F428174

General Info

Members Datasets Scaffolds Average Seq Length
378 251 756 331

Family's Representative Sequence

Representative Sequence 3300050496|nmdc:mga07m45_102428_c1|nmdc:mga07m45_102428_c1_442_1548
Length 363
Sequence MRRKEPTRHDAKRREMARQAPPSIPSQTETTMTFRMDRRRVLLAGAAGLGASALSLPRVARAAAYPSERAITFICPWPAGGTADVTMRALCQAAAKVLGQTVIIENRAGASGMLGTKVLSTAKPDGYTIGQVPISVTRFAQLRTVQLDPLKDLTYLARVNGQTFGLAVRADSPWKTLAEFVAAAKAKPGLISYGSAGIGGATHVGMEEFNLLAGIQLNHIPYKGGAPALQDLLGGQVDAVADSSSWAPHVKSGKLRLLVTWGETRTKDFPAVPTLKESGYDLVVDAPNGIGAPKGMDPAIVARLRDAFRKATADPEFIAVCDRIDAPVMYLDQPDYEKYIQATYRKDTQLIERLKLRELLAKG

Samples

Sample ID Description Type Environment
1 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
2 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
3 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
4 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
9 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
10 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
11 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
12 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
13 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
14 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
15 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
16 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
17 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
18 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
19 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
20 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
21 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
22 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
23 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
24 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
39 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
40 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
41 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
42 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
43 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
44 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
45 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
46 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
47 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
48 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
49 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
50 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
51 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
52 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
53 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
54 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
55 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
61 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
62 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
63 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
64 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
65 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
68 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
69 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
70 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
71 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
72 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
73 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
75 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
76 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
77 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
79 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
80 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
99 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
100 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
101 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
102 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
103 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
104 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
106 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
107 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
108 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
109 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
110 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
111 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
112 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
113 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
114 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
115 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
116 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
117 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
118 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
119 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
120 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
121 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
122 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
123 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
124 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
125 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
126 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
127 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
128 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
129 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
130 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
131 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
132 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
133 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
134 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
135 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
136 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
137 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
138 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
139 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
140 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
141 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
142 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
143 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
144 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
145 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
146 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
147 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
148 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
149 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
150 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
151 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
152 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
153 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
154 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
155 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
156 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
157 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
158 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
159 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
160 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
161 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
162 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
163 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
164 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
165 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
166 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
167 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
168 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
169 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
170 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
171 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
172 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
173 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
174 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
175 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
176 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
177 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
178 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
179 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
180 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
181 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
182 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
183 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
184 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
185 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
186 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
187 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
189 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
190 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
191 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
192 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
193 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
194 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
195 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
196 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
197 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
198 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
199 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
200 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
201 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
202 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
203 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
204 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
205 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
206 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
207 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
208 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
209 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
210 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
211 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
212 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
213 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
214 2513237150 Cupriavidus taiwanensis STM6018 Isolate Nodule
215 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
216 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
217 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
218 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
219 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
220 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
221 2643221594 Achromobacter sp. Root170 Isolate Unclassified
222 2643221609 Acidovorax sp. Root217 Isolate Unclassified
223 2643221611 Acidovorax sp. Root219 Isolate Unclassified
224 2643221621 Achromobacter sp. Root83 Isolate Unclassified
225 2643221658 Variovorax sp. Root411 Isolate Unclassified
226 2643221672 Variovorax sp. Root434 Isolate Unclassified
227 2721755523 Delftia sp. HK171 Isolate Unclassified
228 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
229 2816332133 Acidovorax radicis 2721A Isolate Unclassified
230 2831864461 Roseateles noduli HZ7 Isolate Nodule
231 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
232 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
233 2842677519 Variovorax sp. R-72495 Isolate Unclassified
234 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
235 2855730933 Achromobacter sp. HZ28 Isolate Nodule
236 2855767633 Achromobacter sp. HZ34 Isolate Nodule
237 2858688981 Cupriavidus sp. UYMMa02A Isolate Unclassified
238 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
239 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
240 2886848708 Mitsuaria sp. TWR114 Isolate Rhizosphere
241 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
242 2904456579 Variovorax sp. 2002 Isolate Unclassified
243 2928070936 Variovorax gossypii 1167 Isolate Unclassified
244 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
245 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
246 2929520902 Variovorax beijingensis 502 Isolate Unclassified
247 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
248 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
249 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
250 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule
251 8003400568 Cupriavidus gilardii USM5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.15
Metatranscriptomes 0.53
Isolates 10.32

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 38.62
Nodule 3.44
Rhizoplane 1.59
Rhizosphere 41.01
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga07m45_102428_c1 3300050496 Bacteria 1644
2 JGI25152J39213_1012368 3300002773 Bacteria 1837
3 JGI25159J45721_1000399 3300002987 Bacteria 20252
4 JGI25159J45721_1001437 3300002987 Bacteria 9837
5 JGI25151J46595_10000620 3300003187 Bacteria 30977
6 JGI25151J46595_10001207 3300003187 Bacteria 18524
7 JGI25151J46595_10003582 3300003187 Bacteria 8513
8 rootH2_10017886 3300003320 Bacteria 6964
9 rootL2_10000180 3300003322 Bacteria 87226
10 rootL2_10154501 3300003322 Bacteria 1821
11 rootH1_10019495 3300003323 Bacteria 26145
12 JGI25160J50197_1000467 3300003354 Bacteria 25023
13 JGI25161J50226_1000041 3300003374 Bacteria 124485
14 Ga0006562J51391_1139586 3300003578 Bacteria 3680
15 Ga0006562J51391_1139587 3300003578 Bacteria 2430
16 Ga0055525_1000036 3300003759 Bacteria 298878
17 Ga0055526_1001227 3300003771 Bacteria 18440
18 Ga0055526_1001591 3300003771 Bacteria 15934
19 Ga0055526_1009962 3300003771 Bacteria 4491
20 Ga0055526_1011324 3300003771 Bacteria 4033
21 Ga0055526_1024569 3300003771 Bacteria 1966
22 Ga0055537_1001341 3300003773 Bacteria 10023
23 Ga0055524_1000123 3300003775 Bacteria 90603
24 Ga0055524_1010962 3300003775 Bacteria 3571
25 Ga0055524_1019735 3300003775 Bacteria 2294
26 Ga0055536_1000026 3300003781 Bacteria 166220
27 Ga0055536_1002283 3300003781 Bacteria 10890
28 Ga0055534_1000093 3300003784 Bacteria 70047
29 Ga0055534_1001846 3300003784 Bacteria 7906
30 Ga0055530_10034463 3300003791 Bacteria 1293
31 Ga0055540_1001224 3300003792 Bacteria 15781
32 Ga0055540_1021101 3300003792 Bacteria 1702
33 Ga0055531_10001112 3300003794 Bacteria 20889
34 Ga0055531_10004234 3300003794 Bacteria 8828
35 Ga0055531_10006039 3300003794 Bacteria 6945
36 Ga0055543_1000772 3300004625 Bacteria 15952
37 Ga0055543_1002841 3300004625 Bacteria 5460
38 Ga0065165_1000476 3300005262 Bacteria 62550
39 Ga0065714_10003410 3300005288 Bacteria 8650
40 Ga0065704_10099718 3300005289 Bacteria 2300
41 Ga0070670_100030821 3300005331 Bacteria 4618
42 Ga0070669_100150843 3300005353 Bacteria 1799
43 Ga0070675_100091157 3300005354 Bacteria 2553
44 Ga0070674_100064424 3300005356 Bacteria 2568
45 Ga0070673_100196108 3300005364 Bacteria 1737
46 Ga0070663_100008041 3300005455 Bacteria 6466
47 Ga0070678_100046111 3300005456 Bacteria 3123
48 Ga0070706_100002762 3300005467 Bacteria 17556
49 Ga0070707_100067611 3300005468 Bacteria 3438
50 Ga0070698_100165293 3300005471 Bacteria 2156
51 Ga0070665_100016828 3300005548 Bacteria 7332
52 Ga0068857_100170154 3300005577 Bacteria 1980
53 Ga0068857_100309929 3300005577 Bacteria 1456
54 Ga0068854_100024099 3300005578 Bacteria 4163
55 Ga0068852_100140470 3300005616 Bacteria 2234
56 Ga0068862_100051232 3300005844 Bacteria 3530
57 Ga0081455_10097318 3300005937 Bacteria 2371
58 Ga0075365_10010243 3300006038 Bacteria 5448
59 Ga0075368_10004741 3300006042 Bacteria 4628
60 Ga0075368_10018409 3300006042 Bacteria 2625
61 Ga0075363_100162642 3300006048 Bacteria 1264
62 Ga0075364_10006140 3300006051 Bacteria 7030
63 Ga0075364_10012169 3300006051 Bacteria 5253
64 Ga0075364_10045109 3300006051 Bacteria 2869
65 Ga0075364_10193351 3300006051 Bacteria 1378
66 Ga0075432_10005029 3300006058 Bacteria 4502
67 Ga0075432_10017210 3300006058 Bacteria 2466
68 Ga0075362_10001104 3300006177 Bacteria 8380
69 Ga0075362_10005112 3300006177 Bacteria 4775
70 Ga0075362_10007452 3300006177 Bacteria 4146
71 Ga0075362_10008402 3300006177 Bacteria 3945
72 Ga0075362_10084803 3300006177 Bacteria 1464
73 Ga0075367_10003811 3300006178 Bacteria 7268
74 Ga0075367_10012736 3300006178 Bacteria 4499
75 Ga0075366_10016512 3300006195 Bacteria 4246
76 Ga0075366_10039455 3300006195 Bacteria 2792
77 Ga0075366_10053983 3300006195 Bacteria 2387
78 Ga0075366_10063198 3300006195 Bacteria 2200
79 Ga0075366_10083356 3300006195 Bacteria 1911
80 Ga0075366_10107832 3300006195 Bacteria 1675
81 Ga0075370_10007482 3300006353 Bacteria 5565
82 Ga0075370_10009595 3300006353 Bacteria 5033
83 Ga0075370_10034918 3300006353 Bacteria 2820
84 Ga0075370_10053620 3300006353 Bacteria 2289
85 Ga0075370_10124740 3300006353 Bacteria 1500
86 Ga0075430_100321399 3300006846 Bacteria 1279
87 Ga0075429_100002378 3300006880 Bacteria 15843
88 Ga0099823_1000061 3300006944 Bacteria 52139
89 Ga0079104_1000003 3300006946 Bacteria 468966
90 Ga0099826_10000036 3300006948 Bacteria 104982
91 Ga0099826_10063652 3300006948 Bacteria 2382
92 Ga0105244_10023673 3300009036 Bacteria 3364
93 Ga0105250_10035468 3300009092 Bacteria 2001
94 Ga0105240_10049118 3300009093 Bacteria 5328
95 Ga0105243_10021355 3300009148 Bacteria 4914
96 Ga0105243_10103420 3300009148 Bacteria 2368
97 Ga0105237_10043943 3300009545 Bacteria 4499
98 Ga0105239_10022095 3300010375 Bacteria 7013
99 Ga0157319_1000004 3300012497 Bacteria 394735
100 Ga0157373_10005691 3300013100 Bacteria 9340
101 Ga0182008_10060745 3300014497 Bacteria 1863
102 Ga0182008_10086470 3300014497 Bacteria 1544
103 Ga0163161_10050930 3300017792 Bacteria 2998
104 Ga0213872_10011411 3300021361 Bacteria 4201
105 Ga0209674_104281 3300025226 Bacteria 2356
106 Ga0209563_100014 3300025230 Bacteria 940582
107 Ga0207425_1005080 3300025245 Bacteria 3815
108 Ga0209129_1002051 3300025258 Bacteria 10387
109 Ga0209565_1000145 3300025263 Bacteria 97893
110 Ga0209565_1000470 3300025263 Bacteria 30265
111 Ga0209565_1002104 3300025263 Bacteria 7602
112 Ga0209673_1002563 3300025273 Bacteria 12371
113 Ga0209130_1000099 3300025284 Bacteria 141717
114 Ga0209130_1012829 3300025284 Bacteria 2173
115 Ga0209675_1000026 3300025291 Bacteria 284716
116 Ga0209675_1000139 3300025291 Bacteria 97978
117 Ga0209675_1001768 3300025291 Bacteria 11821
118 Ga0209675_1002030 3300025291 Bacteria 10810
119 Ga0209676_1000059 3300025292 Bacteria 344882
120 Ga0209676_1001506 3300025292 Bacteria 21245
121 Ga0209676_1004999 3300025292 Bacteria 7102
122 Ga0209676_1009392 3300025292 Bacteria 4222
123 Ga0209025_1000066 3300025294 Bacteria 298742
124 Ga0209025_1000307 3300025294 Bacteria 108704
125 Ga0209025_1000424 3300025294 Bacteria 83948
126 Ga0209025_1000463 3300025294 Bacteria 79362
127 Ga0209025_1003547 3300025294 Bacteria 14628
128 Ga0209025_1019075 3300025294 Bacteria 3836
129 Ga0209564_1000021 3300025295 Bacteria 571316
130 Ga0209564_1000084 3300025295 Bacteria 252729
131 Ga0209564_1000161 3300025295 Bacteria 162489
132 Ga0209564_1005357 3300025295 Bacteria 7360
133 Ga0209758_1006945 3300025297 Bacteria 7891
134 Ga0209758_1016683 3300025297 Bacteria 3714
135 Ga0209050_1001049 3300025298 Bacteria 34100
136 Ga0209050_1001957 3300025298 Bacteria 19493
137 Ga0209050_1002575 3300025298 Bacteria 15077
138 Ga0209256_1000085 3300025299 Bacteria 219043
139 Ga0209256_1000562 3300025299 Bacteria 53066
140 Ga0209256_1002081 3300025299 Bacteria 17580
141 Ga0209256_1002251 3300025299 Bacteria 16396
142 Ga0209256_1017172 3300025299 Bacteria 2419
143 Ga0207426_1000062 3300025302 Bacteria 362040
144 Ga0209051_1000182 3300025303 Bacteria 113251
145 Ga0209051_1001201 3300025303 Bacteria 23394
146 Ga0209051_1004362 3300025303 Bacteria 8760
147 Ga0209051_1027347 3300025303 Bacteria 2275
148 Ga0209257_1000351 3300025304 Bacteria 94766
149 Ga0209257_1000397 3300025304 Bacteria 85732
150 Ga0207696_1023740 3300025711 Bacteria 1930
151 Ga0207688_10043245 3300025901 Bacteria 2508
152 Ga0207684_10004381 3300025910 Bacteria 13322
153 Ga0207695_10063936 3300025913 Bacteria 3791
154 Ga0207671_10071725 3300025914 Bacteria 2584
155 Ga0207657_10239741 3300025919 Bacteria 1448
156 Ga0207650_10062338 3300025925 Bacteria 2786
157 Ga0207659_10080886 3300025926 Bacteria 2401
158 Ga0207659_10328882 3300025926 Bacteria 1263
159 Ga0207709_10000032 3300025935 Bacteria 324478
160 Ga0207709_10003266 3300025935 Bacteria 9727
161 Ga0207689_10056877 3300025942 Bacteria 3218
162 Ga0207640_10069417 3300025981 Bacteria 2366
163 Ga0207658_10246874 3300025986 Bacteria 1515
164 Ga0207678_10030101 3300026067 Bacteria 4740
165 Ga0207674_10015451 3300026116 Bacteria 8387
166 Ga0207674_10191005 3300026116 Bacteria 1998
167 Ga0207683_10297647 3300026121 Bacteria 1476
168 Ga0207698_10098696 3300026142 Bacteria 2414
169 Ga0209281_1000002 3300027111 Bacteria 1924012
170 Ga0209389_1006837 3300027296 Bacteria 9970
171 Ga0209970_1001000 3300027614 Bacteria 5024
172 Ga0209282_1000098 3300027666 Bacteria 59778
173 Ga0209813_10040818 3300027866 Bacteria 1412
174 Ga0207428_10215059 3300027907 Bacteria 1443
175 Ga0268265_10237720 3300028380 Bacteria 1605
176 Ga0307517_10000327 3300028786 Bacteria 82422
177 Ga0307515_10000150 3300028794 Bacteria 169644
178 Ga0307515_10000213 3300028794 Bacteria 142742
179 Ga0307515_10011385 3300028794 Bacteria 16884
180 Ga0307515_10136507 3300028794 Bacteria 2663
181 Ga0307515_10207342 3300028794 Bacteria 1815
182 Ga0307511_10000056 3300030521 Bacteria 93598
183 Ga0307512_10012976 3300030522 Bacteria 7835
184 Ga0316183_1134099 3300030742 Bacteria 4085
185 Ga0316181_1247937 3300030744 Bacteria 2105
186 Ga0316182_1105450 3300030745 Bacteria 2750
187 Ga0307513_10000019 3300031456 Bacteria 231194
188 Ga0307513_10003109 3300031456 Bacteria 22657
189 Ga0307513_10009324 3300031456 Bacteria 12426
190 Ga0307513_10186492 3300031456 Bacteria 1931
191 Ga0307509_10002463 3300031507 Bacteria 29929
192 Ga0307509_10002617 3300031507 Bacteria 28807
193 Ga0307408_100007126 3300031548 Bacteria 7399
194 Ga0307408_100059542 3300031548 Bacteria 2779
195 Ga0307508_10001110 3300031616 Bacteria 31159
196 Ga0307508_10009055 3300031616 Bacteria 9171
197 Ga0307514_10002519 3300031649 Bacteria 18945
198 Ga0307514_10045947 3300031649 Bacteria 3413
199 Ga0307516_10154328 3300031730 Bacteria 2053
200 Ga0307405_10004263 3300031731 Bacteria 6732
201 Ga0307405_10019733 3300031731 Bacteria 3752
202 Ga0307405_10028701 3300031731 Bacteria 3244
203 Ga0307406_10001118 3300031901 Bacteria 14969
204 Ga0307406_10035069 3300031901 Bacteria 3083
205 Ga0307412_10006186 3300031911 Bacteria 6749
206 Ga0307412_10075246 3300031911 Bacteria 2316
207 Ga0307416_100072963 3300032002 Bacteria 2859
208 Ga0307416_100095616 3300032002 Bacteria 2566
209 Ga0307411_10149501 3300032005 Bacteria 1733
210 Ga0307510_10003186 3300033180 Bacteria 19042
211 Ga0307510_10113887 3300033180 Bacteria 2435
212 Ga0395900_0225447 3300037418 Bacteria 1887
213 Ga0395905_0000088 3300037471 Bacteria 152506
214 Ga0395905_0077606 3300037471 Bacteria 3112
215 Ga0395905_0235925 3300037471 Bacteria 1710
216 Ga0436361_0520824 3300039447 Bacteria 40350
217 Ga0439436_0001856 3300041404 Bacteria 6241
218 Ga0439436_0011811 3300041404 Bacteria 2650
219 Ga0439439_0005867 3300041406 Bacteria 2824
220 Ga0439466_0006952 3300041411 Bacteria 4291
221 Ga0439465_0002672 3300041413 Bacteria 5829
222 Ga0439431_0002113 3300041997 Bacteria 4386
223 Ga0439433_0003537 3300041999 Bacteria 3356
224 Ga0439445_0000110 3300042004 Bacteria 13718
225 Ga0439445_0011131 3300042004 Bacteria 2140
226 Ga0439432_015841 3300042006 Bacteria 2539
227 Ga0439432_026522 3300042006 Bacteria 1897
228 Ga0439432_051471 3300042006 Bacteria 1283
229 Ga0439449_0000377 3300042007 Bacteria 16423
230 Ga0439449_0001491 3300042007 Bacteria 9169
231 Ga0439449_0004278 3300042007 Bacteria 5515
232 Ga0439452_003500 3300042010 Bacteria 5488
233 Ga0439452_009941 3300042010 Bacteria 2786
234 Ga0439454_000234 3300042011 Bacteria 3989
235 Ga0439457_003218 3300042014 Bacteria 4486
236 Ga0439462_0006027 3300042015 Bacteria 3001
237 Ga0439462_0022717 3300042015 Bacteria 1642
238 Ga0450897_001354 3300042128 Bacteria 1658
239 Ga0450894_003468 3300042131 Bacteria 2062
240 Ga0450898_011847 3300042134 Bacteria 1433
241 Ga0450908_002694 3300042184 Bacteria 3466
242 Ga0450909_003188 3300042185 Bacteria 2333
243 Ga0450893_0019733 3300042532 Bacteria 1154
244 Ga0451577_0137692 3300042876 Bacteria 2193
245 Ga0495627_016118 3300046453 Bacteria 2565
246 Ga0495650_0001947 3300046471 Bacteria 18260
247 Ga0495605_0002788 3300046474 Bacteria 10640
248 Ga0495584_0020068 3300046491 Bacteria 3395
249 Ga0495596_0000145 3300046500 Bacteria 48986
250 Ga0495607_0006832 3300046501 Bacteria 7962
251 Ga0495610_0000358 3300046512 Bacteria 47626
252 Ga0495610_0012777 3300046512 Bacteria 5025
253 Ga0495616_0001923 3300046513 Bacteria 13976
254 Ga0495616_0008027 3300046513 Bacteria 6287
255 Ga0495618_0137382 3300046514 Bacteria 1564
256 Ga0495620_0040878 3300046515 Bacteria 2037
257 Ga0495628_0288965 3300046516 Bacteria 1216
258 Ga0495631_0000260 3300046518 Bacteria 36819
259 Ga0495632_0058999 3300046519 Bacteria 1868
260 Ga0495637_0009341 3300046520 Bacteria 4786
261 Ga0495637_0051449 3300046520 Bacteria 1724
262 Ga0495609_0002319 3300046538 Bacteria 11768
263 Ga0495621_0022654 3300046539 Bacteria 2084
264 Ga0495597_0000481 3300046542 Bacteria 33500
265 Ga0495656_0000085 3300046615 Bacteria 41208
266 Ga0495656_0035558 3300046615 Bacteria 2047
267 Ga0495611_0144918 3300046648 Bacteria 1109
268 Ga0495625_0000012 3300046660 Bacteria 363006
269 Ga0495625_0237084 3300046660 Bacteria 1189
270 Ga0495661_0007020 3300046665 Bacteria 7873
271 Ga0495588_0010078 3300046674 Bacteria 4382
272 Ga0495670_0080538 3300046691 Bacteria 1659
273 Ga0495670_0094142 3300046691 Bacteria 1536
274 Ga0495671_0000629 3300046692 Bacteria 25871
275 Ga0495671_0033618 3300046692 Bacteria 2610
276 Ga0495649_0054057 3300046694 Bacteria 2172
277 Ga0495660_0112266 3300046810 Bacteria 1389
278 Ga0495676_0012204 3300047321 Bacteria 7749
279 Ga0495687_007963 3300047443 Bacteria 6150
280 Ga0495614_0006587 3300048089 Bacteria 5202
281 Ga0496102_0004649 3300048905 Bacteria 11622
282 Ga0496111_0119898 3300048914 Bacteria 1943
283 Ga0496116_0001601 3300048919 Bacteria 24849
284 Ga0496116_0009158 3300048919 Bacteria 8480
285 Ga0496118_0056620 3300048921 Bacteria 2946
286 Ga0496119_0048527 3300048922 Bacteria 2632
287 Ga0496121_0007155 3300048924 Bacteria 13528
288 Ga0496121_0147306 3300048924 Bacteria 1737
289 Ga0496122_0002071 3300048925 Bacteria 29726
290 Ga0496123_0001730 3300048926 Bacteria 28930
291 Ga0496124_0010740 3300048927 Bacteria 9233
292 Ga0496124_0068672 3300048927 Bacteria 2945
293 Ga0496125_0056784 3300048928 Bacteria 3176
294 Ga0496126_0277966 3300048929 Bacteria 1388
295 Ga0501034_0000128 3300049571 Bacteria 140568
296 Ga0501249_021479 3300049679 Bacteria 1408
297 Ga0501266_001077 3300049763 Bacteria 3520
298 nmdc:mga03683_26503_c1 3300050489 Bacteria 2287
299 nmdc:mga03683_37210_c1 3300050489 Bacteria 1982
300 nmdc:mga03683_56959_c1 3300050489 Bacteria 1644
301 nmdc:mga03683_65148_c1 3300050489 Bacteria 1547
302 nmdc:mga00v17_15749_c1 3300050491 Bacteria 4250
303 nmdc:mga00v17_209908_c1 3300050491 Bacteria 1260
304 nmdc:mga00v17_4136_c1 3300050491 Bacteria 7510
305 nmdc:mga00v17_75922_c1 3300050491 Bacteria 2090
306 nmdc:mga0yw44_12825_c1 3300050492 Bacteria 4385
307 nmdc:mga0k408_107411_c1 3300050493 Bacteria 1649
308 nmdc:mga0k408_274_c1 3300050493 Bacteria 28068
309 nmdc:mga06z11_55111_c1 3300050494 Bacteria 2052
310 nmdc:mga06z11_90500_c1 3300050494 Bacteria 1660
311 nmdc:mga07m45_1832_c1 3300050496 Bacteria 9814
312 nmdc:mga07m45_2224_c1 3300050496 Bacteria 9065
313 nmdc:mga07m45_300_c1 3300050496 Bacteria 19984
314 nmdc:mga07m45_63543_c2 3300050496 Bacteria 1540
315 nmdc:mga0qj67_290527_c1 3300050509 Bacteria 1325
316 Ga0500610_0001506 3300053079 Bacteria 7982
317 Ga0500643_006679 3300053087 Bacteria 4778
318 Ga0500651_0001993 3300053093 Bacteria 10596
319 Ga0500569_010750 3300053109 Bacteria 2168
320 Ga0500571_009714 3300053110 Bacteria 5300
321 Ga0500593_000808 3300053117 Bacteria 11711
322 Ga0500593_000828 3300053117 Bacteria 11572
323 Ga0500593_001775 3300053117 Bacteria 7756
324 Ga0500597_006539 3300053120 Bacteria 3878
325 Ga0500607_001635 3300053121 Bacteria 19715
326 Ga0500607_008094 3300053121 Bacteria 6421
327 Ga0500655_001071 3300053133 Bacteria 5258
328 Ga0500658_0000934 3300053134 Bacteria 11917
329 Ga0500658_0001155 3300053134 Bacteria 10727
330 Ga0500559_0039125 3300053136 Bacteria 2062
331 Ga0500568_0006801 3300053139 Bacteria 5697
332 Ga0500586_084117 3300053145 Bacteria 1117
333 Ga0500616_0035981 3300053153 Bacteria 2689
334 Ga0500619_000221 3300053154 Bacteria 12972
335 Ga0500622_0036998 3300053156 Bacteria 2550
336 Ga0500634_0028903 3300053161 Bacteria 3020
337 Ga0500634_0057998 3300053161 Bacteria 2064
338 Ga0500645_004246 3300053730 Bacteria 5558
339 Ga0500645_004349 3300053730 Bacteria 5449
340 2513952313 2513237150 Bacteria 6553639
341 2514041792 2513237165 Bacteria 6771773
342 2599627573 2599185214 Bacteria 8209958
343 2599677828 2599185226 Bacteria 8233575
344 2599685299 2599185227 Bacteria 8246414
345 2599697052 2599185229 Bacteria 8216126
346 2599902505 2599185292 Bacteria 6290804
347 2643979161 2643221594 Bacteria 5811388
348 2644057143 2643221609 Bacteria 6756331
349 2644072033 2643221611 Bacteria 6820941
350 2644121203 2643221621 Bacteria 6212786
351 2644328131 2643221658 Bacteria 6064537
352 2644397183 2643221672 Bacteria 6322190
353 2722884968 2721755523 Bacteria 6430384
354 2809036076 2808606395 Bacteria 6020352
355 2816471667 2816332133 Bacteria 7249298
356 2831865270 2831864461 Bacteria 6502356
357 2834644586 2834641062 Bacteria 5559922
358 2839139557 2839138175 Bacteria 6549354
359 2842678513 2842677519 Bacteria 5615038
360 2842719759 2842718218 Bacteria 4560148
361 2855733494 2855730933 Bacteria 7047938
362 2855772289 2855767633 Bacteria 7049357
363 2858696050 2858688981 Bacteria 8184122
364 2881417874 2881412998 Bacteria 6492157
365 2885197345 2885192300 Bacteria 5882526
366 2886849544 2886848708 Bacteria 5632523
367 2886854293 2886848708 Bacteria 5632523
368 2904454975 2904449895 Bacteria 6927402
369 2904457332 2904456579 Bacteria 6819253
370 2928075176 2928070936 Bacteria 8062541
371 2928090772 2928084124 Bacteria 7159212
372 2928119068 2928115317 Bacteria 6477646
373 2929525229 2929520902 Bacteria 6765052
374 2945948647 2945945610 Bacteria 5951079
375 2954772845 2954767861 Bacteria 5535784
376 2974323834 2974320154 Bacteria 4571377
377 644751122 644736347 Bacteria 6476522
378 8003404039 8003400568 Bacteria 5535898
379 nmdc:mga07m45_102428_c1
380 JGI25152J39213_1012368
381 JGI25159J45721_1000399
382 JGI25159J45721_1001437
383 JGI25151J46595_10000620
384 JGI25151J46595_10001207
385 JGI25151J46595_10003582
386 rootH2_10017886
387 rootL2_10000180
388 rootL2_10154501
389 rootH1_10019495
390 JGI25160J50197_1000467
391 JGI25161J50226_1000041
392 Ga0006562J51391_1139586
393 Ga0006562J51391_1139587
394 Ga0055525_1000036
395 Ga0055526_1001227
396 Ga0055526_1001591
397 Ga0055526_1009962
398 Ga0055526_1011324
399 Ga0055526_1024569
400 Ga0055537_1001341
401 Ga0055524_1000123
402 Ga0055524_1010962
403 Ga0055524_1019735
404 Ga0055536_1000026
405 Ga0055536_1002283
406 Ga0055534_1000093
407 Ga0055534_1001846
408 Ga0055530_10034463
409 Ga0055540_1001224
410 Ga0055540_1021101
411 Ga0055531_10001112
412 Ga0055531_10004234
413 Ga0055531_10006039
414 Ga0055543_1000772
415 Ga0055543_1002841
416 Ga0065165_1000476
417 Ga0065714_10003410
418 Ga0065704_10099718
419 Ga0070670_100030821
420 Ga0070669_100150843
421 Ga0070675_100091157
422 Ga0070674_100064424
423 Ga0070673_100196108
424 Ga0070663_100008041
425 Ga0070678_100046111
426 Ga0070706_100002762
427 Ga0070707_100067611
428 Ga0070698_100165293
429 Ga0070665_100016828
430 Ga0068857_100170154
431 Ga0068857_100309929
432 Ga0068854_100024099
433 Ga0068852_100140470
434 Ga0068862_100051232
435 Ga0081455_10097318
436 Ga0075365_10010243
437 Ga0075368_10004741
438 Ga0075368_10018409
439 Ga0075363_100162642
440 Ga0075364_10006140
441 Ga0075364_10012169
442 Ga0075364_10045109
443 Ga0075364_10193351
444 Ga0075432_10005029
445 Ga0075432_10017210
446 Ga0075362_10001104
447 Ga0075362_10005112
448 Ga0075362_10007452
449 Ga0075362_10008402
450 Ga0075362_10084803
451 Ga0075367_10003811
452 Ga0075367_10012736
453 Ga0075366_10016512
454 Ga0075366_10039455
455 Ga0075366_10053983
456 Ga0075366_10063198
457 Ga0075366_10083356
458 Ga0075366_10107832
459 Ga0075370_10007482
460 Ga0075370_10009595
461 Ga0075370_10034918
462 Ga0075370_10053620
463 Ga0075370_10124740
464 Ga0075430_100321399
465 Ga0075429_100002378
466 Ga0099823_1000061
467 Ga0079104_1000003
468 Ga0099826_10000036
469 Ga0099826_10063652
470 Ga0105244_10023673
471 Ga0105250_10035468
472 Ga0105240_10049118
473 Ga0105243_10021355
474 Ga0105243_10103420
475 Ga0105237_10043943
476 Ga0105239_10022095
477 Ga0157319_1000004
478 Ga0157373_10005691
479 Ga0182008_10060745
480 Ga0182008_10086470
481 Ga0163161_10050930
482 Ga0213872_10011411
483 Ga0209674_104281
484 Ga0209563_100014
485 Ga0207425_1005080
486 Ga0209129_1002051
487 Ga0209565_1000145
488 Ga0209565_1000470
489 Ga0209565_1002104
490 Ga0209673_1002563
491 Ga0209130_1000099
492 Ga0209130_1012829
493 Ga0209675_1000026
494 Ga0209675_1000139
495 Ga0209675_1001768
496 Ga0209675_1002030
497 Ga0209676_1000059
498 Ga0209676_1001506
499 Ga0209676_1004999
500 Ga0209676_1009392
501 Ga0209025_1000066
502 Ga0209025_1000307
503 Ga0209025_1000424
504 Ga0209025_1000463
505 Ga0209025_1003547
506 Ga0209025_1019075
507 Ga0209564_1000021
508 Ga0209564_1000084
509 Ga0209564_1000161
510 Ga0209564_1005357
511 Ga0209758_1006945
512 Ga0209758_1016683
513 Ga0209050_1001049
514 Ga0209050_1001957
515 Ga0209050_1002575
516 Ga0209256_1000085
517 Ga0209256_1000562
518 Ga0209256_1002081
519 Ga0209256_1002251
520 Ga0209256_1017172
521 Ga0207426_1000062
522 Ga0209051_1000182
523 Ga0209051_1001201
524 Ga0209051_1004362
525 Ga0209051_1027347
526 Ga0209257_1000351
527 Ga0209257_1000397
528 Ga0207696_1023740
529 Ga0207688_10043245
530 Ga0207684_10004381
531 Ga0207695_10063936
532 Ga0207671_10071725
533 Ga0207657_10239741
534 Ga0207650_10062338
535 Ga0207659_10080886
536 Ga0207659_10328882
537 Ga0207709_10000032
538 Ga0207709_10003266
539 Ga0207689_10056877
540 Ga0207640_10069417
541 Ga0207658_10246874
542 Ga0207678_10030101
543 Ga0207674_10015451
544 Ga0207674_10191005
545 Ga0207683_10297647
546 Ga0207698_10098696
547 Ga0209281_1000002
548 Ga0209389_1006837
549 Ga0209970_1001000
550 Ga0209282_1000098
551 Ga0209813_10040818
552 Ga0207428_10215059
553 Ga0268265_10237720
554 Ga0307517_10000327
555 Ga0307515_10000150
556 Ga0307515_10000213
557 Ga0307515_10011385
558 Ga0307515_10136507
559 Ga0307515_10207342
560 Ga0307511_10000056
561 Ga0307512_10012976
562 Ga0316183_1134099
563 Ga0316181_1247937
564 Ga0316182_1105450
565 Ga0307513_10000019
566 Ga0307513_10003109
567 Ga0307513_10009324
568 Ga0307513_10186492
569 Ga0307509_10002463
570 Ga0307509_10002617
571 Ga0307408_100007126
572 Ga0307408_100059542
573 Ga0307508_10001110
574 Ga0307508_10009055
575 Ga0307514_10002519
576 Ga0307514_10045947
577 Ga0307516_10154328
578 Ga0307405_10004263
579 Ga0307405_10019733
580 Ga0307405_10028701
581 Ga0307406_10001118
582 Ga0307406_10035069
583 Ga0307412_10006186
584 Ga0307412_10075246
585 Ga0307416_100072963
586 Ga0307416_100095616
587 Ga0307411_10149501
588 Ga0307510_10003186
589 Ga0307510_10113887
590 Ga0395900_0225447
591 Ga0395905_0000088
592 Ga0395905_0077606
593 Ga0395905_0235925
594 Ga0436361_0520824
595 Ga0439436_0001856
596 Ga0439436_0011811
597 Ga0439439_0005867
598 Ga0439466_0006952
599 Ga0439465_0002672
600 Ga0439431_0002113
601 Ga0439433_0003537
602 Ga0439445_0000110
603 Ga0439445_0011131
604 Ga0439432_015841
605 Ga0439432_026522
606 Ga0439432_051471
607 Ga0439449_0000377
608 Ga0439449_0001491
609 Ga0439449_0004278
610 Ga0439452_003500
611 Ga0439452_009941
612 Ga0439454_000234
613 Ga0439457_003218
614 Ga0439462_0006027
615 Ga0439462_0022717
616 Ga0450897_001354
617 Ga0450894_003468
618 Ga0450898_011847
619 Ga0450908_002694
620 Ga0450909_003188
621 Ga0450893_0019733
622 Ga0451577_0137692
623 Ga0495627_016118
624 Ga0495650_0001947
625 Ga0495605_0002788
626 Ga0495584_0020068
627 Ga0495596_0000145
628 Ga0495607_0006832
629 Ga0495610_0000358
630 Ga0495610_0012777
631 Ga0495616_0001923
632 Ga0495616_0008027
633 Ga0495618_0137382
634 Ga0495620_0040878
635 Ga0495628_0288965
636 Ga0495631_0000260
637 Ga0495632_0058999
638 Ga0495637_0009341
639 Ga0495637_0051449
640 Ga0495609_0002319
641 Ga0495621_0022654
642 Ga0495597_0000481
643 Ga0495656_0000085
644 Ga0495656_0035558
645 Ga0495611_0144918
646 Ga0495625_0000012
647 Ga0495625_0237084
648 Ga0495661_0007020
649 Ga0495588_0010078
650 Ga0495670_0080538
651 Ga0495670_0094142
652 Ga0495671_0000629
653 Ga0495671_0033618
654 Ga0495649_0054057
655 Ga0495660_0112266
656 Ga0495676_0012204
657 Ga0495687_007963
658 Ga0495614_0006587
659 Ga0496102_0004649
660 Ga0496111_0119898
661 Ga0496116_0001601
662 Ga0496116_0009158
663 Ga0496118_0056620
664 Ga0496119_0048527
665 Ga0496121_0007155
666 Ga0496121_0147306
667 Ga0496122_0002071
668 Ga0496123_0001730
669 Ga0496124_0010740
670 Ga0496124_0068672
671 Ga0496125_0056784
672 Ga0496126_0277966
673 Ga0501034_0000128
674 Ga0501249_021479
675 Ga0501266_001077
676 nmdc:mga03683_26503_c1
677 nmdc:mga03683_37210_c1
678 nmdc:mga03683_56959_c1
679 nmdc:mga03683_65148_c1
680 nmdc:mga00v17_15749_c1
681 nmdc:mga00v17_209908_c1
682 nmdc:mga00v17_4136_c1
683 nmdc:mga00v17_75922_c1
684 nmdc:mga0yw44_12825_c1
685 nmdc:mga0k408_107411_c1
686 nmdc:mga0k408_274_c1
687 nmdc:mga06z11_55111_c1
688 nmdc:mga06z11_90500_c1
689 nmdc:mga07m45_1832_c1
690 nmdc:mga07m45_2224_c1
691 nmdc:mga07m45_300_c1
692 nmdc:mga07m45_63543_c2
693 nmdc:mga0qj67_290527_c1
694 Ga0500610_0001506
695 Ga0500643_006679
696 Ga0500651_0001993
697 Ga0500569_010750
698 Ga0500571_009714
699 Ga0500593_000808
700 Ga0500593_000828
701 Ga0500593_001775
702 Ga0500597_006539
703 Ga0500607_001635
704 Ga0500607_008094
705 Ga0500655_001071
706 Ga0500658_0000934
707 Ga0500658_0001155
708 Ga0500559_0039125
709 Ga0500568_0006801
710 Ga0500586_084117
711 Ga0500616_0035981
712 Ga0500619_000221
713 Ga0500622_0036998
714 Ga0500634_0028903
715 Ga0500634_0057998
716 Ga0500645_004246
717 Ga0500645_004349
718 2513952313
719 2514041792
720 2599627573
721 2599677828
722 2599685299
723 2599697052
724 2599902505
725 2643979161
726 2644057143
727 2644072033
728 2644121203
729 2644328131
730 2644397183
731 2722884968
732 2809036076
733 2816471667
734 2831865270
735 2834644586
736 2839139557
737 2842678513
738 2842719759
739 2855733494
740 2855772289
741 2858696050
742 2881417874
743 2885197345
744 2886849544
745 2886854293
746 2904454975
747 2904457332
748 2928075176
749 2928090772
750 2928119068
751 2929525229
752 2945948647
753 2954772845
754 2974323834
755 644751122
756 8003404039

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03401

TctC

Tripartite tricarboxylate transporter family receptor

86

356

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
2f5x-assembly3.cif.gz_C structure of periplasmic binding protein bugd 0.9434 34 324
2dvz-assembly1.cif.gz_A structure of a periplasmic transporter 0.9425 34 324
8hkb-assembly1.cif.gz_A tpa bound-form of periplasmic terephthalate binding protein (tbp) from ideonella sakaiensis mutant k184d 0.9317 39 324
5oku-assembly1.cif.gz_A r. palustris rpa4515 with adipate 0.9172 33 323
2f5x-assembly3.cif.gz_C structure of periplasmic binding protein bugd 0.9162 34 324
ID Description Score Start End Superfamily
2qpqC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9564 132 252 3.40.190.10
4x9tA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9555 132 252 3.40.190.10
4x9tA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9401 132 252 3.40.190.10
2qpqC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9267 132 252 3.40.190.10
2dvzA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9119 131 248 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A1F4D0A5-F1-model_v4 MFS transporter 0.964 45 323
AF-A0A1W2BNB3-F1-model_v4 Tripartite-type tricarboxylate transporter, receptor component TctC 0.9638 31 324
AF-A0A193GCD7-F1-model_v4 ABC transporter substrate-binding protein 0.9632 31 323
AF-A0A369VQV0-F1-model_v4 Tripartite tricarboxylate transporter substrate binding protein 0.963 21 323
AF-A0A537DML3-F1-model_v4 Tripartite tricarboxylate transporter substrate binding protein 0.963 42 323

Map