F428117

General Info

Members Datasets Scaffolds Average Seq Length
378 213 754 220

Family's Representative Sequence

Representative Sequence 3300046454|Ga0495592_0002028|Ga0495592_0002028_11066_11851
Length 261
Sequence MEPRREPIHATYSNTRLEGKEWTIMTKSIDVDTRAAVLSENSGETLREILNTRVIAGVSVPDSPLITEALEYAKKLSEPYLYNHAVRSWLFAVKVGHLKAIDYDSEVVAVGTILHDIGLTAGVSGPNRFEVNGADAALSFIKERGLSNRRAQLIWDLIALNSTVSIALHKEAEVALGTMGIGLDWGGFGIELIPALEMTEILSAFPRLKMKDKFTDACCRIVAAKPETTSDNFLRDFGERFVPGYKPMSAVDLLMNAPFEE

Samples

Sample ID Description Type Environment
1 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
2 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
3 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
57 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
58 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
59 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
60 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
64 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
65 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
66 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
67 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
72 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
73 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
78 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
84 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
88 3300012483 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
95 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
96 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
97 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
98 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
99 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
143 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
147 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
148 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
149 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
150 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
151 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
152 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
153 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
154 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
155 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
156 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
157 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
158 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
159 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
160 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
161 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
162 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
163 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
164 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
165 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
166 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
167 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
168 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
169 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
170 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
171 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
172 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
173 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
174 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
175 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
176 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
177 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
178 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
179 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
180 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
181 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
182 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
183 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
184 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
185 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
186 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
187 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
188 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
189 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
190 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
191 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
192 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
193 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
194 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
195 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
201 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
202 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
203 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
204 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
205 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
206 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
207 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
208 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
209 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
210 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
211 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
212 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
213 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.26
Nodule 0
Rhizoplane 6.88
Rhizosphere 92.59
Stem 0
Stem Tuber 0
Unclassified 12.96

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495592_0002028 3300046454 Bacteria 14263
2 JGI25404J52841_10002868 3300003659 Bacteria 3333
3 JGI25404J52841_10006837 3300003659 Bacteria 2396
4 JGI25404J52841_10016777 3300003659 Bacteria 1588
5 JGI25404J52841_10039573 3300003659 Bacteria 998
6 Ga0065714_10241322 3300005288 Unclassified 792
7 Ga0065704_10029227 3300005289 Bacteria 1353
8 Ga0065704_10143100 3300005289 Bacteria 1479
9 Ga0065712_10000710 3300005290 Bacteria 10860
10 Ga0065712_10001611 3300005290 Bacteria 8435
11 Ga0065715_10001887 3300005293 Bacteria 5996
12 Ga0065715_10131896 3300005293 Bacteria 1999
13 Ga0065707_10001970 3300005295 Bacteria 5854
14 Ga0065707_10096971 3300005295 Bacteria 3216
15 Ga0065707_10136679 3300005295 Bacteria 1767
16 Ga0070683_100120927 3300005329 Bacteria 2474
17 Ga0070690_100039211 3300005330 Bacteria 2992
18 Ga0070670_100288153 3300005331 Bacteria 1434
19 Ga0068869_100404272 3300005334 Unclassified 1124
20 Ga0070666_10019019 3300005335 Bacteria 4428
21 Ga0070680_100285244 3300005336 Bacteria 1399
22 Ga0070682_100060393 3300005337 Bacteria 2397
23 Ga0068868_100353733 3300005338 Unclassified 1259
24 Ga0068868_100647458 3300005338 Unclassified 940
25 Ga0070687_100132050 3300005343 Bacteria 1443
26 Ga0070661_100040761 3300005344 Bacteria 3389
27 Ga0070675_100024366 3300005354 Bacteria 4846
28 Ga0070671_100276969 3300005355 Bacteria 1426
29 Ga0070674_100078515 3300005356 Bacteria 2352
30 Ga0070673_100108867 3300005364 Bacteria 2295
31 Ga0070688_100066348 3300005365 Bacteria 2296
32 Ga0070667_100344118 3300005367 Bacteria 1349
33 Ga0070709_10171992 3300005434 Bacteria 1514
34 Ga0070714_100128131 3300005435 Bacteria 2265
35 Ga0070714_100943127 3300005435 Unclassified 839
36 Ga0070713_100029260 3300005436 Bacteria 4360
37 Ga0070710_10175960 3300005437 Bacteria 1336
38 Ga0070701_10211902 3300005438 Bacteria 1151
39 Ga0070705_100064567 3300005440 Bacteria 2188
40 Ga0070705_100545844 3300005440 Bacteria 888
41 Ga0070694_100153846 3300005444 Bacteria 1682
42 Ga0070694_100414406 3300005444 Bacteria 1057
43 Ga0070694_100443141 3300005444 Bacteria 1024
44 Ga0070708_100013434 3300005445 Bacteria 6704
45 Ga0070708_100190898 3300005445 Unclassified 1916
46 Ga0070663_100029021 3300005455 Bacteria 3774
47 Ga0068867_100252668 3300005459 Bacteria 1434
48 Ga0070685_10017071 3300005466 Bacteria 3878
49 Ga0070706_100236523 3300005467 Bacteria 1705
50 Ga0070706_100322037 3300005467 Unclassified 1442
51 Ga0070706_100387083 3300005467 Bacteria 1302
52 Ga0070706_100529086 3300005467 Bacteria 1097
53 Ga0070707_100295976 3300005468 Bacteria 1573
54 Ga0070707_100321092 3300005468 Bacteria 1505
55 Ga0070698_100061155 3300005471 Bacteria 3800
56 Ga0070699_100198497 3300005518 Bacteria 1783
57 Ga0070684_100210914 3300005535 Bacteria 1770
58 Ga0070684_100597822 3300005535 Bacteria 1025
59 Ga0070697_100109312 3300005536 Bacteria 2302
60 Ga0070697_100141356 3300005536 Bacteria 2025
61 Ga0070697_100385936 3300005536 Bacteria 1214
62 Ga0070697_100687833 3300005536 Bacteria 902
63 Ga0070697_100820390 3300005536 Bacteria 823
64 Ga0068853_100673195 3300005539 Unclassified 986
65 Ga0068853_101224683 3300005539 Unclassified 725
66 Ga0070686_100015363 3300005544 Bacteria 4434
67 Ga0070695_100002390 3300005545 Bacteria 10779
68 Ga0070695_100118216 3300005545 Bacteria 1810
69 Ga0070696_100078282 3300005546 Bacteria 2337
70 Ga0070696_100555204 3300005546 Unclassified 921
71 Ga0070704_100724487 3300005549 Bacteria 884
72 Ga0070704_100804688 3300005549 Bacteria 840
73 Ga0070664_100004026 3300005564 Bacteria 11805
74 Ga0070664_100023544 3300005564 Bacteria 5088
75 Ga0070664_100129920 3300005564 Bacteria 2212
76 Ga0070664_100181551 3300005564 Bacteria 1870
77 Ga0070664_100358256 3300005564 Bacteria 1328
78 Ga0068857_100015773 3300005577 Bacteria 6611
79 Ga0068859_100001477 3300005617 Bacteria 23910
80 Ga0068859_100002610 3300005617 Bacteria 18329
81 Ga0068859_100465845 3300005617 Bacteria 1359
82 Ga0068864_100000698 3300005618 Bacteria 28165
83 Ga0068864_100040828 3300005618 Bacteria 3967
84 Ga0068864_100191063 3300005618 Bacteria 1877
85 Ga0068866_10309404 3300005718 Bacteria 990
86 Ga0068861_100692901 3300005719 Unclassified 946
87 Ga0068861_100814367 3300005719 Unclassified 877
88 Ga0068863_100439932 3300005841 Bacteria 1279
89 Ga0068863_101401212 3300005841 Unclassified 707
90 Ga0068858_100279901 3300005842 Bacteria 1588
91 Ga0068858_100396509 3300005842 Bacteria 1326
92 Ga0068860_100316832 3300005843 Bacteria 1530
93 Ga0068860_100319452 3300005843 Bacteria 1524
94 Ga0068860_100864108 3300005843 Bacteria 920
95 Ga0068862_100011921 3300005844 Bacteria 7181
96 Ga0068862_100074575 3300005844 Bacteria 2933
97 Ga0068862_100104930 3300005844 Bacteria 2476
98 Ga0081455_10039133 3300005937 Bacteria 4193
99 Ga0081455_10105428 3300005937 Bacteria 2253
100 Ga0081540_1000028 3300005983 Bacteria 150331
101 Ga0081540_1000088 3300005983 Bacteria 98323
102 Ga0081540_1000377 3300005983 Bacteria 44639
103 Ga0081540_1006465 3300005983 Bacteria 8528
104 Ga0081540_1013792 3300005983 Bacteria 5231
105 Ga0070717_10004425 3300006028 Bacteria 10144
106 Ga0070715_10173199 3300006163 Bacteria 1077
107 Ga0070716_100277132 3300006173 Bacteria 1155
108 Ga0097621_100347447 3300006237 Unclassified 1318
109 Ga0068871_100079177 3300006358 Bacteria 2718
110 Ga0075428_100013929 3300006844 Bacteria 8954
111 Ga0075428_100148364 3300006844 Bacteria 2548
112 Ga0075428_100217546 3300006844 Bacteria 2063
113 Ga0075430_100018889 3300006846 Bacteria 5865
114 Ga0075433_10058133 3300006852 Bacteria 3381
115 Ga0075433_10076206 3300006852 Bacteria 2953
116 Ga0075433_10078309 3300006852 Bacteria 2912
117 Ga0075433_10137260 3300006852 Unclassified 2174
118 Ga0075433_10182384 3300006852 Bacteria 1868
119 Ga0075433_10205699 3300006852 Bacteria 1750
120 Ga0075434_100036174 3300006871 Bacteria 4884
121 Ga0075434_100055396 3300006871 Bacteria 3940
122 Ga0075434_100236153 3300006871 Bacteria 1848
123 Ga0075434_100553647 3300006871 Bacteria 1170
124 Ga0075434_101285450 3300006871 Unclassified 743
125 Ga0075429_100079801 3300006880 Bacteria 2852
126 Ga0075429_100104177 3300006880 Bacteria 2478
127 Ga0068865_100140319 3300006881 Bacteria 1821
128 Ga0075436_100066945 3300006914 Bacteria 2483
129 Ga0097620_100001477 3300006931 Bacteria 23910
130 Ga0097620_100002610 3300006931 Bacteria 18329
131 Ga0097620_100465830 3300006931 Bacteria 1359
132 Ga0075435_100025952 3300007076 Bacteria 4567
133 Ga0075435_100111956 3300007076 Bacteria 2271
134 Ga0099794_10171304 3300007265 Bacteria 1107
135 Ga0105251_10140478 3300009011 Bacteria 1093
136 Ga0105240_10476008 3300009093 Bacteria 1393
137 Ga0111539_10032108 3300009094 Bacteria 6378
138 Ga0111539_10042650 3300009094 Bacteria 5445
139 Ga0111539_10049523 3300009094 Bacteria 5009
140 Ga0111539_10129749 3300009094 Bacteria 2952
141 Ga0111539_10369502 3300009094 Unclassified 1669
142 Ga0111539_10646293 3300009094 Bacteria 1232
143 Ga0105245_10193314 3300009098 Bacteria 1950
144 Ga0105247_10002034 3300009101 Bacteria 14009
145 Ga0105247_10124537 3300009101 Unclassified 1674
146 Ga0114129_10001385 3300009147 Bacteria 32641
147 Ga0114129_10125802 3300009147 Bacteria 3524
148 Ga0114129_10147931 3300009147 Bacteria 3217
149 Ga0114129_10338683 3300009147 Bacteria 1996
150 Ga0114129_10799991 3300009147 Bacteria 1203
151 Ga0114129_11049543 3300009147 Bacteria 1023
152 Ga0105243_10080600 3300009148 Bacteria 2655
153 Ga0105243_10161575 3300009148 Bacteria 1932
154 Ga0105241_10374111 3300009174 Bacteria 1243
155 Ga0105242_10078011 3300009176 Bacteria 2764
156 Ga0105242_10111614 3300009176 Bacteria 2332
157 Ga0105248_10000505 3300009177 Bacteria 44403
158 Ga0105248_10232391 3300009177 Bacteria 2076
159 Ga0105248_10374064 3300009177 Bacteria 1604
160 Ga0105248_10647570 3300009177 Bacteria 1192
161 Ga0105237_10641947 3300009545 Bacteria 1068
162 Ga0105238_10151497 3300009551 Bacteria 2294
163 Ga0105249_10134652 3300009553 Bacteria 2363
164 Ga0105249_10224028 3300009553 Bacteria 1852
165 Ga0105249_10277611 3300009553 Bacteria 1672
166 Ga0105239_10857559 3300010375 Unclassified 1042
167 Ga0105246_10019264 3300011119 Bacteria 4358
168 Ga0105246_10192566 3300011119 Bacteria 1579
169 Ga0105246_10838934 3300011119 Unclassified 819
170 Ga0157337_1003096 3300012483 Unclassified 986
171 Ga0157374_10476629 3300013296 Unclassified 1251
172 Ga0157378_10065363 3300013297 Bacteria 3256
173 Ga0157378_10220557 3300013297 Bacteria 1802
174 Ga0157378_10439484 3300013297 Bacteria 1293
175 Ga0163162_11062615 3300013306 Unclassified 916
176 Ga0157372_10410161 3300013307 Bacteria 1579
177 Ga0157375_10208635 3300013308 Bacteria 2110
178 Ga0157375_10643643 3300013308 Bacteria 1217
179 Ga0157375_10964745 3300013308 Bacteria 994
180 Ga0163163_10000664 3300014325 Bacteria 29497
181 Ga0157380_10095030 3300014326 Bacteria 2468
182 Ga0157380_10637106 3300014326 Bacteria 1061
183 Ga0157377_10487018 3300014745 Unclassified 859
184 Ga0157379_10029862 3300014968 Bacteria 4848
185 Ga0157379_10213967 3300014968 Bacteria 1745
186 Ga0157379_10353730 3300014968 Unclassified 1345
187 Ga0157379_10537700 3300014968 Unclassified 1086
188 Ga0163161_10094380 3300017792 Bacteria 2218
189 Ga0163161_10573291 3300017792 Bacteria 927
190 Ga0207697_10102263 3300025315 Bacteria 1222
191 Ga0207713_1074862 3300025735 Bacteria 1237
192 Ga0207692_10140651 3300025898 Unclassified 1373
193 Ga0207642_10146945 3300025899 Bacteria 1250
194 Ga0207710_10005736 3300025900 Bacteria 5332
195 Ga0207710_10009924 3300025900 Bacteria 4004
196 Ga0207710_10239040 3300025900 Bacteria 906
197 Ga0207688_10145388 3300025901 Bacteria 1397
198 Ga0207699_10057766 3300025906 Bacteria 2318
199 Ga0207684_10053461 3300025910 Bacteria 3428
200 Ga0207684_10105320 3300025910 Unclassified 2412
201 Ga0207684_10235915 3300025910 Bacteria 1578
202 Ga0207654_10386143 3300025911 Bacteria 971
203 Ga0207693_10193820 3300025915 Bacteria 1599
204 Ga0207660_10231521 3300025917 Bacteria 1453
205 Ga0207662_10065591 3300025918 Bacteria 2186
206 Ga0207652_10290209 3300025921 Bacteria 1476
207 Ga0207646_10182569 3300025922 Bacteria 1895
208 Ga0207646_10208021 3300025922 Unclassified 1767
209 Ga0207646_10241145 3300025922 Bacteria 1633
210 Ga0207650_10074550 3300025925 Bacteria 2558
211 Ga0207659_10083622 3300025926 Bacteria 2366
212 Ga0207687_10086966 3300025927 Bacteria 2271
213 Ga0207700_10005756 3300025928 Bacteria 7443
214 Ga0207664_10059460 3300025929 Bacteria 3043
215 Ga0207664_10139395 3300025929 Bacteria 2050
216 Ga0207686_10228515 3300025934 Bacteria 1347
217 Ga0207709_10043267 3300025935 Bacteria 2714
218 Ga0207670_10430171 3300025936 Bacteria 1061
219 Ga0207669_10066323 3300025937 Bacteria 2244
220 Ga0207704_10087315 3300025938 Bacteria 2037
221 Ga0207704_10319044 3300025938 Bacteria 1198
222 Ga0207665_10008176 3300025939 Bacteria 6906
223 Ga0207665_10254172 3300025939 Bacteria 1299
224 Ga0207691_10258608 3300025940 Bacteria 1501
225 Ga0207711_10072870 3300025941 Bacteria 2984
226 Ga0207711_10153976 3300025941 Bacteria 2076
227 Ga0207689_10084327 3300025942 Bacteria 2612
228 Ga0207661_10126063 3300025944 Bacteria 2187
229 Ga0207661_10127603 3300025944 Bacteria 2174
230 Ga0207661_10236911 3300025944 Bacteria 1618
231 Ga0207679_10000653 3300025945 Bacteria 23210
232 Ga0207679_10003235 3300025945 Bacteria 10048
233 Ga0207679_10188623 3300025945 Bacteria 1712
234 Ga0207679_10375943 3300025945 Bacteria 1244
235 Ga0207651_10523924 3300025960 Unclassified 1027
236 Ga0207712_10134237 3300025961 Bacteria 1890
237 Ga0207712_10218764 3300025961 Bacteria 1521
238 Ga0207712_10315446 3300025961 Bacteria 1288
239 Ga0207668_10456483 3300025972 Bacteria 1092
240 Ga0207658_10613976 3300025986 Bacteria 978
241 Ga0207658_10782614 3300025986 Unclassified 865
242 Ga0207677_10153435 3300026023 Bacteria 1780
243 Ga0207703_10020070 3300026035 Bacteria 5223
244 Ga0207703_10147120 3300026035 Bacteria 2050
245 Ga0207703_10583634 3300026035 Unclassified 1056
246 Ga0207639_10295178 3300026041 Bacteria 1431
247 Ga0207678_10036500 3300026067 Bacteria 4278
248 Ga0207641_10137767 3300026088 Bacteria 2198
249 Ga0207641_10409529 3300026088 Bacteria 1303
250 Ga0207676_10000007 3300026095 Bacteria 591074
251 Ga0207676_10057392 3300026095 Bacteria 3065
252 Ga0207676_10303105 3300026095 Bacteria 1459
253 Ga0207674_10107018 3300026116 Bacteria 2773
254 Ga0207675_100727558 3300026118 Unclassified 1002
255 Ga0207683_10049809 3300026121 Bacteria 3668
256 Ga0207428_10002358 3300027907 Bacteria 18868
257 Ga0207428_10005508 3300027907 Bacteria 11795
258 Ga0207428_10147465 3300027907 Bacteria 1792
259 Ga0268266_10022307 3300028379 Bacteria 5395
260 Ga0268265_10037681 3300028380 Bacteria 3551
261 Ga0268265_10045537 3300028380 Bacteria 3274
262 Ga0268265_10943351 3300028380 Bacteria 850
263 Ga0268264_10020910 3300028381 Bacteria 5346
264 Ga0268264_10308149 3300028381 Bacteria 1493
265 Ga0268264_10524118 3300028381 Bacteria 1159
266 Ga0307405_10162904 3300031731 Bacteria 1582
267 Ga0373928_0087125 3300035084 Unclassified 796
268 Ga0373936_0009155 3300035113 Bacteria 3732
269 Ga0373953_0179864 3300035117 Unclassified 912
270 Ga0373954_0161984 3300035118 Unclassified 1095
271 Ga0373960_0176232 3300035121 Unclassified 744
272 Ga0373943_0000898 3300035170 Bacteria 13106
273 Ga0373943_0178902 3300035170 Bacteria 1165
274 Ga0373946_0388204 3300035171 Unclassified 703
275 Ga0373955_0022312 3300035172 Bacteria 3210
276 Ga0373961_0115783 3300035241 Unclassified 883
277 Ga0373931_0042829 3300035691 Bacteria 2382
278 Ga0373935_0006005 3300035692 Bacteria 7210
279 Ga0373947_0011062 3300035725 Bacteria 5180
280 Ga0373947_0095726 3300035725 Bacteria 1858
281 Ga0373925_0005515 3300037068 Bacteria 9418
282 Ga0395900_0047849 3300037418 Bacteria 4405
283 Ga0395900_0051346 3300037418 Bacteria 4248
284 Ga0395905_0017409 3300037471 Bacteria 6822
285 Ga0395901_0003208 3300038443 Bacteria 16464
286 Ga0395901_0016506 3300038443 Bacteria 7525
287 Ga0439450_095004 3300042008 Bacteria 752
288 Ga0439455_0020887 3300042012 Bacteria 1556
289 Ga0451577_0041896 3300042876 Bacteria 4108
290 Ga0451577_0159013 3300042876 Bacteria 2034
291 Ga0453683_0005760 3300044673 Bacteria 8591
292 Ga0453684_0053847 3300044712 Bacteria 5249
293 Ga0451576_0004970 3300045051 Bacteria 16920
294 Ga0451576_0007508 3300045051 Bacteria 13012
295 Ga0451576_0007618 3300045051 Bacteria 12887
296 Ga0451576_0017542 3300045051 Bacteria 7868
297 Ga0451576_0844148 3300045051 Unclassified 961
298 Ga0495603_0070155 3300046455 Bacteria 2060
299 Ga0495603_0150604 3300046455 Bacteria 1351
300 Ga0495629_0001637 3300046459 Bacteria 17606
301 Ga0495580_0213823 3300046472 Bacteria 1326
302 Ga0495582_0072778 3300046473 Bacteria 1902
303 Ga0495640_0038100 3300046533 Unclassified 3384
304 Ga0495621_0121530 3300046539 Bacteria 1010
305 Ga0495635_0382975 3300046663 Bacteria 936
306 Ga0495599_0043072 3300046678 Bacteria 2833
307 Ga0495647_0049085 3300046681 Bacteria 1634
308 Ga0495658_0013642 3300046683 Bacteria 4139
309 Ga0495658_0018579 3300046683 Bacteria 3617
310 Ga0495613_0027851 3300046689 Bacteria 4206
311 Ga0495600_0291990 3300046809 Unclassified 1030
312 Ga0495674_0006443 3300047319 Bacteria 11254
313 Ga0496100_0305325 3300048903 Bacteria 1192
314 Ga0496100_0487217 3300048903 Bacteria 949
315 Ga0496101_0001838 3300048904 Bacteria 12798
316 Ga0496102_0859723 3300048905 Bacteria 829
317 Ga0496104_0018207 3300048907 Bacteria 6406
318 Ga0496104_0021037 3300048907 Bacteria 5985
319 Ga0496104_0021321 3300048907 Bacteria 5947
320 Ga0496104_0091267 3300048907 Bacteria 2911
321 Ga0496104_0443790 3300048907 Bacteria 1209
322 Ga0496106_0029263 3300048909 Bacteria 4104
323 Ga0496108_0003485 3300048911 Bacteria 12607
324 Ga0496108_0006949 3300048911 Bacteria 9160
325 Ga0496108_0084629 3300048911 Bacteria 2691
326 Ga0496109_0009186 3300048912 Bacteria 8420
327 Ga0496109_0159797 3300048912 Bacteria 2111
328 Ga0496109_0224575 3300048912 Bacteria 1767
329 Ga0496111_0027640 3300048914 Bacteria 4015
330 Ga0496111_0317305 3300048914 Unclassified 1154
331 Ga0496112_0019098 3300048915 Bacteria 6460
332 Ga0496112_0095710 3300048915 Bacteria 2939
333 Ga0496112_0158300 3300048915 Bacteria 2231
334 Ga0496113_0029032 3300048916 Bacteria 3987
335 Ga0496113_0052306 3300048916 Bacteria 3050
336 Ga0496114_0310603 3300048917 Unclassified 1392
337 Ga0496115_0223596 3300048918 Bacteria 1553
338 Ga0496115_0487901 3300048918 Bacteria 991
339 Ga0496124_0331623 3300048927 Bacteria 1085
340 Ga0501031_0142816 3300049568 Bacteria 1565
341 Ga0501036_0711822 3300049572 Unclassified 829
342 Ga0501038_0495281 3300049574 Unclassified 935
343 Ga0501040_0455938 3300049576 Unclassified 920
344 Ga0501041_0242042 3300049577 Bacteria 1134
345 Ga0501071_0138189 3300049587 Bacteria 1814
346 Ga0501079_0122312 3300049741 Bacteria 2024
347 Ga0501045_0629495 3300049824 Unclassified 793
348 nmdc:mga05p37_104_c1 3300050507 Bacteria 76602
349 nmdc:mga05p37_260116_c1 3300050507 Bacteria 2077
350 nmdc:mga05p37_441988_c1 3300050507 Bacteria 1508
351 nmdc:mga05p37_515744_c1 3300050507 Bacteria 1369
352 nmdc:mga09592_85276_c1 3300050508 Bacteria 2695
353 nmdc:mga0qj67_181478_c1 3300050509 Bacteria 1710
354 nmdc:mga06r32_16971_c1 3300050510 Bacteria 6643
355 nmdc:mga08y16_10412_c1 3300050511 Bacteria 9754
356 nmdc:mga08y16_272132_c1 3300050511 Unclassified 1748
357 nmdc:mga08y16_419061_c1 3300050511 Bacteria 1369
358 nmdc:mga08y16_43358_c1 3300050511 Bacteria 4715
359 nmdc:mga08y16_85901_c1 3300050511 Bacteria 3279
360 nmdc:mga0n895_251646_c1 3300050512 Bacteria 1793
361 nmdc:mga0n895_29435_c1 3300050512 Bacteria 5239
362 nmdc:mga0n895_46956_c1 3300050512 Bacteria 4221
363 nmdc:mga0n895_481_c1 3300050512 Bacteria 26877
364 nmdc:mga0n895_540391_c1 3300050512 Bacteria 1172
365 nmdc:mga0rr50_23653_c1 3300050513 Bacteria 4241
366 nmdc:mga0rr50_3123_c1 3300050513 Bacteria 9469
367 nmdc:mga08x19_1876_c1 3300050514 Bacteria 12871
368 nmdc:mga08x19_19460_c1 3300050514 Bacteria 4166
369 nmdc:mga08x19_71322_c1 3300050514 Bacteria 2265
370 nmdc:mga0a205_117536_c1 3300050515 Bacteria 2557
371 nmdc:mga0a205_1335_c1 3300050515 Bacteria 20820
372 nmdc:mga0a205_226524_c1 3300050515 Bacteria 1754
373 nmdc:mga0a205_256533_c1 3300050515 Bacteria 1627
374 nmdc:mga0a205_31051_c1 3300050515 Bacteria 5117
375 Ga0495619_0012546 3300053085 Bacteria 5337
376 Ga0495619_0133397 3300053085 Bacteria 1707
377 Ga0500616_0011366 3300053153 Bacteria 5262
378 Ga0495592_0002028
379 JGI25404J52841_10002868
380 JGI25404J52841_10006837
381 JGI25404J52841_10016777
382 JGI25404J52841_10039573
383 Ga0065714_10241322
384 Ga0065704_10029227
385 Ga0065704_10143100
386 Ga0065712_10000710
387 Ga0065712_10001611
388 Ga0065715_10001887
389 Ga0065715_10131896
390 Ga0065707_10001970
391 Ga0065707_10096971
392 Ga0065707_10136679
393 Ga0070683_100120927
394 Ga0070690_100039211
395 Ga0070670_100288153
396 Ga0068869_100404272
397 Ga0070666_10019019
398 Ga0070680_100285244
399 Ga0070682_100060393
400 Ga0068868_100353733
401 Ga0068868_100647458
402 Ga0070687_100132050
403 Ga0070661_100040761
404 Ga0070675_100024366
405 Ga0070671_100276969
406 Ga0070674_100078515
407 Ga0070673_100108867
408 Ga0070688_100066348
409 Ga0070667_100344118
410 Ga0070709_10171992
411 Ga0070714_100128131
412 Ga0070714_100943127
413 Ga0070713_100029260
414 Ga0070710_10175960
415 Ga0070701_10211902
416 Ga0070705_100064567
417 Ga0070705_100545844
418 Ga0070694_100153846
419 Ga0070694_100414406
420 Ga0070694_100443141
421 Ga0070708_100013434
422 Ga0070708_100190898
423 Ga0070663_100029021
424 Ga0068867_100252668
425 Ga0070685_10017071
426 Ga0070706_100236523
427 Ga0070706_100322037
428 Ga0070706_100387083
429 Ga0070706_100529086
430 Ga0070707_100295976
431 Ga0070707_100321092
432 Ga0070698_100061155
433 Ga0070699_100198497
434 Ga0070684_100210914
435 Ga0070684_100597822
436 Ga0070697_100109312
437 Ga0070697_100141356
438 Ga0070697_100385936
439 Ga0070697_100687833
440 Ga0070697_100820390
441 Ga0068853_100673195
442 Ga0068853_101224683
443 Ga0070686_100015363
444 Ga0070695_100002390
445 Ga0070695_100118216
446 Ga0070696_100078282
447 Ga0070696_100555204
448 Ga0070704_100724487
449 Ga0070704_100804688
450 Ga0070664_100004026
451 Ga0070664_100023544
452 Ga0070664_100129920
453 Ga0070664_100181551
454 Ga0070664_100358256
455 Ga0068857_100015773
456 Ga0068859_100001477
457 Ga0068859_100002610
458 Ga0068859_100465845
459 Ga0068864_100000698
460 Ga0068864_100040828
461 Ga0068864_100191063
462 Ga0068866_10309404
463 Ga0068861_100692901
464 Ga0068861_100814367
465 Ga0068863_100439932
466 Ga0068863_101401212
467 Ga0068858_100279901
468 Ga0068858_100396509
469 Ga0068860_100316832
470 Ga0068860_100319452
471 Ga0068860_100864108
472 Ga0068862_100011921
473 Ga0068862_100074575
474 Ga0068862_100104930
475 Ga0081455_10039133
476 Ga0081455_10105428
477 Ga0081540_1000028
478 Ga0081540_1000088
479 Ga0081540_1000377
480 Ga0081540_1006465
481 Ga0081540_1013792
482 Ga0070717_10004425
483 Ga0070715_10173199
484 Ga0070716_100277132
485 Ga0097621_100347447
486 Ga0068871_100079177
487 Ga0075428_100013929
488 Ga0075428_100148364
489 Ga0075428_100217546
490 Ga0075430_100018889
491 Ga0075433_10058133
492 Ga0075433_10076206
493 Ga0075433_10078309
494 Ga0075433_10137260
495 Ga0075433_10182384
496 Ga0075433_10205699
497 Ga0075434_100036174
498 Ga0075434_100055396
499 Ga0075434_100236153
500 Ga0075434_100553647
501 Ga0075434_101285450
502 Ga0075429_100079801
503 Ga0075429_100104177
504 Ga0068865_100140319
505 Ga0075436_100066945
506 Ga0097620_100001477
507 Ga0097620_100002610
508 Ga0097620_100465830
509 Ga0075435_100025952
510 Ga0075435_100111956
511 Ga0099794_10171304
512 Ga0105251_10140478
513 Ga0105240_10476008
514 Ga0111539_10032108
515 Ga0111539_10042650
516 Ga0111539_10049523
517 Ga0111539_10129749
518 Ga0111539_10369502
519 Ga0111539_10646293
520 Ga0105245_10193314
521 Ga0105247_10002034
522 Ga0105247_10124537
523 Ga0114129_10001385
524 Ga0114129_10125802
525 Ga0114129_10147931
526 Ga0114129_10338683
527 Ga0114129_10799991
528 Ga0114129_11049543
529 Ga0105243_10080600
530 Ga0105243_10161575
531 Ga0105241_10374111
532 Ga0105242_10078011
533 Ga0105242_10111614
534 Ga0105248_10000505
535 Ga0105248_10232391
536 Ga0105248_10374064
537 Ga0105248_10647570
538 Ga0105237_10641947
539 Ga0105238_10151497
540 Ga0105249_10134652
541 Ga0105249_10224028
542 Ga0105249_10277611
543 Ga0105239_10857559
544 Ga0105246_10019264
545 Ga0105246_10192566
546 Ga0105246_10838934
547 Ga0157337_1003096
548 Ga0157374_10476629
549 Ga0157378_10065363
550 Ga0157378_10220557
551 Ga0157378_10439484
552 Ga0163162_11062615
553 Ga0157372_10410161
554 Ga0157375_10208635
555 Ga0157375_10643643
556 Ga0157375_10964745
557 Ga0163163_10000664
558 Ga0157380_10095030
559 Ga0157380_10637106
560 Ga0157377_10487018
561 Ga0157379_10029862
562 Ga0157379_10213967
563 Ga0157379_10353730
564 Ga0157379_10537700
565 Ga0163161_10094380
566 Ga0163161_10573291
567 Ga0207697_10102263
568 Ga0207713_1074862
569 Ga0207692_10140651
570 Ga0207642_10146945
571 Ga0207710_10005736
572 Ga0207710_10009924
573 Ga0207710_10239040
574 Ga0207688_10145388
575 Ga0207699_10057766
576 Ga0207684_10053461
577 Ga0207684_10105320
578 Ga0207684_10235915
579 Ga0207654_10386143
580 Ga0207693_10193820
581 Ga0207660_10231521
582 Ga0207662_10065591
583 Ga0207652_10290209
584 Ga0207646_10182569
585 Ga0207646_10208021
586 Ga0207646_10241145
587 Ga0207650_10074550
588 Ga0207659_10083622
589 Ga0207687_10086966
590 Ga0207700_10005756
591 Ga0207664_10059460
592 Ga0207664_10139395
593 Ga0207686_10228515
594 Ga0207709_10043267
595 Ga0207670_10430171
596 Ga0207669_10066323
597 Ga0207704_10087315
598 Ga0207704_10319044
599 Ga0207665_10008176
600 Ga0207665_10254172
601 Ga0207691_10258608
602 Ga0207711_10072870
603 Ga0207711_10153976
604 Ga0207689_10084327
605 Ga0207661_10126063
606 Ga0207661_10127603
607 Ga0207661_10236911
608 Ga0207679_10000653
609 Ga0207679_10003235
610 Ga0207679_10188623
611 Ga0207679_10375943
612 Ga0207651_10523924
613 Ga0207712_10134237
614 Ga0207712_10218764
615 Ga0207712_10315446
616 Ga0207668_10456483
617 Ga0207658_10613976
618 Ga0207658_10782614
619 Ga0207677_10153435
620 Ga0207703_10020070
621 Ga0207703_10147120
622 Ga0207703_10583634
623 Ga0207639_10295178
624 Ga0207678_10036500
625 Ga0207641_10137767
626 Ga0207641_10409529
627 Ga0207676_10000007
628 Ga0207676_10057392
629 Ga0207676_10303105
630 Ga0207674_10107018
631 Ga0207675_100727558
632 Ga0207683_10049809
633 Ga0207428_10002358
634 Ga0207428_10005508
635 Ga0207428_10147465
636 Ga0268266_10022307
637 Ga0268265_10037681
638 Ga0268265_10045537
639 Ga0268265_10943351
640 Ga0268264_10020910
641 Ga0268264_10308149
642 Ga0268264_10524118
643 Ga0307405_10162904
644 Ga0373928_0087125
645 Ga0373936_0009155
646 Ga0373953_0179864
647 Ga0373954_0161984
648 Ga0373960_0176232
649 Ga0373943_0000898
650 Ga0373943_0178902
651 Ga0373946_0388204
652 Ga0373955_0022312
653 Ga0373961_0115783
654 Ga0373931_0042829
655 Ga0373935_0006005
656 Ga0373947_0011062
657 Ga0373947_0095726
658 Ga0373925_0005515
659 Ga0395900_0047849
660 Ga0395900_0051346
661 Ga0395905_0017409
662 Ga0395901_0003208
663 Ga0395901_0016506
664 Ga0439450_095004
665 Ga0439455_0020887
666 Ga0451577_0041896
667 Ga0451577_0159013
668 Ga0453683_0005760
669 Ga0453684_0053847
670 Ga0451576_0004970
671 Ga0451576_0007508
672 Ga0451576_0007618
673 Ga0451576_0017542
674 Ga0451576_0844148
675 Ga0495603_0070155
676 Ga0495603_0150604
677 Ga0495629_0001637
678 Ga0495580_0213823
679 Ga0495582_0072778
680 Ga0495640_0038100
681 Ga0495621_0121530
682 Ga0495635_0382975
683 Ga0495599_0043072
684 Ga0495647_0049085
685 Ga0495658_0013642
686 Ga0495658_0018579
687 Ga0495613_0027851
688 Ga0495600_0291990
689 Ga0495674_0006443
690 Ga0496100_0305325
691 Ga0496100_0487217
692 Ga0496101_0001838
693 Ga0496102_0859723
694 Ga0496104_0018207
695 Ga0496104_0021037
696 Ga0496104_0021321
697 Ga0496104_0091267
698 Ga0496104_0443790
699 Ga0496106_0029263
700 Ga0496108_0003485
701 Ga0496108_0006949
702 Ga0496108_0084629
703 Ga0496109_0009186
704 Ga0496109_0159797
705 Ga0496109_0224575
706 Ga0496111_0027640
707 Ga0496111_0317305
708 Ga0496112_0019098
709 Ga0496112_0095710
710 Ga0496112_0158300
711 Ga0496113_0029032
712 Ga0496113_0052306
713 Ga0496114_0310603
714 Ga0496115_0223596
715 Ga0496115_0487901
716 Ga0496124_0331623
717 Ga0501031_0142816
718 Ga0501036_0711822
719 Ga0501038_0495281
720 Ga0501040_0455938
721 Ga0501041_0242042
722 Ga0501071_0138189
723 Ga0501079_0122312
724 Ga0501045_0629495
725 nmdc:mga05p37_104_c1
726 nmdc:mga05p37_260116_c1
727 nmdc:mga05p37_441988_c1
728 nmdc:mga05p37_515744_c1
729 nmdc:mga09592_85276_c1
730 nmdc:mga0qj67_181478_c1
731 nmdc:mga06r32_16971_c1
732 nmdc:mga08y16_10412_c1
733 nmdc:mga08y16_272132_c1
734 nmdc:mga08y16_419061_c1
735 nmdc:mga08y16_43358_c1
736 nmdc:mga08y16_85901_c1
737 nmdc:mga0n895_251646_c1
738 nmdc:mga0n895_29435_c1
739 nmdc:mga0n895_46956_c1
740 nmdc:mga0n895_481_c1
741 nmdc:mga0n895_540391_c1
742 nmdc:mga0rr50_23653_c1
743 nmdc:mga0rr50_3123_c1
744 nmdc:mga08x19_1876_c1
745 nmdc:mga08x19_19460_c1
746 nmdc:mga08x19_71322_c1
747 nmdc:mga0a205_117536_c1
748 nmdc:mga0a205_1335_c1
749 nmdc:mga0a205_226524_c1
750 nmdc:mga0a205_256533_c1
751 nmdc:mga0a205_31051_c1
752 Ga0495619_0012546
753 Ga0495619_0133397
754 Ga0500616_0011366

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
6dkd-assembly2.cif.gz_C yeast ddi2 cyanamide hydratase 0.8874 2 158
6dk9-assembly4.cif.gz_F yeast ddi2 cyanamide hydratase 0.8845 2 158
6dka-assembly4.cif.gz_F yeast ddi2 cyanamide hydratase 0.8091 2 179
6dka-assembly4.cif.gz_F yeast ddi2 cyanamide hydratase 0.7423 2 179
6dkd-assembly2.cif.gz_C yeast ddi2 cyanamide hydratase 0.7219 2 158
ID Description Score Start End Superfamily
af_P0CH63_33_194_1.10.3210.10 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.9145 2 149 1.10.3210.10
af_P0CH63_33_194_1.10.3210.10 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.8348 2 149 1.10.3210.10
af_P27249_457_599_1.10.3210.10 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.7496 15 113 1.10.3210.10
af_F4HZF4_333_543_1.10.3210.10 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.7281 1 116 1.10.3210.10
af_Q86JB3_16_237_1.10.3210.50 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432; 0.7091 14 131 1.10.3210.50
ID Description Score Start End GO Terms
AF-A0A2V9X7X6-F1-model_v4 HD domain-containing protein 0.9727 2 139
AF-A0A3R9VFG9-F1-model_v4 deleted 0.966 4 113
AF-A0A8B4XTV5-F1-model_v4 deleted 0.9653 2 134
AF-A0A2V6CX63-F1-model_v4 HD domain-containing protein 0.9652 2 115
AF-A0A1I5G940-F1-model_v4 HD domain-containing protein 0.963 2 151

Map