120547 3300045836 Bacteria 1642
230 Ga0466967_2500588 3300045976 Bacteria 511
231 Ga0495592_0420072 3300046454 Bacteria 843
232 Ga0495629_0086783 3300046459 Bacteria 2183
233 Ga0495641_0515197 3300046461 Bacteria 546
234 Ga0495651_0012445 3300046462 Bacteria 6561
235 Ga0495653_0043070 3300046463 Bacteria 3512
236 Ga0495653_0092806 3300046463 Bacteria 2203
237 Ga0495653_0569387 3300046463 Bacteria 699
238 Ga0495582_0387448 3300046473 Bacteria 806
239 Ga0495662_0584638 3300046476 Bacteria 546
240 Ga0495664_0089658 3300046477 Bacteria 1849
241 Ga0495664_0428896 3300046477 Bacteria 793
242 Ga0495608_0112252 3300046511 Bacteria 1752
243 Ga0495608_0308500 3300046511 Bacteria 979
244 Ga0495628_0305733 3300046516 Bacteria 1176
245 Ga0495628_0471321 3300046516 Bacteria 910
246 Ga0495628_0532663 3300046516 Unclassified 845
247 Ga0495628_0935078 3300046516 Bacteria 600
248 Ga0495586_0158226 3300046535 Bacteria 1277
249 Ga0495587_0136444 3300046536 Bacteria 1401
250 Ga0495587_0554388 3300046536 Bacteria 634
251 Ga0495645_0544614 3300046543 Bacteria 720
252 Ga0495667_0039333 3300046559 Bacteria 3145
253 Ga0495667_0239775 3300046559 Bacteria 1155
254 Ga0495634_0005676 3300046642 Bacteria 9551
255 Ga0495634_0146284 3300046642 Bacteria 1497
256 Ga0495635_0207626 3300046663 Bacteria 1327
257 Ga0495635_0712403 3300046663 Bacteria 650
258 Ga0495659_0466565 3300046664 Bacteria 551
259 Ga0495588_0129172 3300046674 Bacteria 1333
260 Ga0495657_0139883 3300046675 Bacteria 1509
261 Ga0495657_0438479 3300046675 Bacteria 766
262 Ga0495599_0207066 3300046678 Bacteria 1204
263 Ga0495623_0009236 3300046679 Bacteria 6400
264 Ga0495658_0053042 3300046683 Bacteria 2302
265 Ga0495613_0000416 3300046689 Bacteria 36518
266 Ga0495613_0585833 3300046689 Unclassified 743
267 Ga0495600_0037082 3300046809 Bacteria 3169
268 Ga0495600_0522587 3300046809 Bacteria 727
269 Ga0495604_0121138 3300047317 Bacteria 1894
270 Ga0495604_0861172 3300047317 Bacteria 568
271 Ga0495674_0965128 3300047319 Bacteria 655
272 Ga0495676_0084750 3300047321 Bacteria 2390
273 Ga0495680_0001600 3300047322 Bacteria 24140
274 Ga0495680_0368029 3300047322 Unclassified 998
275 Ga0495680_0504045 3300047322 Bacteria 821
276 Ga0495675_0034258 3300047444 Bacteria 3242
277 Ga0495602_0018630 3300048088 Bacteria 6924
278 Ga0496114_0358393 3300048917 Bacteria 1290
279 Ga0496114_1675872 3300048917 Bacteria 524
280 Ga0501032_0008437 3300049569 Bacteria 7513
281 Ga0501033_0513218 3300049570 Bacteria 828
282 Ga0501034_0033950 3300049571 Bacteria 5172
283 Ga0501034_0086017 3300049571 Bacteria 3145
284 Ga0501034_0131548 3300049571 Bacteria 2485
285 Ga0501034_0795143 3300049571 Bacteria 839
286 Ga0501036_0378070 3300049572 Bacteria 1182
287 Ga0501036_0810865 3300049572 Bacteria 770
288 Ga0501037_0028393 3300049573 Bacteria 4132
289 Ga0501038_0091105 3300049574 Bacteria 2555
290 Ga0501039_0012162 3300049575 Bacteria 6563
291 Ga0501039_0513301 3300049575 Bacteria 941
292 Ga0501040_0009747 3300049576 Bacteria 6270
293 Ga0501040_0052037 3300049576 Bacteria 2803
294 Ga0501041_0142767 3300049577 Bacteria 1493
295 Ga0501041_0242528 3300049577 Bacteria 1133
296 Ga0501042_0304916 3300049578 Bacteria 1150
297 Ga0501043_0067791 3300049579 Bacteria 2802
298 Ga0501043_0207703 3300049579 Bacteria 1518
299 Ga0501046_0006604 3300049580 Bacteria 10245
300 Ga0501046_0217808 3300049580 Bacteria 1415
301 Ga0501048_0160113 3300049582 Bacteria 1593
302 Ga0501048_0311828 3300049582 Bacteria 1120
303 Ga0501067_0777274 3300049583 Bacteria 539
304 Ga0501068_0609815 3300049584 Bacteria 711
305 Ga0501070_0202430 3300049586 Bacteria 1630
306 Ga0501070_0215934 3300049586 Bacteria 1573
307 Ga0501071_0021691 3300049587 Bacteria 4477
308 Ga0501071_0633787 3300049587 Bacteria 822
309 Ga0501072_0009803 3300049588 Bacteria 7284
310 Ga0501072_0408277 3300049588 Bacteria 1077
311 Ga0501072_0738931 3300049588 Unclassified 772
312 Ga0501074_0224553 3300049590 Bacteria 1337
313 Ga0501074_0696500 3300049590 Bacteria 717
314 Ga0501075_0103641 3300049591 Bacteria 2162
315 Ga0501076_0059513 3300049592 Bacteria 3039
316 Ga0501077_0153518 3300049593 Bacteria 1461
317 Ga0501079_0013393 3300049741 Bacteria 6255
318 Ga0501079_0267909 3300049741 Bacteria 1335
319 Ga0501079_0449232 3300049741 Bacteria 1012
320 Ga0501080_0113921 3300049742 Bacteria 2507
321 Ga0501080_0125451 3300049742 Bacteria 2378
322 Ga0501080_0229681 3300049742 Bacteria 1696
323 Ga0501081_0278889 3300049743 Bacteria 1223
324 Ga0501081_0550192 3300049743 Bacteria 862
325 Ga0501035_0045995 3300049822 Bacteria 3926
326 Ga0501035_0049960 3300049822 Bacteria 3749
327 Ga0501035_0264320 3300049822 Bacteria 1458
328 Ga0501044_0036143 3300049823 Bacteria 5168
329 Ga0501044_1359593 3300049823 Bacteria 576
330 Ga0501045_0027633 3300049824 Bacteria 4090
331 nmdc:mga0yw44_10688_c1 3300050492 Bacteria 4700
332 nmdc:mga0yw44_779918_c1 3300050492 Bacteria 649
333 nmdc:mga06z11_394041_c1 3300050494 Bacteria 833
334 nmdc:mga06z11_66139_c1 3300050494 Bacteria 1899
335 nmdc:mga04h51_28832_c1 3300050495 Bacteria 1734
336 nmdc:mga05p37_1012121_c1 3300050507 Bacteria 881
337 nmdc:mga05p37_304701_c1 3300050507 Bacteria 1891
338 nmdc:mga05p37_31461_c1 3300050507 Bacteria 6481
339 nmdc:mga05p37_373_c1 3300050507 Bacteria 48181
340 nmdc:mga05p37_461714_c1 3300050507 Bacteria 1467
341 nmdc:mga05p37_547156_c1 3300050507 Bacteria 1319
342 nmdc:mga09592_107517_c1 3300050508 Bacteria 2393
343 nmdc:mga09592_157399_c1 3300050508 Bacteria 1961
344 nmdc:mga09592_562682_c1 3300050508 Bacteria 979
345 nmdc:mga09592_826_c1 3300050508 Bacteria 23970
346 nmdc:mga0qj67_1970_c1 3300050509 Bacteria 14618
347 nmdc:mga0qj67_220918_c1 3300050509 Bacteria 1538
348 nmdc:mga0qj67_265347_c1 3300050509 Bacteria 1393
349 nmdc:mga0qj67_514362_c1 3300050509 Bacteria 962
350 nmdc:mga06r32_131329_c1 3300050510 Bacteria 2477
351 nmdc:mga06r32_38014_c1 3300050510 Bacteria 4557
352 nmdc:mga06r32_653184_c1 3300050510 Unclassified 1020
353 nmdc:mga06r32_75569_c1 3300050510 Bacteria 3270
354 nmdc:mga06r32_796_c1 3300050510 Bacteria 27911
355 nmdc:mga06r32_901797_c1 3300050510 Bacteria 840
356 nmdc:mga08y16_25077_c1 3300050511 Bacteria 6290
357 nmdc:mga08y16_29228_c1 3300050511 Bacteria 5809
358 nmdc:mga08y16_490264_c1 3300050511 Bacteria 1250
359 nmdc:mga0rr50_111384_c1 3300050513 Bacteria 2166
360 nmdc:mga08x19_223547_c1 3300050514 Bacteria 1294
361 Ga0495601_0291729 3300053077 Unclassified 1063
362 Ga0495601_0292613 3300053077 Bacteria 1061
363 Ga0495601_0578104 3300053077 Unclassified 722
364 Ga0495595_0015243 3300053084 Bacteria 3275
365 Ga0495595_0028341 3300053084 Bacteria 2501
366 Ga0495595_0395398 3300053084 Bacteria 700
367 Ga0495619_0098262 3300053085 Bacteria 1990
368 Ga0495619_0502964 3300053085 Bacteria 833
369 Ga0495619_0794465 3300053085 Unclassified 640
370 Ga0500568_0006944 3300053139 Bacteria 5615
371 Ga0500616_0001388 3300053153 Bacteria 23407
372 Ga0501084_0005209 3300054114 Bacteria 10640
373 Ga0501084_0628877 3300054114 Bacteria 906
374 Ga0501084_1338087 3300054114 Bacteria 600
375 Ga0587082_158466 3300059504 Bacteria 541
376 Ga0501082_0053685 3300060353 Bacteria 3473
377 Ga0530510_0001570 3300061734 Bacteria 15396
378 Ga0530510_0005238 3300061734 Bacteria 8954
379 Ga0530510_0084950 3300061734 Bacteria 2305
380 Ga0157369_10632679
381 JGI25405J52794_10011265
382 Ga0058859_11559969
383 Ga0058863_10020353
384 Ga0058863_11803149
385 Ga0058861_11940474
386 Ga0058860_11943767
387 Ga0058862_12823138
388 Ga0070676_10217188
389 Ga0070680_101745459
390 Ga0070661_100498666
391 Ga0070669_101814428
392 Ga0070675_102154292
393 Ga0070673_101007199
394 Ga0070714_100232891
395 Ga0070714_101804762
396 Ga0070713_100375967
397 Ga0070713_100680077
398 Ga0070694_101808136
399 Ga0070708_100051233
400 Ga0070708_100581579
401 Ga0070678_100619958
402 Ga0070662_100990552
403 Ga0070706_100376132
404 Ga0070706_100449314
405 Ga0070699_100037566
406 Ga0070699_101058953
407 Ga0070699_101846205
408 Ga0070684_100816526
409 Ga0070672_102085940
410 Ga0070696_100311775
411 Ga0070693_101049177
412 Ga0068855_100382512
413 Ga0068855_100798133
414 Ga0068856_100678038
415 Ga0068852_102485587
416 Ga0068863_101262029
417 Ga0081455_10007342
418 Ga0081455_10183168
419 Ga0081538_10000479
420 Ga0081538_10045027
421 Ga0081538_10059595
422 Ga0070717_11228547
423 Ga0070717_11397036
424 Ga0075367_10576403
425 Ga0075428_100001321
426 Ga0075428_100031846
427 Ga0075428_100654397
428 Ga0075428_101607223
429 Ga0075430_100021128
430 Ga0075430_100182644
431 Ga0075430_100340222
432 Ga0075430_100837545
433 Ga0075430_101087101
434 Ga0075430_101365900
435 Ga0075431_100000794
436 Ga0075431_100049009
437 Ga0075431_100070089
438 Ga0075431_100382392
439 Ga0075431_100579404
440 Ga0075431_101005233
441 Ga0075429_100000722
442 Ga0075429_100136488
443 Ga0075429_100152216
444 Ga0075429_100298133
445 Ga0075429_100876767
446 Ga0075436_100231492
447 Ga0097620_100385980
448 Ga0075435_100265950
449 Ga0105240_12164261
450 Ga0111539_10006247
451 Ga0111539_10095331
452 Ga0111539_10182686
453 Ga0111539_12995068
454 Ga0105245_10480342
455 Ga0105245_11064903
456 Ga0105245_13136823
457 Ga0114129_10001368
458 Ga0114129_10083961
459 Ga0114129_10113215
460 Ga0114129_10279291
461 Ga0114129_10366245
462 Ga0105241_10042305
463 Ga0105241_12688661
464 Ga0105242_10055456
465 Ga0105242_11324426
466 Ga0105249_10544985
467 Ga0105239_10209874
468 Ga0105239_10814288
469 Ga0157370_10676295
470 Ga0157369_10062990
471 Ga0157378_10566069
472 Ga0157378_12287334
473 Ga0163162_11320747
474 Ga0163162_11478368
475 Ga0157372_10822224
476 Ga0163163_10529362
477 Ga0163163_12578253
478 Ga0157380_10929605
479 Ga0157377_10648461
480 Ga0157376_10261573
481 Ga0157376_10516883
482 Ga0157376_11195537
483 Ga0197907_10268845
484 Ga0197907_10455053
485 Ga0197907_10478353
486 Ga0197907_10718342
487 Ga0197907_11220531
488 Ga0206356_10514399
489 Ga0206356_10724875
490 Ga0206356_11330522
491 Ga0206356_11402279
492 Ga0206349_1318353
493 Ga0206355_1049508
494 Ga0206355_1060289
495 Ga0206355_1430424
496 Ga0206351_10726852
497 Ga0206352_10262115
498 Ga0206352_10916732
499 Ga0206352_11170890
500 Ga0206350_10196607
501 Ga0206350_10377604
502 Ga0206350_10637443
503 Ga0206354_10331552
504 Ga0206354_10393149
505 Ga0206354_10915317
506 Ga0206353_10289586
507 Ga0154015_1654138
508 Ga0213873_10007939
509 Ga0213873_10020124
510 Ga0213876_10100307
511 Ga0213875_10020378
512 Ga0213875_10668216
513 Ga0213871_10065799
514 Ga0224712_10340034
515 Ga0224712_10517604
516 Ga0224712_10578591
517 Ga0224712_10629271
518 Ga0224712_10682737
519 Ga0224572_1064074
520 Ga0207684_10155670
521 Ga0207684_10963263
522 Ga0207654_10703697
523 Ga0207657_10877156
524 Ga0207649_10724400
525 Ga0207687_10007018
526 Ga0207687_10551390
527 Ga0207664_10247895
528 Ga0207664_11073129
529 Ga0207706_11638573
530 Ga0207686_10168284
531 Ga0207686_10957715
532 Ga0207669_10823392
533 Ga0207704_10262884
534 Ga0207667_10060693
535 Ga0207651_10875185
536 Ga0207677_10512189
537 Ga0207702_11018779
538 Ga0207641_11269689
539 Ga0207428_10009345
540 Ga0207428_10119169
541 Ga0268264_10025670
542 Ga0265762_1098191
543 Ga0265766_1015947
544 Ga0265770_1115567
545 Ga0265761_111909
546 Ga0265768_114333
547 Ga0265760_10350084
548 Ga0265327_10000106
549 Ga0265327_10005406
550 Ga0265327_10093781
551 Ga0265327_10166237
552 Ga0265316_11153621
553 Ga0310113_129137
554 Ga0373939_0542298
555 Ga0373953_0323917
556 Ga0373955_0703474
557 Ga0373933_0132956
558 Ga0373937_0032122
559 Ga0373937_0132230
560 Ga0373937_0859415
561 Ga0373937_1651352
562 Ga0310112_058949
563 Ga0373925_1130736
564 Ga0436364_0859107
565 Ga0436364_1040690
566 Ga0400483_177964
567 Ga0436365_0082372
568 Ga0436365_0430039
569 Ga0436365_1567540
570 Ga0436360_0254077
571 Ga0436360_1050025
572 Ga0436360_1216017
573 Ga0436360_1310050
574 Ga0436361_0806031
575 Ga0436363_1193462
576 Ga0436363_1385771
577 Ga0436362_0295615
578 Ga0436362_0428546
579 Ga0436362_0753771
580 Ga0436362_0779916
581 Ga0436362_1158939
582 Ga0451793_1126467
583 Ga0451800_0711587
584 Ga0451802_2063312
585 Ga0451853_0876186
586 Ga0439448_0320381
587 Ga0439450_026923
588 Ga0439451_016673
589 Ga0439455_0027786
590 Ga0439463_088148
591 Ga0450915_018539
592 Ga0450888_021909
593 Ga0439435_0266927
594 Ga0439444_0003732
595 Ga0439460_0145362
596 Ga0439460_0357777
597 Ga0450901_026005
598 Ga0439440_0089963
599 Ga0466969_0541094
600 Ga0466966_0066342
601 Ga0466966_0249020
602 Ga0466966_0437130
603 Ga0466961_0295001
604 Ga0466968_0376412
605 Ga0466959_0030793
606 Ga0466959_0325810
607 Ga0466959_0367359
608 Ga0466958_0120547
609 Ga0466967_2500588
610 Ga0495592_0420072
611 Ga0495629_0086783
612 Ga0495641_0515197
613 Ga0495651_0012445
614 Ga0495653_0043070
615 Ga0495653_0092806
616 Ga0495653_0569387
617 Ga0495582_0387448
618 Ga0495662_0584638
619 Ga0495664_0089658
620 Ga0495664_0428896
621 Ga0495608_0112252
622 Ga0495608_0308500
623 Ga0495628_0305733
624 Ga0495628_0471321
625 Ga0495628_0532663
626 Ga0495628_0935078
627 Ga0495586_0158226
628 Ga0495587_0136444
629 Ga0495587_0554388
630 Ga0495645_0544614
631 Ga0495667_0039333
632 Ga0495667_0239775
633 Ga0495634_0005676
634 Ga0495634_0146284
635 Ga0495635_0207626
636 Ga0495635_0712403
637 Ga0495659_0466565
638 Ga0495588_0129172
639 Ga0495657_0139883
640 Ga0495657_0438479
641 Ga0495599_0207066
642 Ga0495623_0009236
643 Ga0495658_0053042
644 Ga0495613_0000416
645 Ga0495613_0585833
646 Ga0495600_0037082
647 Ga0495600_0522587
648 Ga0495604_0121138
649 Ga0495604_0861172
650 Ga0495674_0965128
651 Ga0495676_0084750
652 Ga0495680_0001600
653 Ga0495680_0368029
654 Ga0495680_0504045
655 Ga0495675_0034258
656 Ga0495602_0018630
657 Ga0496114_0358393
658 Ga0496114_1675872
659 Ga0501032_0008437
660 Ga0501033_0513218
661 Ga0501034_0033950
662 Ga0501034_0086017
663 Ga0501034_0131548
664 Ga0501034_0795143
665 Ga0501036_0378070
666 Ga0501036_0810865
667 Ga0501037_0028393
668 Ga0501038_0091105
669 Ga0501039_0012162
670 Ga0501039_0513301
671 Ga0501040_0009747
672 Ga0501040_0052037
673 Ga0501041_0142767
674 Ga0501041_0242528
675 Ga0501042_0304916
676 Ga0501043_0067791
677 Ga0501043_0207703
678 Ga0501046_0006604
679 Ga0501046_0217808
680 Ga0501048_0160113
681 Ga0501048_0311828
682 Ga0501067_0777274
683 Ga0501068_0609815
684 Ga0501070_0202430
685 Ga0501070_0215934
686 Ga0501071_0021691
687 Ga0501071_0633787
688 Ga0501072_0009803
689 Ga0501072_0408277
690 Ga0501072_0738931
691 Ga0501074_0224553
692 Ga0501074_0696500
693 Ga0501075_0103641
694 Ga0501076_0059513
695 Ga0501077_0153518
696 Ga0501079_0013393
697 Ga0501079_0267909
698 Ga0501079_0449232
699 Ga0501080_0113921
700 Ga0501080_0125451
701 Ga0501080_0229681
702 Ga0501081_0278889
703 Ga0501081_0550192
704 Ga0501035_0045995
705 Ga0501035_0049960
706 Ga0501035_0264320
707 Ga0501044_0036143
708 Ga0501044_1359593
709 Ga0501045_0027633
710 nmdc:mga0yw44_10688_c1
711 nmdc:mga0yw44_779918_c1
712 nmdc:mga06z11_394041_c1
713 nmdc:mga06z11_66139_c1
714 nmdc:mga04h51_28832_c1
715 nmdc:mga05p37_1012121_c1
716 nmdc:mga05p37_304701_c1
717 nmdc:mga05p37_31461_c1
718 nmdc:mga05p37_373_c1
719 nmdc:mga05p37_461714_c1
720 nmdc:mga05p37_547156_c1
721 nmdc:mga09592_107517_c1
722 nmdc:mga09592_157399_c1
723 nmdc:mga09592_562682_c1
724 nmdc:mga09592_826_c1
725 nmdc:mga0qj67_1970_c1
726 nmdc:mga0qj67_220918_c1
727 nmdc:mga0qj67_265347_c1
728 nmdc:mga0qj67_514362_c1
729 nmdc:mga06r32_131329_c1
730 nmdc:mga06r32_38014_c1
731 nmdc:mga06r32_653184_c1
732 nmdc:mga06r32_75569_c1
733 nmdc:mga06r32_796_c1
734 nmdc:mga06r32_901797_c1
735 nmdc:mga08y16_25077_c1
736 nmdc:mga08y16_29228_c1
737 nmdc:mga08y16_490264_c1
738 nmdc:mga0rr50_111384_c1
739 nmdc:mga08x19_223547_c1
740 Ga0495601_0291729
741 Ga0495601_0292613
742 Ga0495601_0578104
743 Ga0495595_0015243
744 Ga0495595_0028341
745 Ga0495595_0395398
746 Ga0495619_0098262
747 Ga0495619_0502964
748 Ga0495619_0794465
749 Ga0500568_0006944
750 Ga0500616_0001388
751 Ga0501084_0005209
752 Ga0501084_0628877
753 Ga0501084_1338087
754 Ga0587082_158466
755 Ga0501082_0053685
756 Ga0530510_0001570
757 Ga0530510_0005238
758 Ga0530510_0084950

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02467

Whib

Transcription factor WhiB

34

102

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
6onu-assembly3.cif.gz_E complex structure of whib1 and region 4 of siga in p21 space group. 0.8263 17 86
8cwt-assembly1.cif.gz_A complex structure of whib3 and the sigmaar4-rnap beta flap tip chimera in space group p43212 0.8211 17 86
7kuf-assembly1.cif.gz_A transcription activation subcomplex with whib7 bound to sigmaar4-rnap beta flap tip chimera and dna 0.7969 23 77
6onu-assembly3.cif.gz_E complex structure of whib1 and region 4 of siga in p21 space group. 0.7966 17 86
8dy9-assembly1.cif.gz_H streptomyces venezuelae rnap unconstrained open promoter complex with whia and whib transcription factors 0.7869 11 88
ID Description Score Start End Superfamily
af_A4I561_623_777_1.25.40.240 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Ku, C-terminal domain 0.4169 31 70 1.25.40.240
af_E7EXN2_13_91_1.10.10.60 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.3719 12 98 1.10.10.60
af_E7EXN2_13_91_1.10.10.60 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.354 12 98 1.10.10.60
af_Q2RA30_2_105_1.20.58.90 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.3115 17 96 1.20.58.90
af_Q7JY00_24_121_1.20.58.90 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.297 17 97 1.20.58.90
ID Description Score Start End GO Terms
AF-A0A0Q9KJF9-F1-model_v4 Transcriptional regulator WhiB 0.8902 18 87 GO:0003677
GO:0005737
GO:0035731
GO:0045454
GO:0045892
GO:0046872
GO:0047134
GO:0051539
AF-A0A2D4XG37-F1-model_v4 Transcriptional regulator WhiB 0.8883 20 92 GO:0003677
GO:0005737
GO:0035731
GO:0045454
GO:0045892
GO:0046872
GO:0047134
GO:0051539
AF-A0A5N8XI86-F1-model_v4 Transcriptional regulator WhiB 0.8868 17 88 GO:0003677
GO:0005737
GO:0035731
GO:0045454
GO:0045892
GO:0046872
GO:0047134
GO:0051539
AF-A0A7V0IS91-F1-model_v4 Transcriptional regulator WhiB 0.8848 17 98 GO:0003677
GO:0005737
GO:0035731
GO:0045454
GO:0045892
GO:0046872
GO:0047134
GO:0051539
AF-A0A7K0P0Q8-F1-model_v4 Transcriptional regulator WhiB 0.8823 17 88 GO:0003677
GO:0005737
GO:0035731
GO:0045454
GO:0045892
GO:0046872
GO:0047134
GO:0051539

Map