F428075

General Info

Members Datasets Scaffolds Average Seq Length
378 198 756 212

Family's Representative Sequence

Representative Sequence 3300035171|Ga0373946_0088860|Ga0373946_0088860_287_1027
Length 246
Sequence LPERRINEVAAFRASHSSRFDLSTGEIFPGCKMKIWDISRPLTNNLAPWPGDTPFDFRLIRNIPDGGVVNLGSIGLSVHNGTHADAVFHFEENGLTIEKASLDVYFGRAAVVDLASRFSDGRSRLIEIEDLRPHQEEIADAKRLLVRTNIWQDSTVFPQSIAVITPEVAEWLGTLGLKLLGLDLPSVDPIDARELRNHHALGRAGVSIIESLDLKAISAGIYNFIGLPLRIVGADGSPIRAILWRE

Samples

Sample ID Description Type Environment
1 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
2 3300000545 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
54 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
55 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
56 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
57 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
58 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
63 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
64 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
65 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
66 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
69 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
74 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
80 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
81 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
82 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
89 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
90 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
91 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
130 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
134 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
135 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
136 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
137 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
138 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
139 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
140 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
141 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
142 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
143 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
144 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
145 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
146 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
147 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
148 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
149 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
150 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
151 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
152 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
153 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
154 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
155 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
156 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
157 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
158 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
159 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
160 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
161 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
162 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
163 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
164 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
165 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
166 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
167 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
168 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
169 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
170 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
171 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
172 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
173 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
174 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
175 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
176 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
177 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
178 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
179 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
180 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
181 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
182 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
186 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
187 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
188 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
189 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
190 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
191 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
192 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
193 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
194 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
195 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
196 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
197 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
198 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.03
Rhizosphere 94.71
Stem 0
Stem Tuber 0
Unclassified 30.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373946_0088860 3300035171 Bacteria 1366
2 CNXas_1000010 3300000545 Bacteria 39918
3 Ga0065704_10083926 3300005289 Bacteria 3399
4 Ga0065712_10001096 3300005290 Bacteria 12954
5 Ga0065712_10011308 3300005290 Bacteria 2769
6 Ga0065712_10092175 3300005290 Bacteria 2341
7 Ga0065712_10366122 3300005290 Bacteria 769
8 Ga0065715_10004264 3300005293 Unclassified 4014
9 Ga0065715_10177679 3300005293 Bacteria 1496
10 Ga0065715_10213712 3300005293 Unclassified 1302
11 Ga0065707_10111064 3300005295 Bacteria 2405
12 Ga0065707_10231601 3300005295 Unclassified 1187
13 Ga0070658_10627768 3300005327 Bacteria 932
14 Ga0070676_10016099 3300005328 Bacteria 4131
15 Ga0070676_10219054 3300005328 Bacteria 1256
16 Ga0070676_10251618 3300005328 Bacteria 1179
17 Ga0070683_100026392 3300005329 Bacteria 5229
18 Ga0070683_100071050 3300005329 Bacteria 3248
19 Ga0070690_100624221 3300005330 Bacteria 820
20 Ga0070670_100031230 3300005331 Unclassified 4586
21 Ga0070670_100292964 3300005331 Bacteria 1422
22 Ga0068869_100411418 3300005334 Unclassified 1114
23 Ga0070666_10051046 3300005335 Bacteria 2784
24 Ga0070666_10241808 3300005335 Unclassified 1277
25 Ga0070666_10557778 3300005335 Unclassified 833
26 Ga0070680_100068202 3300005336 Unclassified 2919
27 Ga0070682_100118320 3300005337 Unclassified 1775
28 Ga0070682_100499488 3300005337 Unclassified 942
29 Ga0068868_100128382 3300005338 Bacteria 2073
30 Ga0068868_100270510 3300005338 Unclassified 1435
31 Ga0070689_100064813 3300005340 Unclassified 2845
32 Ga0070687_100359391 3300005343 Unclassified 942
33 Ga0070661_100074102 3300005344 Bacteria 2506
34 Ga0070668_100092317 3300005347 Bacteria 2388
35 Ga0070669_100134869 3300005353 Bacteria 1898
36 Ga0070675_100048809 3300005354 Bacteria 3472
37 Ga0070675_100495815 3300005354 Bacteria 1100
38 Ga0070671_100016244 3300005355 Bacteria 6020
39 Ga0070671_100157124 3300005355 Unclassified 1921
40 Ga0070673_100007005 3300005364 Bacteria 7390
41 Ga0070673_100145176 3300005364 Bacteria 2005
42 Ga0070673_100285514 3300005364 Bacteria 1449
43 Ga0070673_100390336 3300005364 Unclassified 1243
44 Ga0070688_100045872 3300005365 Bacteria 2704
45 Ga0070688_100115274 3300005365 Unclassified 1793
46 Ga0070688_100169743 3300005365 Bacteria 1504
47 Ga0070688_100454872 3300005365 Unclassified 958
48 Ga0070667_100383179 3300005367 Unclassified 1277
49 Ga0070667_100408574 3300005367 Bacteria 1236
50 Ga0070667_100833860 3300005367 Bacteria 857
51 Ga0070709_10074699 3300005434 Unclassified 2197
52 Ga0070714_100687647 3300005435 Unclassified 986
53 Ga0070713_100006174 3300005436 Bacteria 8280
54 Ga0070713_100128658 3300005436 Bacteria 2231
55 Ga0070713_100131046 3300005436 Unclassified 2211
56 Ga0070701_10397929 3300005438 Unclassified 872
57 Ga0070711_100258256 3300005439 Unclassified 1369
58 Ga0070711_100464517 3300005439 Bacteria 1038
59 Ga0070711_100619795 3300005439 Unclassified 904
60 Ga0070705_100137768 3300005440 Bacteria 1602
61 Ga0070705_100324690 3300005440 Bacteria 1113
62 Ga0070700_100890266 3300005441 Unclassified 724
63 Ga0070708_100028769 3300005445 Unclassified 4784
64 Ga0070708_100149579 3300005445 Bacteria 2171
65 Ga0070708_100202249 3300005445 Unclassified 1860
66 Ga0070708_100243433 3300005445 Bacteria 1689
67 Ga0070708_100468473 3300005445 Unclassified 1189
68 Ga0068867_100208842 3300005459 Bacteria 1567
69 Ga0070706_100020796 3300005467 Bacteria 6042
70 Ga0070707_100052317 3300005468 Unclassified 3915
71 Ga0070707_100154125 3300005468 Unclassified 2238
72 Ga0070698_100006481 3300005471 Bacteria 12699
73 Ga0070698_100570866 3300005471 Bacteria 1071
74 Ga0070699_100000613 3300005518 Bacteria 33675
75 Ga0070699_100627678 3300005518 Unclassified 980
76 Ga0070699_100713929 3300005518 Bacteria 916
77 Ga0070684_100005125 3300005535 Bacteria 10015
78 Ga0070684_100090608 3300005535 Bacteria 2719
79 Ga0070684_100911931 3300005535 Bacteria 823
80 Ga0070697_100012519 3300005536 Bacteria 6646
81 Ga0070697_100066390 3300005536 Unclassified 2950
82 Ga0070697_100142814 3300005536 Unclassified 2014
83 Ga0070697_100174228 3300005536 Unclassified 1822
84 Ga0070697_100423403 3300005536 Unclassified 1157
85 Ga0070697_100581133 3300005536 Unclassified 984
86 Ga0070695_100005059 3300005545 Bacteria 7768
87 Ga0070665_100002176 3300005548 Bacteria 21848
88 Ga0070665_100012697 3300005548 Bacteria 8482
89 Ga0070665_100068465 3300005548 Bacteria 3559
90 Ga0070665_100290345 3300005548 Unclassified 1638
91 Ga0070704_100004451 3300005549 Bacteria 8094
92 Ga0070664_100063686 3300005564 Bacteria 3144
93 Ga0070664_100101082 3300005564 Bacteria 2507
94 Ga0070664_100456045 3300005564 Unclassified 1174
95 Ga0070664_100504219 3300005564 Bacteria 1116
96 Ga0068856_100016270 3300005614 Bacteria 7197
97 Ga0068856_100645962 3300005614 Unclassified 1079
98 Ga0068859_100017272 3300005617 Bacteria 7246
99 Ga0068859_100907259 3300005617 Unclassified 966
100 Ga0068861_100941251 3300005719 Bacteria 821
101 Ga0068863_100335886 3300005841 Unclassified 1469
102 Ga0068863_100466225 3300005841 Bacteria 1241
103 Ga0068858_100009151 3300005842 Bacteria 9471
104 Ga0068858_100083923 3300005842 Bacteria 2963
105 Ga0068858_100202165 3300005842 Bacteria 1879
106 Ga0068860_100707881 3300005843 Bacteria 1017
107 Ga0068860_100733778 3300005843 Bacteria 999
108 Ga0068862_100054231 3300005844 Bacteria 3433
109 Ga0068862_100116797 3300005844 Bacteria 2347
110 Ga0081455_10017383 3300005937 Bacteria 6898
111 Ga0081455_10025976 3300005937 Bacteria 5396
112 Ga0081539_10021706 3300005985 Bacteria 4276
113 Ga0070717_10005147 3300006028 Bacteria 9534
114 Ga0070715_10057201 3300006163 Archaea 1698
115 Ga0070715_10196564 3300006163 Bacteria 1022
116 Ga0070716_100024243 3300006173 Bacteria 3227
117 Ga0070712_100183966 3300006175 Unclassified 1630
118 Ga0070712_100311904 3300006175 Unclassified 1276
119 Ga0097621_100223450 3300006237 Bacteria 1642
120 Ga0097621_100839820 3300006237 Bacteria 853
121 Ga0068871_100012163 3300006358 Bacteria 6335
122 Ga0068871_100093022 3300006358 Unclassified 2515
123 Ga0068871_100112451 3300006358 Bacteria 2292
124 Ga0068871_100263190 3300006358 Bacteria 1505
125 Ga0075428_100000648 3300006844 Bacteria 35798
126 Ga0075428_100008430 3300006844 Bacteria 11434
127 Ga0075428_100038751 3300006844 Bacteria 5245
128 Ga0075428_100681232 3300006844 Bacteria 1096
129 Ga0075431_100023509 3300006847 Bacteria 6307
130 Ga0075433_10004237 3300006852 Bacteria 11139
131 Ga0075433_10057014 3300006852 Bacteria 3414
132 Ga0075433_10085313 3300006852 Bacteria 2787
133 Ga0075433_10229926 3300006852 Bacteria 1647
134 Ga0075433_10271672 3300006852 Bacteria 1502
135 Ga0075434_100004355 3300006871 Bacteria 12741
136 Ga0075434_100080433 3300006871 Bacteria 3256
137 Ga0075429_100018250 3300006880 Bacteria 6074
138 Ga0075429_100087041 3300006880 Bacteria 2723
139 Ga0075436_100009839 3300006914 Bacteria 6541
140 Ga0097620_100017272 3300006931 Bacteria 7246
141 Ga0097620_100907287 3300006931 Unclassified 966
142 Ga0075435_100013323 3300007076 Bacteria 6112
143 Ga0075435_100125889 3300007076 Bacteria 2141
144 Ga0099795_10090726 3300007788 Bacteria 1184
145 Ga0105240_10180218 3300009093 Bacteria 2494
146 Ga0111539_10188098 3300009094 Bacteria 2410
147 Ga0111539_11061944 3300009094 Unclassified 941
148 Ga0105245_10083133 3300009098 Bacteria 2930
149 Ga0105247_10157645 3300009101 Bacteria 1500
150 Ga0114129_10014999 3300009147 Bacteria 11033
151 Ga0114129_10017940 3300009147 Bacteria 10076
152 Ga0114129_10034966 3300009147 Bacteria 7098
153 Ga0114129_10038572 3300009147 Bacteria 6737
154 Ga0114129_10038584 3300009147 Bacteria 6736
155 Ga0114129_10052213 3300009147 Bacteria 5737
156 Ga0114129_10255366 3300009147 Bacteria 2351
157 Ga0114129_10429928 3300009147 Unclassified 1735
158 Ga0114129_10465223 3300009147 Bacteria 1657
159 Ga0114129_10465470 3300009147 Bacteria 1656
160 Ga0105243_10447527 3300009148 Bacteria 1211
161 Ga0105241_10446435 3300009174 Unclassified 1143
162 Ga0105242_10001965 3300009176 Bacteria 16173
163 Ga0105248_10019928 3300009177 Bacteria 7425
164 Ga0105248_10559059 3300009177 Unclassified 1291
165 Ga0105248_10758314 3300009177 Bacteria 1095
166 Ga0105246_10046142 3300011119 Bacteria 2970
167 Ga0157370_10183554 3300013104 Unclassified 1943
168 Ga0157369_10314820 3300013105 Bacteria 1627
169 Ga0157374_10005668 3300013296 Bacteria 10524
170 Ga0157374_10081427 3300013296 Bacteria 3072
171 Ga0157374_10421581 3300013296 Unclassified 1333
172 Ga0157374_10531916 3300013296 Unclassified 1182
173 Ga0157374_10725573 3300013296 Unclassified 1008
174 Ga0157374_10821462 3300013296 Bacteria 946
175 Ga0157378_10027536 3300013297 Bacteria 5015
176 Ga0157378_10358599 3300013297 Unclassified 1426
177 Ga0163162_10013939 3300013306 Bacteria 7853
178 Ga0163162_10224003 3300013306 Unclassified 2010
179 Ga0163162_11257583 3300013306 Unclassified 840
180 Ga0157372_10025310 3300013307 Bacteria 6450
181 Ga0157375_10261116 3300013308 Bacteria 1893
182 Ga0157375_10261685 3300013308 Bacteria 1892
183 Ga0163163_10352326 3300014325 Bacteria 1528
184 Ga0163163_10459167 3300014325 Bacteria 1334
185 Ga0163163_10513647 3300014325 Bacteria 1260
186 Ga0157379_10038154 3300014968 Bacteria 4286
187 Ga0157379_10185981 3300014968 Bacteria 1877
188 Ga0157376_10011314 3300014969 Bacteria 6572
189 Ga0157376_10042612 3300014969 Bacteria 3721
190 Ga0157376_10052196 3300014969 Bacteria 3399
191 Ga0157376_10057211 3300014969 Bacteria 3261
192 Ga0207673_1004548 3300025290 Bacteria 1663
193 Ga0207697_10004047 3300025315 Bacteria 7094
194 Ga0207697_10010551 3300025315 Bacteria 3945
195 Ga0207697_10067146 3300025315 Unclassified 1499
196 Ga0207692_10070249 3300025898 Unclassified 1843
197 Ga0207680_10024607 3300025903 Bacteria 3307
198 Ga0207680_10425126 3300025903 Unclassified 941
199 Ga0207699_10010716 3300025906 Unclassified 4610
200 Ga0207699_10464126 3300025906 Unclassified 910
201 Ga0207645_10019425 3300025907 Bacteria 4454
202 Ga0207645_10118077 3300025907 Bacteria 1721
203 Ga0207684_10016982 3300025910 Bacteria 6253
204 Ga0207684_10067227 3300025910 Unclassified 3045
205 Ga0207684_10228442 3300025910 Bacteria 1606
206 Ga0207654_10229063 3300025911 Bacteria 1237
207 Ga0207693_10034176 3300025915 Unclassified 4011
208 Ga0207693_10242832 3300025915 Bacteria 1414
209 Ga0207663_10592820 3300025916 Unclassified 870
210 Ga0207662_10124220 3300025918 Bacteria 1621
211 Ga0207662_10317260 3300025918 Unclassified 1040
212 Ga0207646_10025044 3300025922 Bacteria 5462
213 Ga0207646_10068355 3300025922 Bacteria 3172
214 Ga0207646_10624854 3300025922 Bacteria 966
215 Ga0207646_10808346 3300025922 Unclassified 835
216 Ga0207681_10705621 3300025923 Unclassified 839
217 Ga0207659_10047323 3300025926 Unclassified 3042
218 Ga0207659_10051899 3300025926 Bacteria 2919
219 Ga0207659_10472601 3300025926 Bacteria 1058
220 Ga0207700_10014743 3300025928 Bacteria 5131
221 Ga0207700_10568587 3300025928 Unclassified 1007
222 Ga0207664_10314009 3300025929 Archaea 1381
223 Ga0207644_10066922 3300025931 Bacteria 2617
224 Ga0207644_10081871 3300025931 Bacteria 2387
225 Ga0207706_10057069 3300025933 Unclassified 3441
226 Ga0207706_10253604 3300025933 Unclassified 1536
227 Ga0207686_10010909 3300025934 Bacteria 4958
228 Ga0207670_10046633 3300025936 Bacteria 2881
229 Ga0207669_10012672 3300025937 Unclassified 4155
230 Ga0207704_10495042 3300025938 Bacteria 984
231 Ga0207665_10029539 3300025939 Bacteria 3623
232 Ga0207691_10082177 3300025940 Bacteria 2894
233 Ga0207711_10770107 3300025941 Unclassified 897
234 Ga0207661_10098468 3300025944 Unclassified 2451
235 Ga0207661_10457774 3300025944 Bacteria 1163
236 Ga0207679_10134185 3300025945 Bacteria 1991
237 Ga0207651_10017113 3300025960 Bacteria 4272
238 Ga0207712_10921148 3300025961 Bacteria 773
239 Ga0207668_10045994 3300025972 Bacteria 2979
240 Ga0207640_10294194 3300025981 Unclassified 1281
241 Ga0207640_10431111 3300025981 Bacteria 1081
242 Ga0207658_10224885 3300025986 Unclassified 1581
243 Ga0207658_10389196 3300025986 Bacteria 1223
244 Ga0207677_10201023 3300026023 Bacteria 1584
245 Ga0207677_10257039 3300026023 Bacteria 1422
246 Ga0207703_10035610 3300026035 Bacteria 3956
247 Ga0207703_10079643 3300026035 Bacteria 2726
248 Ga0207703_10158425 3300026035 Bacteria 1981
249 Ga0207678_10087275 3300026067 Bacteria 2666
250 Ga0207702_10118645 3300026078 Bacteria 2364
251 Ga0207641_10292132 3300026088 Unclassified 1537
252 Ga0207641_10576965 3300026088 Bacteria 1099
253 Ga0207648_10299144 3300026089 Bacteria 1443
254 Ga0207648_10865763 3300026089 Bacteria 843
255 Ga0207683_10082885 3300026121 Bacteria 2850
256 Ga0207683_10290185 3300026121 Bacteria 1496
257 Ga0207428_10140184 3300027907 Unclassified 1846
258 Ga0207428_10438626 3300027907 Bacteria 953
259 Ga0268266_10002791 3300028379 Bacteria 18207
260 Ga0268266_10016835 3300028379 Bacteria 6247
261 Ga0268266_10063216 3300028379 Bacteria 3195
262 Ga0268266_10063334 3300028379 Unclassified 3192
263 Ga0268265_10080805 3300028380 Bacteria 2565
264 Ga0268265_10394934 3300028380 Bacteria 1277
265 Ga0268265_11124022 3300028380 Bacteria 781
266 Ga0268264_10105587 3300028381 Bacteria 2457
267 Ga0268264_10409834 3300028381 Bacteria 1305
268 Ga0268264_10674729 3300028381 Bacteria 1025
269 Ga0265338_10365123 3300028800 Bacteria 1035
270 Ga0265325_10156107 3300031241 Unclassified 1076
271 Ga0307513_10106777 3300031456 Bacteria 2805
272 Ga0373929_0063961 3300035085 Unclassified 867
273 Ga0373957_0154261 3300035120 Unclassified 944
274 Ga0373943_0024572 3300035170 Bacteria 2810
275 Ga0373943_0157062 3300035170 Unclassified 1236
276 Ga0373943_0167889 3300035170 Bacteria 1199
277 Ga0373935_0016078 3300035692 Bacteria 4528
278 Ga0373935_0232305 3300035692 Bacteria 1285
279 Ga0373947_0036865 3300035725 Unclassified 2900
280 Ga0373947_0041166 3300035725 Bacteria 2754
281 Ga0373947_0226319 3300035725 Unclassified 1231
282 Ga0373937_0168349 3300036401 Bacteria 2055
283 Ga0373925_0039323 3300037068 Bacteria 3500
284 Ga0373925_0168873 3300037068 Bacteria 1726
285 Ga0373925_0802098 3300037068 Unclassified 776
286 Ga0439440_0068142 3300042993 Bacteria 921
287 Ga0466960_0103160 3300044901 Bacteria 1472
288 Ga0466967_0161679 3300045976 Unclassified 2102
289 Ga0466967_0163926 3300045976 Bacteria 2088
290 Ga0466967_0351547 3300045976 Unclassified 1427
291 Ga0466967_0428320 3300045976 Unclassified 1290
292 Ga0466967_1165876 3300045976 Unclassified 768
293 Ga0495592_0016426 3300046454 Bacteria 5615
294 Ga0495592_0210868 3300046454 Bacteria 1304
295 Ga0495641_0122845 3300046461 Unclassified 1159
296 Ga0495582_0342710 3300046473 Bacteria 860
297 Ga0495639_0048845 3300046475 Bacteria 1920
298 Ga0495594_0317462 3300046499 Unclassified 888
299 Ga0495630_0432458 3300046517 Unclassified 1008
300 Ga0495630_0794104 3300046517 Unclassified 723
301 Ga0495644_0102783 3300046523 Unclassified 1082
302 Ga0495644_0221397 3300046523 Bacteria 732
303 Ga0495666_0117655 3300046526 Unclassified 1246
304 Ga0495652_0053447 3300046529 Bacteria 3442
305 Ga0495652_0342769 3300046529 Unclassified 1073
306 Ga0495640_0095830 3300046533 Bacteria 1953
307 Ga0495640_0485957 3300046533 Bacteria 752
308 Ga0495586_0213711 3300046535 Unclassified 1095
309 Ga0495598_0076167 3300046537 Unclassified 1067
310 Ga0495645_0180346 3300046543 Bacteria 1447
311 Ga0495645_0462138 3300046543 Bacteria 799
312 Ga0495634_0030660 3300046642 Bacteria 3712
313 Ga0495588_0123049 3300046674 Unclassified 1368
314 Ga0495657_0235504 3300046675 Bacteria 1106
315 Ga0495623_0023095 3300046679 Unclassified 4015
316 Ga0495646_0018194 3300046680 Bacteria 4450
317 Ga0495646_0184783 3300046680 Unclassified 1142
318 Ga0495658_0163765 3300046683 Unclassified 1373
319 Ga0495669_0053555 3300046684 Unclassified 1815
320 Ga0495613_0080804 3300046689 Unclassified 2363
321 Ga0495613_0391552 3300046689 Unclassified 949
322 Ga0495581_0378636 3300047315 Bacteria 826
323 Ga0495674_0162594 3300047319 Bacteria 1867
324 Ga0495674_0380525 3300047319 Bacteria 1142
325 Ga0495672_0002020 3300047320 Bacteria 19130
326 Ga0495675_0042559 3300047444 Bacteria 2893
327 Ga0495684_0002940 3300047471 Bacteria 13419
328 Ga0496102_0036755 3300048905 Bacteria 4414
329 Ga0496102_0561797 3300048905 Unclassified 1064
330 Ga0496104_0046651 3300048907 Bacteria 4081
331 Ga0496104_0118547 3300048907 Bacteria 2541
332 Ga0496104_0435601 3300048907 Bacteria 1223
333 Ga0496104_0691023 3300048907 Unclassified 928
334 Ga0496105_0348640 3300048908 Bacteria 1183
335 Ga0496108_0043495 3300048911 Bacteria 3752
336 Ga0496108_0239271 3300048911 Bacteria 1579
337 Ga0496109_0055664 3300048912 Bacteria 3608
338 Ga0496110_0035261 3300048913 Bacteria 4340
339 Ga0496112_0092884 3300048915 Bacteria 2987
340 Ga0496112_0095182 3300048915 Bacteria 2949
341 Ga0496112_0109548 3300048915 Unclassified 2732
342 Ga0496113_0036294 3300048916 Bacteria 3610
343 Ga0496114_0144780 3300048917 Unclassified 2059
344 Ga0496114_0925051 3300048917 Unclassified 754
345 Ga0496115_0003071 3300048918 Bacteria 11989
346 Ga0496115_0188390 3300048918 Archaea 1705
347 Ga0501033_0324532 3300049570 Bacteria 1081
348 Ga0501038_0337258 3300049574 Bacteria 1176
349 Ga0501041_0054658 3300049577 Bacteria 2436
350 Ga0501075_0310256 3300049591 Bacteria 1202
351 Ga0501079_0530163 3300049741 Bacteria 926
352 Ga0501081_0018622 3300049743 Bacteria 4614
353 Ga0501083_0503957 3300049744 Bacteria 788
354 Ga0501045_0384920 3300049824 Bacteria 1044
355 nmdc:mga05p37_116512_c1 3300050507 Bacteria 3283
356 nmdc:mga05p37_362635_c1 3300050507 Bacteria 1703
357 nmdc:mga05p37_393576_c1 3300050507 Bacteria 1620
358 nmdc:mga05p37_5669_c1 3300050507 Bacteria 14680
359 nmdc:mga05p37_7252_c1 3300050507 Bacteria 13075
360 nmdc:mga05p37_886365_c1 3300050507 Bacteria 964
361 nmdc:mga05p37_922425_c1 3300050507 Unclassified 939
362 nmdc:mga09592_218943_c1 3300050508 Unclassified 1650
363 nmdc:mga09592_32613_c1 3300050508 Bacteria 4342
364 nmdc:mga06r32_22102_c1 3300050510 Bacteria 5877
365 nmdc:mga0n895_1285357_c1 3300050512 Bacteria 703
366 nmdc:mga0n895_149463_c1 3300050512 Bacteria 2365
367 nmdc:mga0n895_55745_c1 3300050512 Unclassified 3891
368 nmdc:mga0n895_763287_c1 3300050512 Bacteria 959
369 nmdc:mga0n895_89550_c1 3300050512 Bacteria 3078
370 nmdc:mga0a205_15963_c1 3300050515 Bacteria 7026
371 nmdc:mga0a205_17736_c1 3300050515 Bacteria 3448
372 nmdc:mga0a205_351771_c1 3300050515 Bacteria 1341
373 nmdc:mga0a205_456123_c1 3300050515 Bacteria 1138
374 Ga0495601_0182356 3300053077 Bacteria 1372
375 Ga0495619_0092477 3300053085 Bacteria 2049
376 Ga0495619_0282936 3300053085 Unclassified 1149
377 Ga0501084_0236511 3300054114 Bacteria 1542
378 Ga0501082_0039766 3300060353 Bacteria 4057
379 Ga0373946_0088860
380 CNXas_1000010
381 Ga0065704_10083926
382 Ga0065712_10001096
383 Ga0065712_10011308
384 Ga0065712_10092175
385 Ga0065712_10366122
386 Ga0065715_10004264
387 Ga0065715_10177679
388 Ga0065715_10213712
389 Ga0065707_10111064
390 Ga0065707_10231601
391 Ga0070658_10627768
392 Ga0070676_10016099
393 Ga0070676_10219054
394 Ga0070676_10251618
395 Ga0070683_100026392
396 Ga0070683_100071050
397 Ga0070690_100624221
398 Ga0070670_100031230
399 Ga0070670_100292964
400 Ga0068869_100411418
401 Ga0070666_10051046
402 Ga0070666_10241808
403 Ga0070666_10557778
404 Ga0070680_100068202
405 Ga0070682_100118320
406 Ga0070682_100499488
407 Ga0068868_100128382
408 Ga0068868_100270510
409 Ga0070689_100064813
410 Ga0070687_100359391
411 Ga0070661_100074102
412 Ga0070668_100092317
413 Ga0070669_100134869
414 Ga0070675_100048809
415 Ga0070675_100495815
416 Ga0070671_100016244
417 Ga0070671_100157124
418 Ga0070673_100007005
419 Ga0070673_100145176
420 Ga0070673_100285514
421 Ga0070673_100390336
422 Ga0070688_100045872
423 Ga0070688_100115274
424 Ga0070688_100169743
425 Ga0070688_100454872
426 Ga0070667_100383179
427 Ga0070667_100408574
428 Ga0070667_100833860
429 Ga0070709_10074699
430 Ga0070714_100687647
431 Ga0070713_100006174
432 Ga0070713_100128658
433 Ga0070713_100131046
434 Ga0070701_10397929
435 Ga0070711_100258256
436 Ga0070711_100464517
437 Ga0070711_100619795
438 Ga0070705_100137768
439 Ga0070705_100324690
440 Ga0070700_100890266
441 Ga0070708_100028769
442 Ga0070708_100149579
443 Ga0070708_100202249
444 Ga0070708_100243433
445 Ga0070708_100468473
446 Ga0068867_100208842
447 Ga0070706_100020796
448 Ga0070707_100052317
449 Ga0070707_100154125
450 Ga0070698_100006481
451 Ga0070698_100570866
452 Ga0070699_100000613
453 Ga0070699_100627678
454 Ga0070699_100713929
455 Ga0070684_100005125
456 Ga0070684_100090608
457 Ga0070684_100911931
458 Ga0070697_100012519
459 Ga0070697_100066390
460 Ga0070697_100142814
461 Ga0070697_100174228
462 Ga0070697_100423403
463 Ga0070697_100581133
464 Ga0070695_100005059
465 Ga0070665_100002176
466 Ga0070665_100012697
467 Ga0070665_100068465
468 Ga0070665_100290345
469 Ga0070704_100004451
470 Ga0070664_100063686
471 Ga0070664_100101082
472 Ga0070664_100456045
473 Ga0070664_100504219
474 Ga0068856_100016270
475 Ga0068856_100645962
476 Ga0068859_100017272
477 Ga0068859_100907259
478 Ga0068861_100941251
479 Ga0068863_100335886
480 Ga0068863_100466225
481 Ga0068858_100009151
482 Ga0068858_100083923
483 Ga0068858_100202165
484 Ga0068860_100707881
485 Ga0068860_100733778
486 Ga0068862_100054231
487 Ga0068862_100116797
488 Ga0081455_10017383
489 Ga0081455_10025976
490 Ga0081539_10021706
491 Ga0070717_10005147
492 Ga0070715_10057201
493 Ga0070715_10196564
494 Ga0070716_100024243
495 Ga0070712_100183966
496 Ga0070712_100311904
497 Ga0097621_100223450
498 Ga0097621_100839820
499 Ga0068871_100012163
500 Ga0068871_100093022
501 Ga0068871_100112451
502 Ga0068871_100263190
503 Ga0075428_100000648
504 Ga0075428_100008430
505 Ga0075428_100038751
506 Ga0075428_100681232
507 Ga0075431_100023509
508 Ga0075433_10004237
509 Ga0075433_10057014
510 Ga0075433_10085313
511 Ga0075433_10229926
512 Ga0075433_10271672
513 Ga0075434_100004355
514 Ga0075434_100080433
515 Ga0075429_100018250
516 Ga0075429_100087041
517 Ga0075436_100009839
518 Ga0097620_100017272
519 Ga0097620_100907287
520 Ga0075435_100013323
521 Ga0075435_100125889
522 Ga0099795_10090726
523 Ga0105240_10180218
524 Ga0111539_10188098
525 Ga0111539_11061944
526 Ga0105245_10083133
527 Ga0105247_10157645
528 Ga0114129_10014999
529 Ga0114129_10017940
530 Ga0114129_10034966
531 Ga0114129_10038572
532 Ga0114129_10038584
533 Ga0114129_10052213
534 Ga0114129_10255366
535 Ga0114129_10429928
536 Ga0114129_10465223
537 Ga0114129_10465470
538 Ga0105243_10447527
539 Ga0105241_10446435
540 Ga0105242_10001965
541 Ga0105248_10019928
542 Ga0105248_10559059
543 Ga0105248_10758314
544 Ga0105246_10046142
545 Ga0157370_10183554
546 Ga0157369_10314820
547 Ga0157374_10005668
548 Ga0157374_10081427
549 Ga0157374_10421581
550 Ga0157374_10531916
551 Ga0157374_10725573
552 Ga0157374_10821462
553 Ga0157378_10027536
554 Ga0157378_10358599
555 Ga0163162_10013939
556 Ga0163162_10224003
557 Ga0163162_11257583
558 Ga0157372_10025310
559 Ga0157375_10261116
560 Ga0157375_10261685
561 Ga0163163_10352326
562 Ga0163163_10459167
563 Ga0163163_10513647
564 Ga0157379_10038154
565 Ga0157379_10185981
566 Ga0157376_10011314
567 Ga0157376_10042612
568 Ga0157376_10052196
569 Ga0157376_10057211
570 Ga0207673_1004548
571 Ga0207697_10004047
572 Ga0207697_10010551
573 Ga0207697_10067146
574 Ga0207692_10070249
575 Ga0207680_10024607
576 Ga0207680_10425126
577 Ga0207699_10010716
578 Ga0207699_10464126
579 Ga0207645_10019425
580 Ga0207645_10118077
581 Ga0207684_10016982
582 Ga0207684_10067227
583 Ga0207684_10228442
584 Ga0207654_10229063
585 Ga0207693_10034176
586 Ga0207693_10242832
587 Ga0207663_10592820
588 Ga0207662_10124220
589 Ga0207662_10317260
590 Ga0207646_10025044
591 Ga0207646_10068355
592 Ga0207646_10624854
593 Ga0207646_10808346
594 Ga0207681_10705621
595 Ga0207659_10047323
596 Ga0207659_10051899
597 Ga0207659_10472601
598 Ga0207700_10014743
599 Ga0207700_10568587
600 Ga0207664_10314009
601 Ga0207644_10066922
602 Ga0207644_10081871
603 Ga0207706_10057069
604 Ga0207706_10253604
605 Ga0207686_10010909
606 Ga0207670_10046633
607 Ga0207669_10012672
608 Ga0207704_10495042
609 Ga0207665_10029539
610 Ga0207691_10082177
611 Ga0207711_10770107
612 Ga0207661_10098468
613 Ga0207661_10457774
614 Ga0207679_10134185
615 Ga0207651_10017113
616 Ga0207712_10921148
617 Ga0207668_10045994
618 Ga0207640_10294194
619 Ga0207640_10431111
620 Ga0207658_10224885
621 Ga0207658_10389196
622 Ga0207677_10201023
623 Ga0207677_10257039
624 Ga0207703_10035610
625 Ga0207703_10079643
626 Ga0207703_10158425
627 Ga0207678_10087275
628 Ga0207702_10118645
629 Ga0207641_10292132
630 Ga0207641_10576965
631 Ga0207648_10299144
632 Ga0207648_10865763
633 Ga0207683_10082885
634 Ga0207683_10290185
635 Ga0207428_10140184
636 Ga0207428_10438626
637 Ga0268266_10002791
638 Ga0268266_10016835
639 Ga0268266_10063216
640 Ga0268266_10063334
641 Ga0268265_10080805
642 Ga0268265_10394934
643 Ga0268265_11124022
644 Ga0268264_10105587
645 Ga0268264_10409834
646 Ga0268264_10674729
647 Ga0265338_10365123
648 Ga0265325_10156107
649 Ga0307513_10106777
650 Ga0373929_0063961
651 Ga0373957_0154261
652 Ga0373943_0024572
653 Ga0373943_0157062
654 Ga0373943_0167889
655 Ga0373935_0016078
656 Ga0373935_0232305
657 Ga0373947_0036865
658 Ga0373947_0041166
659 Ga0373947_0226319
660 Ga0373937_0168349
661 Ga0373925_0039323
662 Ga0373925_0168873
663 Ga0373925_0802098
664 Ga0439440_0068142
665 Ga0466960_0103160
666 Ga0466967_0161679
667 Ga0466967_0163926
668 Ga0466967_0351547
669 Ga0466967_0428320
670 Ga0466967_1165876
671 Ga0495592_0016426
672 Ga0495592_0210868
673 Ga0495641_0122845
674 Ga0495582_0342710
675 Ga0495639_0048845
676 Ga0495594_0317462
677 Ga0495630_0432458
678 Ga0495630_0794104
679 Ga0495644_0102783
680 Ga0495644_0221397
681 Ga0495666_0117655
682 Ga0495652_0053447
683 Ga0495652_0342769
684 Ga0495640_0095830
685 Ga0495640_0485957
686 Ga0495586_0213711
687 Ga0495598_0076167
688 Ga0495645_0180346
689 Ga0495645_0462138
690 Ga0495634_0030660
691 Ga0495588_0123049
692 Ga0495657_0235504
693 Ga0495623_0023095
694 Ga0495646_0018194
695 Ga0495646_0184783
696 Ga0495658_0163765
697 Ga0495669_0053555
698 Ga0495613_0080804
699 Ga0495613_0391552
700 Ga0495581_0378636
701 Ga0495674_0162594
702 Ga0495674_0380525
703 Ga0495672_0002020
704 Ga0495675_0042559
705 Ga0495684_0002940
706 Ga0496102_0036755
707 Ga0496102_0561797
708 Ga0496104_0046651
709 Ga0496104_0118547
710 Ga0496104_0435601
711 Ga0496104_0691023
712 Ga0496105_0348640
713 Ga0496108_0043495
714 Ga0496108_0239271
715 Ga0496109_0055664
716 Ga0496110_0035261
717 Ga0496112_0092884
718 Ga0496112_0095182
719 Ga0496112_0109548
720 Ga0496113_0036294
721 Ga0496114_0144780
722 Ga0496114_0925051
723 Ga0496115_0003071
724 Ga0496115_0188390
725 Ga0501033_0324532
726 Ga0501038_0337258
727 Ga0501041_0054658
728 Ga0501075_0310256
729 Ga0501079_0530163
730 Ga0501081_0018622
731 Ga0501083_0503957
732 Ga0501045_0384920
733 nmdc:mga05p37_116512_c1
734 nmdc:mga05p37_362635_c1
735 nmdc:mga05p37_393576_c1
736 nmdc:mga05p37_5669_c1
737 nmdc:mga05p37_7252_c1
738 nmdc:mga05p37_886365_c1
739 nmdc:mga05p37_922425_c1
740 nmdc:mga09592_218943_c1
741 nmdc:mga09592_32613_c1
742 nmdc:mga06r32_22102_c1
743 nmdc:mga0n895_1285357_c1
744 nmdc:mga0n895_149463_c1
745 nmdc:mga0n895_55745_c1
746 nmdc:mga0n895_763287_c1
747 nmdc:mga0n895_89550_c1
748 nmdc:mga0a205_15963_c1
749 nmdc:mga0a205_17736_c1
750 nmdc:mga0a205_351771_c1
751 nmdc:mga0a205_456123_c1
752 Ga0495601_0182356
753 Ga0495619_0092477
754 Ga0495619_0282936
755 Ga0501084_0236511
756 Ga0501082_0039766

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04199

Cyclase

Putative cyclase

36

189

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
4cog-assembly2.cif.gz_D crystal structure of kynurenine formamidase from burkholderia cenocepacia 0.9545 2 216
4co9-assembly2.cif.gz_A crystal structure of kynurenine formamidase from bacillus anthracis 0.9478 2 219
4co9-assembly2.cif.gz_A crystal structure of kynurenine formamidase from bacillus anthracis 0.9345 2 219
4cog-assembly2.cif.gz_D crystal structure of kynurenine formamidase from burkholderia cenocepacia 0.9322 2 216
4cob-assembly1.cif.gz_B crystal structure kynurenine formamidase from pseudomonas aeruginosa 0.9064 2 216
ID Description Score Start End Superfamily
4co9B00 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Putative cyclase 0.9506 1 219 3.50.30.50
4co9B00 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Putative cyclase 0.9416 1 219 3.50.30.50
4cobB00 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Putative cyclase 0.9064 2 216 3.50.30.50
4cobB00 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Putative cyclase 0.8856 2 216 3.50.30.50
3krvB00 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Putative cyclase 0.8653 2 216 3.50.30.50
ID Description Score Start End GO Terms
AF-A0A2V6KI56-F1-model_v4 Kynurenine formamidase 0.9978 118 219 GO:0004061
GO:0019441
AF-A0A2V5R5Y2-F1-model_v4 Arylformamidase 0.9797 1 219 GO:0004061
GO:0019441
AF-A0A2V6KI56-F1-model_v4 Kynurenine formamidase 0.9786 118 219 GO:0004061
GO:0019441
AF-A0A2V5YJL6-F1-model_v4 Arylformamidase 0.9779 1 219 GO:0004061
GO:0019441
AF-A0A2V5YJL6-F1-model_v4 Arylformamidase 0.9735 1 219 GO:0004061
GO:0019441

Map