F428059

General Info

Members Datasets Scaffolds Average Seq Length
378 286 300 82

Family's Representative Sequence

Representative Sequence 3300031456|Ga0307513_10014591|Ga0307513_100145918
Length 75
Sequence MLELRPTCECCNCDLAPDSPDARICTFECTFDVLDGVCPNCGGNFVPRPIRPAALLDRYPASTKRVLKAEGCKAA

Samples

Sample ID Description Type Environment
1 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
2 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
3 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
4 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
5 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
6 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
7 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
8 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
9 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
10 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
11 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
12 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
13 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
14 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
15 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
16 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
17 2643221599 Rhizobium sp. Root708 Isolate Unclassified
18 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
19 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
20 2643221693 Rhizobium sp. Root491 Isolate Unclassified
21 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
22 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
23 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
24 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
25 2791355256 Rhizobium sp. M10 Isolate Nodule
26 2791355261 Rhizobium sp. J15 Isolate Nodule
27 2791355262 Rhizobium sp. M1 Isolate Nodule
28 2791355265 Rhizobium sp. H4 Isolate Nodule
29 2791355267 Rhizobium sp. L18 Isolate Nodule
30 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
31 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
32 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
33 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
34 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
35 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
36 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
37 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
38 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
39 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
40 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
41 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
42 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
43 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
44 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
45 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
46 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
47 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
48 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
49 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
50 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
51 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
52 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
53 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
54 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
55 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
56 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
57 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
58 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
59 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
60 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
61 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
62 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
63 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
64 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
65 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
66 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
67 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
68 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
69 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
70 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
71 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
72 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
73 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
74 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
75 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
76 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
77 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
78 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
79 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
80 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
81 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
82 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
83 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
84 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
85 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
86 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
87 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
88 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
89 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
90 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
91 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
92 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
93 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
94 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
95 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
96 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
97 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
98 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
99 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
100 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
101 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
102 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
103 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
104 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
105 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
106 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
107 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
108 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
109 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
110 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
111 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
112 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
113 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
114 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
115 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
116 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
117 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
118 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
119 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
120 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
121 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
122 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
123 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
124 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
125 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
126 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
127 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
128 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
130 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
131 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
132 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
133 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
134 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
135 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
136 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
138 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
139 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
140 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
141 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
142 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
143 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
169 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
170 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
172 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
173 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
174 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
175 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
176 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
177 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
178 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
179 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
180 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
181 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
182 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
183 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
184 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
185 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
186 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
187 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
188 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
189 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
190 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
191 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
192 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
193 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
194 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
195 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
196 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
197 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
198 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
199 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
200 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
201 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
202 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
203 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
204 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
205 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
206 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
207 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
208 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
209 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
210 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
211 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
212 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
213 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
214 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
215 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
216 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
217 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
218 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
219 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
220 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
221 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
222 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
223 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
224 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
225 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
226 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
227 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
228 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
229 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
230 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
231 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
232 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
233 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
234 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
235 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
236 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
237 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
238 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
239 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
240 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
241 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
242 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
243 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
244 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
245 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
246 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
247 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
248 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
249 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
250 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
251 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
252 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
253 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
254 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
255 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
256 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
257 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
258 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
259 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
260 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
261 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
262 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
263 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
264 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
265 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
266 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
267 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
268 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
269 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
270 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
271 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
272 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
273 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
274 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
275 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
276 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
277 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
278 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
279 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
280 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
281 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
282 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
283 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
284 8024501048 Rhizobium sp. H4 Isolate Nodule
285 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
286 8056382006 Rhizobium croatiense 13T Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 79.37
Metatranscriptomes 0
Isolates 20.63

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 26.46
Nodule 12.96
Rhizoplane 4.23
Rhizosphere 43.12
Stem 0
Stem Tuber 0
Unclassified 13.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10141971 3300001989 Bacteria 712
2 JGI25162J39368_1000149 3300002737 Bacteria 76227
3 JGI25152J39213_1001439 3300002773 Bacteria 10264
4 JGI25152J39213_1002125 3300002773 Bacteria 7773
5 JGI25152J39213_1004677 3300002773 Bacteria 4238
6 JGI25150J39212_1004426 3300002774 Bacteria 3125
7 JGI25150J39212_1018082 3300002774 Bacteria 1126
8 JGI25159J45721_1001753 3300002987 Bacteria 8728
9 JGI25165J46597_1001553 3300003214 Bacteria 11382
10 JGI25153J46596_10000002 3300003215 Bacteria 653569
11 JGI25153J46596_10004225 3300003215 Bacteria 7778
12 JGI25153J46596_10004765 3300003215 Bacteria 7231
13 rootH1_10130903 3300003316 Bacteria 1776
14 rootH2_10147178 3300003320 Bacteria 2037
15 rootL2_10082099 3300003322 Bacteria 3216
16 JGI25160J50197_1005146 3300003354 Bacteria 5497
17 JGI25160J50197_1012339 3300003354 Bacteria 2972
18 JGI25161J50226_1000490 3300003374 Bacteria 17851
19 Ga0055526_1001847 3300003771 Bacteria 14659
20 Ga0055526_1005836 3300003771 Bacteria 6915
21 Ga0055526_1050427 3300003771 Bacteria 954
22 Ga0055526_1077173 3300003771 Bacteria 658
23 Ga0055524_1007195 3300003775 Bacteria 4760
24 Ga0055524_1027990 3300003775 Bacteria 1698
25 Ga0055524_1062053 3300003775 Bacteria 769
26 Ga0055528_1004885 3300003790 Bacteria 6344
27 Ga0055528_1015412 3300003790 Bacteria 2763
28 Ga0055540_1009938 3300003792 Bacteria 3217
29 Ga0055540_1029373 3300003792 Bacteria 1287
30 Ga0055540_1041541 3300003792 Bacteria 990
31 Ga0055543_1000220 3300004625 Bacteria 45860
32 Ga0065165_1006866 3300005262 Bacteria 5789
33 Ga0070677_10052605 3300005333 Bacteria 1653
34 Ga0070666_10068054 3300005335 Bacteria 2419
35 Ga0070660_100601769 3300005339 Bacteria 919
36 Ga0070660_100650327 3300005339 Bacteria 883
37 Ga0070689_101796185 3300005340 Bacteria 559
38 Ga0070661_100388288 3300005344 Bacteria 1102
39 Ga0070661_100392125 3300005344 Bacteria 1096
40 Ga0070668_100085999 3300005347 Bacteria 2472
41 Ga0070671_100044977 3300005355 Bacteria 3669
42 Ga0070674_100031936 3300005356 Bacteria 3493
43 Ga0070673_101052699 3300005364 Bacteria 759
44 Ga0070659_100005136 3300005366 Bacteria 9388
45 Ga0070667_100413448 3300005367 Bacteria 1229
46 Ga0070667_100540302 3300005367 Bacteria 1071
47 Ga0070663_100426191 3300005455 Bacteria 1089
48 Ga0070663_100488380 3300005455 Bacteria 1021
49 Ga0070662_100338558 3300005457 Bacteria 1230
50 Ga0070662_100436792 3300005457 Bacteria 1085
51 Ga0070665_100357814 3300005548 Bacteria 1465
52 Ga0068855_101885732 3300005563 Bacteria 606
53 Ga0070664_102074446 3300005564 Bacteria 539
54 Ga0068856_100537155 3300005614 Bacteria 1190
55 Ga0068852_100721998 3300005616 Bacteria 1007
56 Ga0068864_102552652 3300005618 Bacteria 517
57 Ga0068862_100776757 3300005844 Bacteria 934
58 Ga0081540_1332453 3300005983 Bacteria 520
59 Ga0075365_10057051 3300006038 Bacteria 2598
60 Ga0075365_10204870 3300006038 Bacteria 1382
61 Ga0075365_10340828 3300006038 Bacteria 1056
62 Ga0075363_100052024 3300006048 Bacteria 2186
63 Ga0075363_100080225 3300006048 Bacteria 1784
64 Ga0075364_10660775 3300006051 Bacteria 714
65 Ga0075362_10060097 3300006177 Bacteria 1717
66 Ga0075369_10001801 3300006186 Bacteria 7460
67 Ga0075366_10120517 3300006195 Bacteria 1581
68 Ga0075366_10467138 3300006195 Bacteria 779
69 Ga0075370_10188697 3300006353 Bacteria 1214
70 Ga0099826_10000404 3300006948 Bacteria 20366
71 Ga0105243_11706099 3300009148 Bacteria 659
72 Ga0105241_10156312 3300009174 Bacteria 1870
73 Ga0105248_10276238 3300009177 Bacteria 1891
74 Ga0105237_10587519 3300009545 Bacteria 1121
75 Ga0123342_1017418 3300009766 Bacteria 5976
76 Ga0157373_10213200 3300013100 Bacteria 1362
77 Ga0157371_10000165 3300013102 Bacteria 96321
78 Ga0157370_10724864 3300013104 Bacteria 907
79 Ga0157369_10289303 3300013105 Bacteria 1706
80 Ga0157372_12818527 3300013307 Bacteria 557
81 Ga0163163_11592575 3300014325 Bacteria 714
82 Ga0213874_10130436 3300021377 Bacteria 863
83 Ga0209436_100272 3300025208 Bacteria 23718
84 Ga0209672_105709 3300025228 Bacteria 2104
85 Ga0209437_100058 3300025233 Bacteria 357279
86 Ga0207425_1000495 3300025245 Bacteria 24691
87 Ga0207425_1067682 3300025245 Bacteria 617
88 Ga0207425_1087272 3300025245 Bacteria 513
89 Ga0209646_1008472 3300025246 Bacteria 1652
90 Ga0209129_1000810 3300025258 Bacteria 19737
91 Ga0209129_1002064 3300025258 Bacteria 10356
92 Ga0209129_1006087 3300025258 Bacteria 4030
93 Ga0209233_1000149 3300025261 Bacteria 181183
94 Ga0209673_1004170 3300025273 Bacteria 7899
95 Ga0209673_1007952 3300025273 Bacteria 4785
96 Ga0209673_1030779 3300025273 Bacteria 1683
97 Ga0209130_1000023 3300025284 Bacteria 359355
98 Ga0209130_1021240 3300025284 Bacteria 1469
99 Ga0209130_1046625 3300025284 Bacteria 808
100 Ga0209676_1118043 3300025292 Bacteria 536
101 Ga0209025_1004713 3300025294 Bacteria 11638
102 Ga0209025_1044879 3300025294 Bacteria 1840
103 Ga0209564_1002794 3300025295 Bacteria 13027
104 Ga0209564_1008336 3300025295 Bacteria 5130
105 Ga0209758_1000001 3300025297 Bacteria 1981790
106 Ga0209758_1000666 3300025297 Bacteria 51353
107 Ga0209758_1001689 3300025297 Bacteria 24856
108 Ga0209758_1082968 3300025297 Bacteria 963
109 Ga0209256_1003508 3300025299 Bacteria 10927
110 Ga0209256_1004538 3300025299 Bacteria 8646
111 Ga0209256_1060973 3300025299 Bacteria 878
112 Ga0207426_1000087 3300025302 Bacteria 288870
113 Ga0207426_1001853 3300025302 Bacteria 15526
114 Ga0209051_1012705 3300025303 Bacteria 4055
115 Ga0209051_1021441 3300025303 Bacteria 2751
116 Ga0209051_1110704 3300025303 Bacteria 717
117 Ga0209257_1036223 3300025304 Bacteria 1518
118 Ga0207656_10002888 3300025321 Bacteria 5861
119 Ga0207682_10096262 3300025893 Bacteria 1290
120 Ga0207688_10171081 3300025901 Bacteria 1292
121 Ga0207680_10095034 3300025903 Bacteria 1904
122 Ga0207647_10284304 3300025904 Bacteria 944
123 Ga0207705_10142949 3300025909 Bacteria 1788
124 Ga0207657_10361272 3300025919 Bacteria 1145
125 Ga0207657_10475829 3300025919 Bacteria 979
126 Ga0207649_10028739 3300025920 Bacteria 3276
127 Ga0207649_10074163 3300025920 Bacteria 2183
128 Ga0207644_10078738 3300025931 Bacteria 2430
129 Ga0207644_10501832 3300025931 Bacteria 1001
130 Ga0207690_10004845 3300025932 Bacteria 7941
131 Ga0207706_10363294 3300025933 Bacteria 1258
132 Ga0207706_10576106 3300025933 Bacteria 968
133 Ga0207669_10041178 3300025937 Bacteria 2686
134 Ga0207691_10874129 3300025940 Bacteria 753
135 Ga0207691_11131529 3300025940 Bacteria 651
136 Ga0207711_10292098 3300025941 Bacteria 1503
137 Ga0207667_11324450 3300025949 Bacteria 696
138 Ga0207651_10785783 3300025960 Bacteria 843
139 Ga0207668_10107210 3300025972 Bacteria 2089
140 Ga0207658_10445242 3300025986 Bacteria 1146
141 Ga0207678_10039208 3300026067 Bacteria 4112
142 Ga0207678_10278606 3300026067 Bacteria 1435
143 Ga0207708_11973764 3300026075 Bacteria 511
144 Ga0207702_10005050 3300026078 Bacteria 11590
145 Ga0207676_12107807 3300026095 Bacteria 562
146 Ga0207674_10633590 3300026116 Bacteria 1032
147 Ga0207698_10082248 3300026142 Bacteria 2602
148 Ga0209282_1010572 3300027666 Bacteria 5840
149 Ga0209813_10433957 3300027866 Bacteria 535
150 Ga0268266_10905860 3300028379 Bacteria 853
151 Ga0268266_10939727 3300028379 Bacteria 836
152 Ga0268266_11457403 3300028379 Bacteria 660
153 Ga0307515_10170591 3300028794 Bacteria 2171
154 Ga0307513_10014591 3300031456 Bacteria 9566
155 Ga0307513_10105745 3300031456 Bacteria 2823
156 Ga0307513_10401954 3300031456 Bacteria 1104
157 Ga0307408_100366195 3300031548 Bacteria 1228
158 Ga0307408_101984453 3300031548 Bacteria 559
159 Ga0307405_10844417 3300031731 Bacteria 771
160 Ga0307413_10801285 3300031824 Bacteria 792
161 Ga0307406_10016869 3300031901 Bacteria 4249
162 Ga0307412_10390011 3300031911 Bacteria 1130
163 Ga0307412_10482939 3300031911 Bacteria 1028
164 Ga0307412_11821030 3300031911 Bacteria 560
165 Ga0307414_10672823 3300032004 Bacteria 935
166 Ga0395905_0000314 3300037471 Bacteria 70335
167 Ga0395905_0012581 3300037471 Bacteria 8140
168 Ga0436363_0702761 3300039450 Bacteria 1695
169 Ga0439439_0207967 3300041406 Bacteria 571
170 Ga0439465_0026722 3300041413 Bacteria 1826
171 Ga0451787_702006 3300041441 Bacteria 897
172 Ga0451795_0967194 3300041456 Bacteria 950
173 Ga0451835_0636688 3300041492 Bacteria 625
174 Ga0451853_3709861 3300041512 Bacteria 882
175 Ga0439448_0233646 3300042005 Bacteria 647
176 Ga0439449_0194342 3300042007 Bacteria 759
177 Ga0439452_085183 3300042010 Bacteria 686
178 Ga0439458_0097753 3300042157 Bacteria 760
179 Ga0466966_0081540 3300044684 Bacteria 2014
180 Ga0466963_0032651 3300044694 Bacteria 3373
181 Ga0466971_0031285 3300044719 Bacteria 2383
182 Ga0466970_0007726 3300044765 Bacteria 5395
183 Ga0495650_0000461 3300046471 Bacteria 63382
184 Ga0495662_0182351 3300046476 Bacteria 1035
185 Ga0495584_0030697 3300046491 Bacteria 2722
186 Ga0495585_0014135 3300046492 Bacteria 4659
187 Ga0495585_0075646 3300046492 Bacteria 1830
188 Ga0495585_0321811 3300046492 Bacteria 756
189 Ga0495583_0011410 3300046506 Bacteria 5103
190 Ga0495583_0018146 3300046506 Bacteria 3712
191 Ga0495583_0254520 3300046506 Bacteria 703
192 Ga0495583_0383554 3300046506 Bacteria 553
193 Ga0495620_0281426 3300046515 Bacteria 633
194 Ga0495631_0077409 3300046518 Bacteria 1435
195 Ga0495637_0011209 3300046520 Bacteria 4314
196 Ga0495643_0296590 3300046522 Bacteria 738
197 Ga0495648_0081386 3300046524 Bacteria 1842
198 Ga0495663_0351434 3300046525 Bacteria 537
199 Ga0495597_0185254 3300046542 Bacteria 839
200 Ga0495622_0166551 3300046557 Bacteria 992
201 Ga0495633_0012047 3300046558 Bacteria 4619
202 Ga0495633_0030369 3300046558 Bacteria 2625
203 Ga0495633_0107268 3300046558 Bacteria 1295
204 Ga0495633_0361538 3300046558 Bacteria 657
205 Ga0495668_0155342 3300046616 Bacteria 1253
206 Ga0495611_0144499 3300046648 Bacteria 1110
207 Ga0495611_0556574 3300046648 Bacteria 519
208 Ga0495625_0150420 3300046660 Bacteria 1565
209 Ga0495625_0179170 3300046660 Bacteria 1410
210 Ga0495625_0297750 3300046660 Bacteria 1033
211 Ga0495661_0360245 3300046665 Bacteria 714
212 Ga0495669_0004975 3300046684 Bacteria 5524
213 Ga0495670_0346568 3300046691 Bacteria 799
214 Ga0495649_0157318 3300046694 Bacteria 1192
215 Ga0495649_0384754 3300046694 Bacteria 706
216 Ga0495600_0131262 3300046809 Bacteria 1628
217 Ga0495660_0215976 3300046810 Bacteria 907
218 Ga0495660_0254452 3300046810 Bacteria 813
219 Ga0495687_005974 3300047443 Bacteria 7589
220 Ga0495687_252532 3300047443 Bacteria 525
221 Ga0495681_0167887 3300047470 Bacteria 909
222 Ga0495681_0281493 3300047470 Bacteria 648
223 Ga0495681_0378940 3300047470 Bacteria 532
224 Ga0495686_0526293 3300047472 Bacteria 620
225 Ga0495686_0610897 3300047472 Bacteria 564
226 Ga0496101_0036288 3300048904 Bacteria 3491
227 Ga0496102_0230671 3300048905 Bacteria 1745
228 Ga0496103_0120001 3300048906 Bacteria 1674
229 Ga0496104_0021359 3300048907 Bacteria 5943
230 Ga0496105_0052097 3300048908 Bacteria 3379
231 Ga0496106_0002856 3300048909 Bacteria 12826
232 Ga0496106_0742655 3300048909 Bacteria 781
233 Ga0496108_0053952 3300048911 Bacteria 3373
234 Ga0496109_0057344 3300048912 Bacteria 3555
235 Ga0496111_0091947 3300048914 Bacteria 2224
236 Ga0496113_0107952 3300048916 Bacteria 2163
237 Ga0496114_0098727 3300048917 Bacteria 2490
238 Ga0496116_0144058 3300048919 Bacteria 1335
239 Ga0496116_0198853 3300048919 Bacteria 1051
240 Ga0496117_0444337 3300048920 Bacteria 643
241 Ga0496118_0077136 3300048921 Bacteria 2365
242 Ga0496118_0138909 3300048921 Bacteria 1545
243 Ga0496119_0117467 3300048922 Bacteria 1466
244 Ga0496121_0018866 3300048924 Bacteria 6923
245 Ga0496121_0054762 3300048924 Bacteria 3330
246 Ga0496121_0174331 3300048924 Bacteria 1559
247 Ga0496121_0687822 3300048924 Bacteria 617
248 Ga0496122_0079731 3300048925 Bacteria 2286
249 Ga0496122_0273642 3300048925 Bacteria 928
250 Ga0496123_0053073 3300048926 Bacteria 2683
251 Ga0496123_0082295 3300048926 Bacteria 1952
252 Ga0496123_0382342 3300048926 Bacteria 645
253 Ga0496124_0088801 3300048927 Bacteria 2525
254 Ga0496124_0237850 3300048927 Bacteria 1356
255 Ga0496124_0412790 3300048927 Bacteria 933
256 Ga0496125_0329701 3300048928 Bacteria 921
257 Ga0496126_0019778 3300048929 Bacteria 6624
258 Ga0496126_0030350 3300048929 Bacteria 5122
259 Ga0495682_0107037 3300049460 Bacteria 1002
260 Ga0495682_0324537 3300049460 Bacteria 543
261 Ga0501032_0037931 3300049569 Bacteria 3284
262 Ga0501033_0364323 3300049570 Bacteria 1011
263 Ga0501034_0172394 3300049571 Bacteria 2130
264 Ga0501038_0762272 3300049574 Bacteria 721
265 Ga0501043_0033643 3300049579 Bacteria 4033
266 Ga0501047_0062863 3300049581 Bacteria 3581
267 Ga0501072_0590435 3300049588 Bacteria 876
268 Ga0501073_0332719 3300049589 Bacteria 1048
269 Ga0501238_028656 3300049671 Bacteria 802
270 Ga0501080_0798066 3300049742 Bacteria 828
271 Ga0501083_0350641 3300049744 Bacteria 959
272 nmdc:mga03n38_647710_c1 3300050490 Bacteria 605
273 nmdc:mga00v17_165333_c1 3300050491 Bacteria 1425
274 nmdc:mga0yw44_135038_c1 3300050492 Bacteria 1600
275 nmdc:mga0yw44_336495_c1 3300050492 Bacteria 1015
276 nmdc:mga0yw44_74379_c1 3300050492 Bacteria 2116
277 nmdc:mga07m45_139166_c1 3300050496 Bacteria 1405
278 nmdc:mga07m45_920692_c1 3300050496 Bacteria 500
279 nmdc:mga0sz30_27452_c1 3300050516 Bacteria 1914
280 Ga0500610_0001460 3300053079 Bacteria 8066
281 Ga0500610_0022464 3300053079 Bacteria 3110
282 Ga0495655_0094234 3300053083 Bacteria 877
283 Ga0500644_0175062 3300053088 Bacteria 875
284 Ga0500583_0100689 3300053092 Bacteria 1415
285 Ga0500595_047657 3300053119 Bacteria 1341
286 Ga0500658_0021282 3300053134 Bacteria 2454
287 Ga0500561_0305567 3300053137 Bacteria 507
288 Ga0500568_0004365 3300053139 Bacteria 7570
289 Ga0500568_0079348 3300053139 Bacteria 1247
290 Ga0500604_0300509 3300053151 Bacteria 557
291 Ga0500616_0000045 3300053153 Bacteria 339292
292 Ga0500616_0212518 3300053153 Bacteria 849
293 Ga0500619_113975 3300053154 Bacteria 921
294 Ga0500633_0009381 3300053160 Bacteria 2571
295 Ga0500638_193604 3300053162 Bacteria 866
296 Ga0500636_0057957 3300053177 Bacteria 2265
297 Ga0500636_0149965 3300053177 Bacteria 1281
298 Ga0500645_000138 3300053730 Bacteria 57099
299 Ga0501084_1858974 3300054114 Bacteria 503
300 Ga0501082_0103543 3300060353 Bacteria 2462

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041406 Ga0439439_0207967 Ga0439439_0207967_37_246 69
2 3300042010 Ga0439452_085183 Ga0439452_085183_440_649 69
3 3300006038 Ga0075365_10204870 Ga0075365_102048702 75
4 3300031456 Ga0307513_10014591 Ga0307513_100145918 75
5 3300050492 nmdc:mga0yw44_336495_c1 nmdc:mga0yw44_336495_c1_752_979 75
6 3300005339 Ga0070660_100601769 Ga0070660_1006017693 76
7 3300025909 Ga0207705_10142949 Ga0207705_101429494 76
8 3300025919 Ga0207657_10475829 Ga0207657_104758292 76
9 3300046558 Ga0495633_0361538 Ga0495633_0361538_302_556 77
10 3300047470 Ga0495681_0167887 Ga0495681_0167887_217_471 77
11 3300049588 Ga0501072_0590435 Ga0501072_0590435_555_791 78
12 iso_pu_bacteria 2510917030 2511195278 79
13 iso_pu_bacteria 2615840624 2616296619 79
14 iso_pu_bacteria 2718217997 2719666608 79
15 iso_pu_bacteria 2718218199 2720493028 79
16 iso_pu_bacteria 2791355256 2793293981 79
17 iso_pu_bacteria 2791355261 2793329736 79
18 iso_pu_bacteria 2791355262 2793335076 79
19 iso_pu_bacteria 2791355265 2793355355 79
20 iso_pu_bacteria 2791355267 2793369914 79
21 iso_pu_bacteria 2802429605 2805929571 79
22 iso_pu_bacteria 2802429606 2805936876 79
23 iso_pu_bacteria 2838668709 2838671804 79
24 iso_pu_bacteria 2838701080 2838704483 79
25 iso_pu_bacteria 2842146304 2842149701 79
26 iso_pu_bacteria 2842192696 2842195596 79
27 iso_pu_bacteria 2842205361 2842210916 79
28 iso_pu_bacteria 2842250916 2842254132 79
29 iso_pu_bacteria 2842278818 2842284369 79
30 iso_pu_bacteria 2842285085 2842285156 79
31 iso_pu_bacteria 2842317721 2842319999 79
32 iso_pu_bacteria 2842402390 2842402514 79
33 iso_pu_bacteria 2842409023 2842410115 79
34 iso_pu_bacteria 2842415677 2842416763 79
35 iso_pu_bacteria 2842489311 2842493460 79
36 iso_pu_bacteria 2842495871 2842497611 79
37 iso_pu_bacteria 2854896431 2854900502 79
38 iso_pu_bacteria 2854916844 2854917451 79
39 iso_pu_bacteria 2919171160 2919173125 79
40 iso_pu_bacteria 3005445848 3005448868 79
41 iso_pu_bacteria 8005289223 8005289609 79
42 iso_pu_bacteria 8018127388 8018127605 79
43 iso_pu_bacteria 8024501048 8024501155 79
44 iso_pu_bacteria 8056375014 8056377049 79
45 iso_pu_bacteria 8056382006 8056387373 79
46 3300005339 Ga0070660_100650327 Ga0070660_1006503272 80
47 3300005366 Ga0070659_100005136 Ga0070659_1000051365 80
48 3300025919 Ga0207657_10361272 Ga0207657_103612721 80
49 3300025932 Ga0207690_10004845 Ga0207690_100048455 80
50 iso_pu_bacteria 2508501127 2509140904 80
51 iso_pu_bacteria 2510917028 2511182686 80
52 iso_pu_bacteria 2513237088 2513598372 80
53 iso_pu_bacteria 2513237138 2513867869 80
54 iso_pu_bacteria 2513237305 2514417727 80
55 iso_pu_bacteria 2534681796 2535517270 80
56 iso_pu_bacteria 2582581294 2585205069 80
57 iso_pu_bacteria 2617270742 2617386324 80
58 iso_pu_bacteria 2643221599 2644002947 80
59 iso_pu_bacteria 2643221634 2644196697 80
60 iso_pu_bacteria 2643221643 2644237928 80
61 iso_pu_bacteria 2721755686 2723573002 80
62 iso_pu_bacteria 2775507266 2778173411 80
63 iso_pu_bacteria 2818991272 2819240953 80
64 iso_pu_bacteria 2818991448 2819609898 80
65 iso_pu_bacteria 2838661181 2838665819 80
66 iso_pu_bacteria 2842482326 2842483679 80
67 iso_pu_bacteria 2847670302 2847673321 80
68 iso_pu_bacteria 2856314179 2856319210 80
69 iso_pu_bacteria 2871481445 2871486899 80
70 iso_pu_bacteria 2878035449 2878039599 80
71 iso_pu_bacteria 2906414383 2906419282 80
72 iso_pu_bacteria 2968110612 2968114674 80
73 iso_pu_bacteria 2989771324 2989772363 80
74 iso_pu_bacteria 3000135777 3000137250 80
75 iso_pu_bacteria 3003930520 3003934687 80
76 iso_pu_bacteria 3005416602 3005418785 80
77 iso_pu_bacteria 3005452660 3005455085 80
78 iso_pu_bacteria 8005314921 8005318323 80
79 iso_pu_bacteria 8005542996 8005546091 80
80 iso_pu_bacteria 8005645114 8005645827 80
81 iso_pu_bacteria 8005682033 8005682491 80
82 3300003215 JGI25153J46596_10000002 JGI25153J46596_1000000281 81
83 3300005333 Ga0070677_10052605 Ga0070677_100526052 81
84 3300005344 Ga0070661_100388288 Ga0070661_1003882882 81
85 3300005344 Ga0070661_100392125 Ga0070661_1003921252 81
86 3300005356 Ga0070674_100031936 Ga0070674_1000319365 81
87 3300005364 Ga0070673_101052699 Ga0070673_1010526991 81
88 3300005367 Ga0070667_100540302 Ga0070667_1005403021 81
89 3300005457 Ga0070662_100436792 Ga0070662_1004367922 81
90 3300005548 Ga0070665_100357814 Ga0070665_1003578142 81
91 3300005563 Ga0068855_101885732 Ga0068855_1018857322 81
92 3300005564 Ga0070664_102074446 Ga0070664_1020744462 81
93 3300005614 Ga0068856_100537155 Ga0068856_1005371552 81
94 3300005616 Ga0068852_100721998 Ga0068852_1007219982 81
95 3300006038 Ga0075365_10340828 Ga0075365_103408283 81
96 3300006051 Ga0075364_10660775 Ga0075364_106607752 81
97 3300006177 Ga0075362_10060097 Ga0075362_100600972 81
98 3300006195 Ga0075366_10120517 Ga0075366_101205172 81
99 3300006353 Ga0075370_10188697 Ga0075370_101886972 81
100 3300009174 Ga0105241_10156312 Ga0105241_101563121 81
101 3300009545 Ga0105237_10587519 Ga0105237_105875192 81
102 3300013100 Ga0157373_10213200 Ga0157373_102132002 81
103 3300013104 Ga0157370_10724864 Ga0157370_107248642 81
104 3300013105 Ga0157369_10289303 Ga0157369_102893032 81
105 3300013307 Ga0157372_12818527 Ga0157372_128185272 81
106 3300025297 Ga0209758_1000001 Ga0209758_1000001880 81
107 3300025321 Ga0207656_10002888 Ga0207656_100028882 81
108 3300025893 Ga0207682_10096262 Ga0207682_100962623 81
109 3300025901 Ga0207688_10171081 Ga0207688_101710812 81
110 3300025920 Ga0207649_10028739 Ga0207649_100287394 81
111 3300025920 Ga0207649_10074163 Ga0207649_100741634 81
112 3300025931 Ga0207644_10501832 Ga0207644_105018321 81
113 3300025933 Ga0207706_10576106 Ga0207706_105761062 81
114 3300025937 Ga0207669_10041178 Ga0207669_100411784 81
115 3300025940 Ga0207691_10874129 Ga0207691_108741291 81
116 3300025949 Ga0207667_11324450 Ga0207667_113244502 81
117 3300025960 Ga0207651_10785783 Ga0207651_107857832 81
118 3300026078 Ga0207702_10005050 Ga0207702_1000505011 81
119 3300026116 Ga0207674_10633590 Ga0207674_106335902 81
120 3300026142 Ga0207698_10082248 Ga0207698_100822482 81
121 3300028379 Ga0268266_10939727 Ga0268266_109397272 81
122 3300031548 Ga0307408_101984453 Ga0307408_1019844531 81
123 3300031911 Ga0307412_10390011 Ga0307412_103900113 81
124 3300031911 Ga0307412_10482939 Ga0307412_104829392 81
125 3300041441 Ga0451787_702006 Ga0451787_702006_28_273 81
126 3300041456 Ga0451795_0967194 Ga0451795_0967194_73_318 81
127 3300041492 Ga0451835_0636688 Ga0451835_0636688_161_406 81
128 3300041512 Ga0451853_3709861 Ga0451853_3709861_179_424 81
129 3300042005 Ga0439448_0233646 Ga0439448_0233646_267_512 81
130 3300042157 Ga0439458_0097753 Ga0439458_0097753_229_474 81
131 3300046471 Ga0495650_0000461 Ga0495650_0000461_11134_11379 81
132 3300046476 Ga0495662_0182351 Ga0495662_0182351_344_589 81
133 3300046491 Ga0495584_0030697 Ga0495584_0030697_799_1044 81
134 3300046492 Ga0495585_0014135 Ga0495585_0014135_618_863 81
135 3300046492 Ga0495585_0321811 Ga0495585_0321811_209_454 81
136 3300046506 Ga0495583_0011410 Ga0495583_0011410_638_883 81
137 3300046506 Ga0495583_0018146 Ga0495583_0018146_2354_2599 81
138 3300046506 Ga0495583_0254520 Ga0495583_0254520_330_575 81
139 3300046506 Ga0495583_0383554 Ga0495583_0383554_169_414 81
140 3300046515 Ga0495620_0281426 Ga0495620_0281426_298_543 81
141 3300046518 Ga0495631_0077409 Ga0495631_0077409_518_763 81
142 3300046520 Ga0495637_0011209 Ga0495637_0011209_3707_3952 81
143 3300046522 Ga0495643_0296590 Ga0495643_0296590_203_448 81
144 3300046524 Ga0495648_0081386 Ga0495648_0081386_1484_1729 81
145 3300046525 Ga0495663_0351434 Ga0495663_0351434_260_505 81
146 3300046542 Ga0495597_0185254 Ga0495597_0185254_268_513 81
147 3300046557 Ga0495622_0166551 Ga0495622_0166551_299_544 81
148 3300046558 Ga0495633_0012047 Ga0495633_0012047_80_325 81
149 3300046558 Ga0495633_0107268 Ga0495633_0107268_382_627 81
150 3300046616 Ga0495668_0155342 Ga0495668_0155342_612_857 81
151 3300046648 Ga0495611_0144499 Ga0495611_0144499_648_893 81
152 3300046648 Ga0495611_0556574 Ga0495611_0556574_95_340 81
153 3300046660 Ga0495625_0150420 Ga0495625_0150420_527_772 81
154 3300046660 Ga0495625_0179170 Ga0495625_0179170_359_604 81
155 3300046660 Ga0495625_0297750 Ga0495625_0297750_68_313 81
156 3300046684 Ga0495669_0004975 Ga0495669_0004975_4585_4830 81
157 3300046691 Ga0495670_0346568 Ga0495670_0346568_39_284 81
158 3300046694 Ga0495649_0157318 Ga0495649_0157318_777_1022 81
159 3300046694 Ga0495649_0384754 Ga0495649_0384754_324_569 81
160 3300046809 Ga0495600_0131262 Ga0495600_0131262_904_1149 81
161 3300046810 Ga0495660_0215976 Ga0495660_0215976_583_828 81
162 3300046810 Ga0495660_0254452 Ga0495660_0254452_310_555 81
163 3300047443 Ga0495687_005974 Ga0495687_005974_4521_4766 81
164 3300047443 Ga0495687_252532 Ga0495687_252532_145_390 81
165 3300047470 Ga0495681_0281493 Ga0495681_0281493_168_413 81
166 3300047472 Ga0495686_0526293 Ga0495686_0526293_116_361 81
167 3300047472 Ga0495686_0610897 Ga0495686_0610897_182_427 81
168 3300049460 Ga0495682_0107037 Ga0495682_0107037_527_772 81
169 3300049460 Ga0495682_0324537 Ga0495682_0324537_194_439 81
170 3300049570 Ga0501033_0364323 Ga0501033_0364323_281_526 81
171 3300050491 nmdc:mga00v17_165333_c1 nmdc:mga00v17_165333_c1_180_425 81
172 3300050492 nmdc:mga0yw44_135038_c1 nmdc:mga0yw44_135038_c1_1189_1434 81
173 3300050496 nmdc:mga07m45_139166_c1 nmdc:mga07m45_139166_c1_818_1063 81
174 3300053079 Ga0500610_0001460 Ga0500610_0001460_5084_5329 81
175 3300053079 Ga0500610_0022464 Ga0500610_0022464_1951_2196 81
176 3300053083 Ga0495655_0094234 Ga0495655_0094234_201_446 81
177 3300053092 Ga0500583_0100689 Ga0500583_0100689_1079_1324 81
178 3300053119 Ga0500595_047657 Ga0500595_047657_394_639 81
179 3300053151 Ga0500604_0300509 Ga0500604_0300509_162_407 81
180 3300053154 Ga0500619_113975 Ga0500619_113975_331_576 81
181 3300053177 Ga0500636_0149965 Ga0500636_0149965_357_602 81
182 3300053730 Ga0500645_000138 Ga0500645_000138_4364_4609 81
183 iso_pu_bacteria 2510461069 2510839310 81
184 iso_pu_bacteria 2537561587 2537873907 81
185 iso_pu_bacteria 2554235003 2554248546 81
186 iso_pu_bacteria 2558860242 2559295634 81
187 iso_pu_bacteria 2600255279 2601609787 81
188 iso_pu_bacteria 2600255308 2601746562 81
189 iso_pu_bacteria 2643221693 2644523399 81
190 iso_pu_bacteria 2808606387 2808987633 81
191 iso_pu_bacteria 2899845264 2899847267 81
192 iso_pu_bacteria 2933594066 2933596297 81
193 iso_pu_bacteria 650716007 650740844 81
194 iso_pu_bacteria 8003570095 8003571918 81
195 3300002773 JGI25152J39213_1001439 JGI25152J39213_10014396 83
196 3300002773 JGI25152J39213_1002125 JGI25152J39213_10021256 83
197 3300002774 JGI25150J39212_1004426 JGI25150J39212_10044264 83
198 3300002774 JGI25150J39212_1018082 JGI25150J39212_10180823 83
199 3300002987 JGI25159J45721_1001753 JGI25159J45721_10017539 83
200 3300003215 JGI25153J46596_10004225 JGI25153J46596_100042256 83
201 3300003215 JGI25153J46596_10004765 JGI25153J46596_100047653 83
202 3300003354 JGI25160J50197_1005146 JGI25160J50197_10051465 83
203 3300003374 JGI25161J50226_1000490 JGI25161J50226_100049016 83
204 3300003771 Ga0055526_1001847 Ga0055526_100184715 83
205 3300003771 Ga0055526_1005836 Ga0055526_10058367 83
206 3300003775 Ga0055524_1007195 Ga0055524_10071955 83
207 3300003775 Ga0055524_1062053 Ga0055524_10620532 83
208 3300003790 Ga0055528_1004885 Ga0055528_10048857 83
209 3300003792 Ga0055540_1009938 Ga0055540_10099385 83
210 3300004625 Ga0055543_1000220 Ga0055543_100022012 83
211 3300005262 Ga0065165_1006866 Ga0065165_10068666 83
212 3300005455 Ga0070663_100488380 Ga0070663_1004883802 83
213 3300005983 Ga0081540_1332453 Ga0081540_13324532 83
214 3300009148 Ga0105243_11706099 Ga0105243_117060991 83
215 3300025208 Ga0209436_100272 Ga0209436_1002727 83
216 3300025245 Ga0207425_1000495 Ga0207425_100049516 83
217 3300025245 Ga0207425_1087272 Ga0207425_10872722 83
218 3300025258 Ga0209129_1000810 Ga0209129_10008108 83
219 3300025258 Ga0209129_1002064 Ga0209129_10020648 83
220 3300025273 Ga0209673_1007952 Ga0209673_10079522 83
221 3300025273 Ga0209673_1030779 Ga0209673_10307792 83
222 3300025284 Ga0209130_1000023 Ga0209130_1000023167 83
223 3300025294 Ga0209025_1044879 Ga0209025_10448792 83
224 3300025295 Ga0209564_1002794 Ga0209564_100279412 83
225 3300025297 Ga0209758_1000666 Ga0209758_100066615 83
226 3300025297 Ga0209758_1001689 Ga0209758_100168918 83
227 3300025297 Ga0209758_1082968 Ga0209758_10829682 83
228 3300025299 Ga0209256_1003508 Ga0209256_10035089 83
229 3300025302 Ga0207426_1000087 Ga0207426_1000087195 83
230 3300025303 Ga0209051_1012705 Ga0209051_10127053 83
231 3300025304 Ga0209257_1036223 Ga0209257_10362232 83
232 3300026067 Ga0207678_10278606 Ga0207678_102786063 83
233 3300027866 Ga0209813_10433957 Ga0209813_104339572 83
234 3300028379 Ga0268266_10905860 Ga0268266_109058603 83
235 3300028379 Ga0268266_11457403 Ga0268266_114574032 83
236 3300031911 Ga0307412_11821030 Ga0307412_118210302 83
237 3300041413 Ga0439465_0026722 Ga0439465_0026722_1459_1710 83
238 3300042007 Ga0439449_0194342 Ga0439449_0194342_312_563 83
239 3300048909 Ga0496106_0002856 Ga0496106_0002856_10048_10299 83
240 3300048924 Ga0496121_0054762 Ga0496121_0054762_1131_1382 83
241 3300048924 Ga0496121_0174331 Ga0496121_0174331_410_661 83
242 3300048927 Ga0496124_0412790 Ga0496124_0412790_617_868 83
243 3300049569 Ga0501032_0037931 Ga0501032_0037931_1320_1571 83
244 3300049574 Ga0501038_0762272 Ga0501038_0762272_247_498 83
245 3300049579 Ga0501043_0033643 Ga0501043_0033643_2154_2405 83
246 3300049581 Ga0501047_0062863 Ga0501047_0062863_1631_1882 83
247 3300049589 Ga0501073_0332719 Ga0501073_0332719_576_827 83
248 3300049671 Ga0501238_028656 Ga0501238_028656_131_382 83
249 3300049742 Ga0501080_0798066 Ga0501080_0798066_78_329 83
250 3300049744 Ga0501083_0350641 Ga0501083_0350641_169_420 83
251 3300053088 Ga0500644_0175062 Ga0500644_0175062_152_403 83
252 3300053134 Ga0500658_0021282 Ga0500658_0021282_184_435 83
253 3300053139 Ga0500568_0079348 Ga0500568_0079348_612_863 83
254 3300053153 Ga0500616_0000045 Ga0500616_0000045_260338_260589 83
255 3300053160 Ga0500633_0009381 Ga0500633_0009381_799_1050 83
256 3300054114 Ga0501084_1858974 Ga0501084_1858974_166_417 83
257 3300060353 Ga0501082_0103543 Ga0501082_0103543_79_330 83
258 3300001989 JGI24739J22299_10141971 JGI24739J22299_101419711 84
259 3300002737 JGI25162J39368_1000149 JGI25162J39368_10001499 84
260 3300002773 JGI25152J39213_1004677 JGI25152J39213_10046776 84
261 3300003214 JGI25165J46597_1001553 JGI25165J46597_10015539 84
262 3300003316 rootH1_10130903 rootH1_101309034 84
263 3300003320 rootH2_10147178 rootH2_101471782 84
264 3300003322 rootL2_10082099 rootL2_100820993 84
265 3300003354 JGI25160J50197_1012339 JGI25160J50197_10123391 84
266 3300003771 Ga0055526_1050427 Ga0055526_10504273 84
267 3300003771 Ga0055526_1077173 Ga0055526_10771731 84
268 3300003775 Ga0055524_1027990 Ga0055524_10279902 84
269 3300003790 Ga0055528_1015412 Ga0055528_10154123 84
270 3300003792 Ga0055540_1029373 Ga0055540_10293733 84
271 3300003792 Ga0055540_1041541 Ga0055540_10415412 84
272 3300005335 Ga0070666_10068054 Ga0070666_100680543 84
273 3300005340 Ga0070689_101796185 Ga0070689_1017961851 84
274 3300005347 Ga0070668_100085999 Ga0070668_1000859994 84
275 3300005355 Ga0070671_100044977 Ga0070671_1000449775 84
276 3300005367 Ga0070667_100413448 Ga0070667_1004134482 84
277 3300005455 Ga0070663_100426191 Ga0070663_1004261912 84
278 3300005457 Ga0070662_100338558 Ga0070662_1003385583 84
279 3300005618 Ga0068864_102552652 Ga0068864_1025526521 84
280 3300005844 Ga0068862_100776757 Ga0068862_1007767572 84
281 3300006038 Ga0075365_10057051 Ga0075365_100570515 84
282 3300006048 Ga0075363_100052024 Ga0075363_1000520244 84
283 3300006048 Ga0075363_100080225 Ga0075363_1000802255 84
284 3300006186 Ga0075369_10001801 Ga0075369_100018014 84
285 3300006195 Ga0075366_10467138 Ga0075366_104671382 84
286 3300006948 Ga0099826_10000404 Ga0099826_1000040414 84
287 3300009177 Ga0105248_10276238 Ga0105248_102762382 84
288 3300009766 Ga0123342_1017418 Ga0123342_10174187 84
289 3300013102 Ga0157371_10000165 Ga0157371_1000016558 84
290 3300014325 Ga0163163_11592575 Ga0163163_115925752 84
291 3300021377 Ga0213874_10130436 Ga0213874_101304362 84
292 3300025228 Ga0209672_105709 Ga0209672_1057093 84
293 3300025233 Ga0209437_100058 Ga0209437_100058132 84
294 3300025245 Ga0207425_1067682 Ga0207425_10676822 84
295 3300025246 Ga0209646_1008472 Ga0209646_10084724 84
296 3300025258 Ga0209129_1006087 Ga0209129_10060873 84
297 3300025261 Ga0209233_1000149 Ga0209233_100014952 84
298 3300025273 Ga0209673_1004170 Ga0209673_10041708 84
299 3300025284 Ga0209130_1021240 Ga0209130_10212404 84
300 3300025284 Ga0209130_1046625 Ga0209130_10466252 84
301 3300025292 Ga0209676_1118043 Ga0209676_11180432 84
302 3300025294 Ga0209025_1004713 Ga0209025_100471312 84
303 3300025295 Ga0209564_1008336 Ga0209564_10083362 84
304 3300025299 Ga0209256_1004538 Ga0209256_10045382 84
305 3300025299 Ga0209256_1060973 Ga0209256_10609732 84
306 3300025302 Ga0207426_1001853 Ga0207426_10018535 84
307 3300025303 Ga0209051_1021441 Ga0209051_10214413 84
308 3300025303 Ga0209051_1110704 Ga0209051_11107041 84
309 3300025903 Ga0207680_10095034 Ga0207680_100950343 84
310 3300025904 Ga0207647_10284304 Ga0207647_102843041 84
311 3300025931 Ga0207644_10078738 Ga0207644_100787384 84
312 3300025933 Ga0207706_10363294 Ga0207706_103632942 84
313 3300025940 Ga0207691_11131529 Ga0207691_111315291 84
314 3300025941 Ga0207711_10292098 Ga0207711_102920983 84
315 3300025972 Ga0207668_10107210 Ga0207668_101072103 84
316 3300025986 Ga0207658_10445242 Ga0207658_104452422 84
317 3300026067 Ga0207678_10039208 Ga0207678_100392085 84
318 3300026075 Ga0207708_11973764 Ga0207708_119737641 84
319 3300026095 Ga0207676_12107807 Ga0207676_121078072 84
320 3300027666 Ga0209282_1010572 Ga0209282_10105727 84
321 3300028794 Ga0307515_10170591 Ga0307515_101705913 84
322 3300031456 Ga0307513_10105745 Ga0307513_101057453 84
323 3300031456 Ga0307513_10401954 Ga0307513_104019542 84
324 3300031548 Ga0307408_100366195 Ga0307408_1003661952 84
325 3300031731 Ga0307405_10844417 Ga0307405_108444172 84
326 3300031824 Ga0307413_10801285 Ga0307413_108012851 84
327 3300031901 Ga0307406_10016869 Ga0307406_100168696 84
328 3300032004 Ga0307414_10672823 Ga0307414_106728232 84
329 3300037471 Ga0395905_0000314 Ga0395905_0000314_18233_18487 84
330 3300037471 Ga0395905_0012581 Ga0395905_0012581_3455_3709 84
331 3300039450 Ga0436363_0702761 Ga0436363_0702761_762_1019 84
332 3300044684 Ga0466966_0081540 Ga0466966_0081540_369_623 84
333 3300044694 Ga0466963_0032651 Ga0466963_0032651_1487_1741 84
334 3300044719 Ga0466971_0031285 Ga0466971_0031285_1195_1449 84
335 3300044765 Ga0466970_0007726 Ga0466970_0007726_2313_2567 84
336 3300046492 Ga0495585_0075646 Ga0495585_0075646_740_994 84
337 3300046558 Ga0495633_0030369 Ga0495633_0030369_907_1164 84
338 3300046665 Ga0495661_0360245 Ga0495661_0360245_423_677 84
339 3300047470 Ga0495681_0378940 Ga0495681_0378940_63_317 84
340 3300048904 Ga0496101_0036288 Ga0496101_0036288_1778_2032 84
341 3300048905 Ga0496102_0230671 Ga0496102_0230671_316_570 84
342 3300048906 Ga0496103_0120001 Ga0496103_0120001_1379_1633 84
343 3300048907 Ga0496104_0021359 Ga0496104_0021359_3942_4196 84
344 3300048908 Ga0496105_0052097 Ga0496105_0052097_1559_1813 84
345 3300048909 Ga0496106_0742655 Ga0496106_0742655_244_498 84
346 3300048911 Ga0496108_0053952 Ga0496108_0053952_1425_1679 84
347 3300048912 Ga0496109_0057344 Ga0496109_0057344_1371_1625 84
348 3300048914 Ga0496111_0091947 Ga0496111_0091947_39_293 84
349 3300048916 Ga0496113_0107952 Ga0496113_0107952_505_759 84
350 3300048917 Ga0496114_0098727 Ga0496114_0098727_710_964 84
351 3300048919 Ga0496116_0144058 Ga0496116_0144058_1045_1302 84
352 3300048919 Ga0496116_0198853 Ga0496116_0198853_533_787 84
353 3300048920 Ga0496117_0444337 Ga0496117_0444337_86_343 84
354 3300048921 Ga0496118_0077136 Ga0496118_0077136_594_851 84
355 3300048921 Ga0496118_0138909 Ga0496118_0138909_956_1210 84
356 3300048922 Ga0496119_0117467 Ga0496119_0117467_920_1174 84
357 3300048924 Ga0496121_0018866 Ga0496121_0018866_494_748 84
358 3300048924 Ga0496121_0687822 Ga0496121_0687822_28_282 84
359 3300048925 Ga0496122_0079731 Ga0496122_0079731_454_708 84
360 3300048925 Ga0496122_0273642 Ga0496122_0273642_498_752 84
361 3300048926 Ga0496123_0053073 Ga0496123_0053073_1508_1762 84
362 3300048926 Ga0496123_0082295 Ga0496123_0082295_360_614 84
363 3300048926 Ga0496123_0382342 Ga0496123_0382342_150_404 84
364 3300048927 Ga0496124_0088801 Ga0496124_0088801_1926_2180 84
365 3300048927 Ga0496124_0237850 Ga0496124_0237850_1032_1286 84
366 3300048928 Ga0496125_0329701 Ga0496125_0329701_581_838 84
367 3300048929 Ga0496126_0019778 Ga0496126_0019778_2381_2635 84
368 3300048929 Ga0496126_0030350 Ga0496126_0030350_2943_3197 84
369 3300049571 Ga0501034_0172394 Ga0501034_0172394_365_619 84
370 3300050490 nmdc:mga03n38_647710_c1 nmdc:mga03n38_647710_c1_73_327 84
371 3300050492 nmdc:mga0yw44_74379_c1 nmdc:mga0yw44_74379_c1_165_419 84
372 3300050496 nmdc:mga07m45_920692_c1 nmdc:mga07m45_920692_c1_128_382 84
373 3300050516 nmdc:mga0sz30_27452_c1 nmdc:mga0sz30_27452_c1_342_596 84
374 3300053137 Ga0500561_0305567 Ga0500561_0305567_11_265 84
375 3300053139 Ga0500568_0004365 Ga0500568_0004365_40_351 84
376 3300053153 Ga0500616_0212518 Ga0500616_0212518_398_652 84
377 3300053162 Ga0500638_193604 Ga0500638_193604_428_682 84
378 3300053177 Ga0500636_0057957 Ga0500636_0057957_665_919 84

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06906

DUF1272

Protein of unknown function (DUF1272)

1

51

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
5g3y-assembly1.cif.gz_A crystal structure of adenylate kinase ancestor 1 with zn and adp bound 0.7784 20 54
4qbh-assembly2.cif.gz_B crystal structure of a stable adenylate kinase variant aklse5 0.7573 20 54
4qbi-assembly2.cif.gz_B crystal structure of a stable adenylate kinase variant aklse6 0.7546 21 54
3fb4-assembly1.cif.gz_A crystal structure of adenylate kinase from marinibacillus marinus 0.7285 21 54
1s3g-assembly1.cif.gz_A crystal structure of adenylate kinase from bacillus globisporus 0.7264 20 54
ID Description Score Start End Superfamily
af_Q53700_9_242_3.40.50.1220 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;TPP-binding domain 0.7834 19 53 3.40.50.1220
af_Q9W4W4_193_250_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.7125 19 57 3.30.40.10
2lcqA02 Mainly Beta;Single Sheet;Rubrerythrin, domain 2; 0.7007 22 58 2.20.28.10
3tlxA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.6867 20 54 3.40.50.300
af_Q4D4A2_1_210_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.6826 20 55 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A7Y6JZ50-F1-model_v4 DUF1272 domain-containing protein 0.8409 15 68
AF-A0A3A4UEB5-F1-model_v4 Adenylate kinase (EC 2.7.4.3) 0.8066 20 54 GO:0004017
GO:0005524
GO:0005737
AF-A0A800AZ91-F1-model_v4 DUF1272 domain-containing protein 0.8026 1 62
AF-A0A536YXV2-F1-model_v4 DUF1272 domain-containing protein 0.8007 1 59
AF-A0A316G1Y2-F1-model_v4 Urease 0.7998 14 73

Feature Viewer

pLDDT pTM Quality
79.95 0.62 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map