F428023

General Info

Members Datasets Scaffolds Average Seq Length
378 202 756 123

Family's Representative Sequence

Representative Sequence 3300013307|Ga0157372_10395006|Ga0157372_103950062
Length 132
Sequence VILGPLYTAGMEQEFVALGHAGSDAYAGLETFPNPGVERVEMVSDELTAMCPITSQPDFYVTTIAYEPDALCLESKSLKIYLSRFRDQGVFCEALAVQIRDEVAAALALDAARVHVTLRQKARGGITITASV

Samples

Sample ID Description Type Environment
1 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
26 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
27 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
28 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
29 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
30 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
31 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
32 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
33 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
34 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
35 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
36 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
37 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
38 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
39 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
40 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
41 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
42 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
43 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
44 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
45 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
46 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
47 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
48 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
49 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
50 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
72 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
73 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
74 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
75 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
76 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
77 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
78 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
79 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
80 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
81 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
82 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
83 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
84 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
85 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
86 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
87 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
88 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
89 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
90 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
91 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
92 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
93 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
94 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
95 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
96 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
97 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
98 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
99 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
100 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
101 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
102 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
103 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
104 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
105 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
106 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
107 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
108 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
109 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
110 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
111 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
112 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
113 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
114 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
115 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
116 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
117 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
118 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
119 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
120 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
121 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
122 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
123 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
124 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
125 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
126 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
127 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
128 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
129 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
130 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
131 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
132 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
133 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
134 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
135 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
136 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
137 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
138 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
139 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
140 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
141 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
142 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
143 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
144 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
145 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
146 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
147 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
148 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
149 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
150 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
151 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
152 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
153 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
154 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
155 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
156 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
157 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
158 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
159 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
160 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
161 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
162 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
163 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
164 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
165 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
166 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
167 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
179 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
180 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
181 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
182 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
183 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
184 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
185 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
186 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
187 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
188 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
189 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
190 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
191 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
192 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
194 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
195 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
196 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
197 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
198 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
199 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
200 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
201 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
202 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.03
Metatranscriptomes 3.97
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 11.38
Rhizosphere 87.83
Stem 0
Stem Tuber 0
Unclassified 22.75

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157372_10395006 3300013307 Bacteria 1612
2 Ga0070658_10834690 3300005327 Unclassified 801
3 Ga0070683_100003255 3300005329 Bacteria 13122
4 Ga0070683_101796335 3300005329 Bacteria 589
5 Ga0070680_100024996 3300005336 Bacteria 4774
6 Ga0070682_100436860 3300005337 Bacteria 999
7 Ga0068868_101168946 3300005338 Unclassified 710
8 Ga0070691_10214988 3300005341 Bacteria 1016
9 Ga0070661_100042538 3300005344 Bacteria 3316
10 Ga0070661_100140657 3300005344 Bacteria 1819
11 Ga0070671_100778317 3300005355 Unclassified 832
12 Ga0070659_100089304 3300005366 Bacteria 2468
13 Ga0070667_100009650 3300005367 Bacteria 8007
14 Ga0070714_100560837 3300005435 Bacteria 1094
15 Ga0070714_101092495 3300005435 Unclassified 777
16 Ga0070714_101800108 3300005435 Bacteria 598
17 Ga0070714_102052245 3300005435 Bacteria 557
18 Ga0070713_100423907 3300005436 Unclassified 1246
19 Ga0070710_10307124 3300005437 Unclassified 1037
20 Ga0070710_10693133 3300005437 Bacteria 718
21 Ga0070711_100238837 3300005439 Unclassified 1420
22 Ga0070711_100316169 3300005439 Unclassified 1246
23 Ga0070708_101185140 3300005445 Unclassified 715
24 Ga0070681_10061707 3300005458 Bacteria 3722
25 Ga0070681_10071390 3300005458 Bacteria 3437
26 Ga0070681_10163233 3300005458 Unclassified 2151
27 Ga0070681_10728469 3300005458 Bacteria 908
28 Ga0070707_100718754 3300005468 Bacteria 962
29 Ga0070679_100016954 3300005530 Bacteria 7040
30 Ga0070679_100036435 3300005530 Bacteria 4881
31 Ga0070684_100002494 3300005535 Bacteria 13557
32 Ga0070684_100147964 3300005535 Bacteria 2127
33 Ga0068853_100361764 3300005539 Bacteria 1352
34 Ga0070665_100175968 3300005548 Bacteria 2141
35 Ga0070665_101294842 3300005548 Unclassified 739
36 Ga0068855_100043796 3300005563 Bacteria 5299
37 Ga0068855_100120010 3300005563 Unclassified 3010
38 Ga0068855_100151954 3300005563 Bacteria 2632
39 Ga0068855_100314283 3300005563 Bacteria 1733
40 Ga0068856_100037938 3300005614 Unclassified 4728
41 Ga0068856_101054335 3300005614 Bacteria 831
42 Ga0068852_100447104 3300005616 Unclassified 1279
43 Ga0068852_100577429 3300005616 Unclassified 1127
44 Ga0070717_10226133 3300006028 Unclassified 1646
45 Ga0070717_10365626 3300006028 Bacteria 1292
46 Ga0097621_100280386 3300006237 Bacteria 1467
47 Ga0097621_100790429 3300006237 Unclassified 879
48 Ga0105240_10150660 3300009093 Bacteria 2771
49 Ga0105240_10521961 3300009093 Bacteria 1318
50 Ga0105240_10875686 3300009093 Bacteria 968
51 Ga0105240_10992708 3300009093 Bacteria 898
52 Ga0105245_10687181 3300009098 Bacteria 1056
53 Ga0105245_10720988 3300009098 Unclassified 1031
54 Ga0105243_10120908 3300009148 Bacteria 2207
55 Ga0105241_10255580 3300009174 Bacteria 1487
56 Ga0105241_10324261 3300009174 Bacteria 1329
57 Ga0105241_11279260 3300009174 Bacteria 698
58 Ga0105242_10310302 3300009176 Bacteria 1443
59 Ga0105238_10084021 3300009551 Unclassified 3173
60 Ga0105239_10194963 3300010375 Bacteria 2268
61 Ga0105239_11792602 3300010375 Bacteria 711
62 Ga0105246_10627766 3300011119 Bacteria 932
63 Ga0157370_10073115 3300013104 Bacteria 3234
64 Ga0157370_10414796 3300013104 Unclassified 1239
65 Ga0157370_10583529 3300013104 Bacteria 1024
66 Ga0157369_10001856 3300013105 Bacteria 25507
67 Ga0157369_10018598 3300013105 Bacteria 7789
68 Ga0157369_10023520 3300013105 Bacteria 6863
69 Ga0157369_10024980 3300013105 Bacteria 6637
70 Ga0157369_10436544 3300013105 Bacteria 1357
71 Ga0157369_11199028 3300013105 Bacteria 775
72 Ga0157374_10265601 3300013296 Bacteria 1691
73 Ga0157374_10422206 3300013296 Bacteria 1332
74 Ga0163162_10929251 3300013306 Unclassified 982
75 Ga0157372_10048909 3300013307 Bacteria 4700
76 Ga0157372_10318204 3300013307 Bacteria 1812
77 Ga0163163_10534110 3300014325 Bacteria 1235
78 Ga0182008_10082150 3300014497 Bacteria 1586
79 Ga0182006_1241797 3300015261 Bacteria 593
80 Ga0182007_10048015 3300015262 Bacteria 1411
81 Ga0182007_10241580 3300015262 Unclassified 645
82 Ga0197907_10408782 3300020069 Bacteria 528
83 Ga0197907_11068698 3300020069 Unclassified 1054
84 Ga0206356_10170311 3300020070 Bacteria 2018
85 Ga0206356_10926635 3300020070 Bacteria 1692
86 Ga0206356_11622462 3300020070 Bacteria 1593
87 Ga0206352_10439837 3300020078 Unclassified 668
88 Ga0206354_10210719 3300020081 Bacteria 2716
89 Ga0206354_11180317 3300020081 Unclassified 2604
90 Ga0206354_11282469 3300020081 Bacteria 803
91 Ga0206354_11432084 3300020081 Bacteria 1122
92 Ga0206353_10539076 3300020082 Unclassified 913
93 Ga0206353_10787298 3300020082 Bacteria 8248
94 Ga0206353_11349045 3300020082 Bacteria 1763
95 Ga0206353_11600863 3300020082 Bacteria 2323
96 Ga0206353_11611734 3300020082 Bacteria 5810
97 Ga0213876_10057939 3300021384 Bacteria 2046
98 Ga0207705_10097608 3300025909 Bacteria 2158
99 Ga0207705_10660736 3300025909 Unclassified 813
100 Ga0207707_10073049 3300025912 Bacteria 2990
101 Ga0207707_10143486 3300025912 Bacteria 2087
102 Ga0207707_10198731 3300025912 Bacteria 1748
103 Ga0207707_10439270 3300025912 Unclassified 1117
104 Ga0207707_10478151 3300025912 Bacteria 1064
105 Ga0207707_10923674 3300025912 Unclassified 720
106 Ga0207695_10085052 3300025913 Bacteria 3192
107 Ga0207695_10694401 3300025913 Bacteria 898
108 Ga0207693_10200874 3300025915 Bacteria 1568
109 Ga0207693_10453233 3300025915 Bacteria 1002
110 Ga0207663_10106103 3300025916 Unclassified 1898
111 Ga0207663_10172969 3300025916 Unclassified 1536
112 Ga0207660_10027283 3300025917 Bacteria 3895
113 Ga0207660_10389048 3300025917 Unclassified 1122
114 Ga0207660_10447680 3300025917 Unclassified 1044
115 Ga0207657_10001075 3300025919 Bacteria 28931
116 Ga0207657_10553699 3300025919 Bacteria 899
117 Ga0207649_10022734 3300025920 Bacteria 3623
118 Ga0207649_10137876 3300025920 Bacteria 1665
119 Ga0207652_10034456 3300025921 Bacteria 4267
120 Ga0207652_10104746 3300025921 Unclassified 2502
121 Ga0207652_10210123 3300025921 Unclassified 1752
122 Ga0207652_10605154 3300025921 Bacteria 982
123 Ga0207652_10915251 3300025921 Bacteria 774
124 Ga0207646_10113020 3300025922 Bacteria 2438
125 Ga0207664_10061057 3300025929 Bacteria 3006
126 Ga0207664_10496718 3300025929 Unclassified 1092
127 Ga0207644_10072800 3300025931 Bacteria 2518
128 Ga0207690_10018761 3300025932 Bacteria 4246
129 Ga0207690_10734585 3300025932 Bacteria 813
130 Ga0207686_10192190 3300025934 Bacteria 1456
131 Ga0207661_10024234 3300025944 Bacteria 4596
132 Ga0207667_10170362 3300025949 Bacteria 2238
133 Ga0207667_10269243 3300025949 Bacteria 1741
134 Ga0207667_10297609 3300025949 Unclassified 1648
135 Ga0207667_10621007 3300025949 Bacteria 1088
136 Ga0207658_10002701 3300025986 Bacteria 12799
137 Ga0207703_10095192 3300026035 Bacteria 2512
138 Ga0207678_10286600 3300026067 Bacteria 1414
139 Ga0207702_10152049 3300026078 Bacteria 2106
140 Ga0207702_11342085 3300026078 Unclassified 709
141 Ga0207698_10260891 3300026142 Unclassified 1592
142 Ga0265337_1066227 3300028556 Bacteria 996
143 Ga0265319_1028096 3300028563 Bacteria 1987
144 Ga0265319_1037860 3300028563 Unclassified 1642
145 Ga0265334_10076096 3300028573 Unclassified 1243
146 Ga0265318_10166752 3300028577 Bacteria 807
147 Ga0265322_10009193 3300028654 Bacteria 2872
148 Ga0265322_10018571 3300028654 Unclassified 1998
149 Ga0265336_10000672 3300028666 Bacteria 18520
150 Ga0265336_10131678 3300028666 Unclassified 745
151 Ga0265338_10007755 3300028800 Bacteria 13209
152 Ga0265338_10019538 3300028800 Bacteria 7180
153 Ga0265338_10038928 3300028800 Bacteria 4495
154 Ga0265324_10001948 3300029957 Bacteria 11061
155 Ga0265330_10100006 3300031235 Unclassified 1242
156 Ga0265320_10234335 3300031240 Bacteria 816
157 Ga0265320_10235598 3300031240 Bacteria 813
158 Ga0265325_10018649 3300031241 Bacteria 3848
159 Ga0265329_10034715 3300031242 Bacteria 1629
160 Ga0265340_10011976 3300031247 Bacteria 4588
161 Ga0265340_10106305 3300031247 Unclassified 1301
162 Ga0265339_10023776 3300031249 Bacteria 3539
163 Ga0265331_10069021 3300031250 Bacteria 1656
164 Ga0265316_10380379 3300031344 Unclassified 1018
165 Ga0265313_10005402 3300031595 Bacteria 9417
166 Ga0265314_10017120 3300031711 Bacteria 5698
167 Ga0265314_10082720 3300031711 Bacteria 2112
168 Ga0307416_102913719 3300032002 Bacteria 572
169 Ga0373936_0210854 3300035113 Bacteria 860
170 Ga0373945_0008919 3300035116 Unclassified 3277
171 Ga0373943_0030792 3300035170 Bacteria 2542
172 Ga0373924_0051981 3300035410 Unclassified 1700
173 Ga0373935_0316537 3300035692 Bacteria 1106
174 Ga0373935_0634014 3300035692 Bacteria 783
175 Ga0373947_0263058 3300035725 Bacteria 1143
176 Ga0373937_0041070 3300036401 Unclassified 4219
177 Ga0373937_0892729 3300036401 Bacteria 838
178 Ga0373925_0035952 3300037068 Bacteria 3656
179 Ga0373925_0249554 3300037068 Bacteria 1423
180 Ga0373925_0534831 3300037068 Bacteria 963
181 Ga0395900_0164697 3300037418 Bacteria 2260
182 Ga0395900_0978040 3300037418 Unclassified 767
183 Ga0395900_1128935 3300037418 Bacteria 700
184 Ga0395898_0076387 3300037466 Bacteria 3235
185 Ga0395898_0112693 3300037466 Bacteria 2607
186 Ga0395898_0134671 3300037466 Bacteria 2365
187 Ga0395898_0474042 3300037466 Unclassified 1191
188 Ga0395905_0080795 3300037471 Bacteria 3047
189 Ga0395905_0206418 3300037471 Bacteria 1841
190 Ga0395901_0067318 3300038443 Bacteria 3729
191 Ga0395901_0342462 3300038443 Bacteria 1544
192 Ga0395901_0473114 3300038443 Bacteria 1279
193 Ga0395901_0926092 3300038443 Bacteria 852
194 Ga0436365_0585402 3300039437 Bacteria 3940
195 Ga0436360_0907928 3300039438 Bacteria 2315
196 Ga0451849_0689894 3300041505 Archaea 555
197 Ga0466972_0363101 3300044658 Bacteria 678
198 Ga0466966_0004058 3300044684 Bacteria 9667
199 Ga0466966_0046950 3300044684 Unclassified 2755
200 Ga0466966_0078568 3300044684 Bacteria 2057
201 Ga0466966_0079873 3300044684 Bacteria 2038
202 Ga0466966_0218480 3300044684 Bacteria 1151
203 Ga0466961_0002181 3300044693 Bacteria 12175
204 Ga0466961_0088920 3300044693 Bacteria 1951
205 Ga0466961_0283015 3300044693 Bacteria 1014
206 Ga0466963_0008980 3300044694 Bacteria 6001
207 Ga0466963_0223133 3300044694 Unclassified 1320
208 Ga0466963_0806102 3300044694 Bacteria 662
209 Ga0466964_0249350 3300044706 Bacteria 875
210 Ga0466971_0053269 3300044719 Unclassified 1823
211 Ga0466971_0070988 3300044719 Bacteria 1582
212 Ga0466968_0057426 3300044735 Bacteria 1673
213 Ga0466968_0220625 3300044735 Bacteria 893
214 Ga0466970_0311366 3300044765 Unclassified 889
215 Ga0466970_0721821 3300044765 Bacteria 582
216 Ga0466957_0285183 3300044842 Bacteria 1106
217 Ga0466957_0500644 3300044842 Bacteria 842
218 Ga0466957_0763638 3300044842 Unclassified 685
219 Ga0466960_0049239 3300044901 Bacteria 2028
220 Ga0466959_0031766 3300045049 Bacteria 3907
221 Ga0466959_0100015 3300045049 Bacteria 2076
222 Ga0466959_0419500 3300045049 Bacteria 908
223 Ga0466958_0030850 3300045836 Bacteria 3186
224 Ga0466958_0294140 3300045836 Unclassified 1042
225 Ga0466958_0549688 3300045836 Bacteria 750
226 Ga0466958_1000898 3300045836 Bacteria 545
227 Ga0466967_0138829 3300045976 Bacteria 2262
228 Ga0466967_0159059 3300045976 Bacteria 2119
229 Ga0466967_0170412 3300045976 Bacteria 2048
230 Ga0466967_0215273 3300045976 Bacteria 1823
231 Ga0466967_0266019 3300045976 Bacteria 1641
232 Ga0466967_0332101 3300045976 Bacteria 1468
233 Ga0466967_0928663 3300045976 Bacteria 866
234 Ga0495592_0062293 3300046454 Bacteria 2739
235 Ga0495592_0340172 3300046454 Bacteria 965
236 Ga0495629_0152350 3300046459 Bacteria 1607
237 Ga0495641_0014195 3300046461 Bacteria 4322
238 Ga0495641_0180206 3300046461 Unclassified 946
239 Ga0495651_0024376 3300046462 Bacteria 4707
240 Ga0495653_0074154 3300046463 Bacteria 2536
241 Ga0495582_0078032 3300046473 Bacteria 1837
242 Ga0495582_0402601 3300046473 Bacteria 789
243 Ga0495662_0488225 3300046476 Bacteria 604
244 Ga0495664_0066967 3300046477 Bacteria 2142
245 Ga0495664_0100285 3300046477 Bacteria 1744
246 Ga0495608_0043402 3300046511 Bacteria 3004
247 Ga0495608_0045121 3300046511 Unclassified 2939
248 Ga0495618_0058233 3300046514 Unclassified 2447
249 Ga0495628_0095416 3300046516 Unclassified 2298
250 Ga0495628_0195433 3300046516 Bacteria 1526
251 Ga0495630_0009794 3300046517 Bacteria 6899
252 Ga0495630_0031703 3300046517 Bacteria 3936
253 Ga0495630_1062819 3300046517 Bacteria 614
254 Ga0495652_0036049 3300046529 Bacteria 4303
255 Ga0495652_0050591 3300046529 Unclassified 3551
256 Ga0495640_0007331 3300046533 Bacteria 8681
257 Ga0495587_0105085 3300046536 Bacteria 1625
258 Ga0495667_0011563 3300046559 Bacteria 5975
259 Ga0495667_0014154 3300046559 Bacteria 5385
260 Ga0495634_0025975 3300046642 Bacteria 4091
261 Ga0495635_0040418 3300046663 Bacteria 3223
262 Ga0495635_0405316 3300046663 Bacteria 905
263 Ga0495623_0011518 3300046679 Bacteria 5723
264 Ga0495646_0104914 3300046680 Bacteria 1615
265 Ga0495658_0048715 3300046683 Bacteria 2390
266 Ga0495658_0427163 3300046683 Bacteria 845
267 Ga0495613_0197631 3300046689 Bacteria 1419
268 Ga0495613_0970363 3300046689 Bacteria 547
269 Ga0495624_0033658 3300046690 Unclassified 3319
270 Ga0495589_0031444 3300046794 Unclassified 2672
271 Ga0495600_0076312 3300046809 Bacteria 2188
272 Ga0495600_0760818 3300046809 Unclassified 579
273 Ga0495604_0028031 3300047317 Bacteria 4480
274 Ga0495604_0132464 3300047317 Bacteria 1790
275 Ga0495674_0001135 3300047319 Bacteria 25640
276 Ga0495674_0049094 3300047319 Unclassified 3731
277 Ga0495676_0165912 3300047321 Unclassified 1558
278 Ga0495676_0830795 3300047321 Bacteria 594
279 Ga0495680_0004067 3300047322 Bacteria 14091
280 Ga0495680_0094929 3300047322 Bacteria 2230
281 Ga0495675_0003965 3300047444 Bacteria 8975
282 Ga0495684_0012490 3300047471 Bacteria 6545
283 Ga0495602_0048079 3300048088 Bacteria 3838
284 Ga0495602_0129627 3300048088 Bacteria 2014
285 Ga0495614_0576686 3300048089 Unclassified 539
286 Ga0496100_0009998 3300048903 Bacteria 5356
287 Ga0496100_0016460 3300048903 Bacteria 4343
288 Ga0496100_1634206 3300048903 Archaea 509
289 Ga0496101_0011095 3300048904 Bacteria 5971
290 Ga0496101_0018704 3300048904 Bacteria 4715
291 Ga0496101_0078657 3300048904 Bacteria 2433
292 Ga0496101_0809546 3300048904 Unclassified 739
293 Ga0496102_0029674 3300048905 Bacteria 4894
294 Ga0496102_0158305 3300048905 Unclassified 2129
295 Ga0496103_0022526 3300048906 Bacteria 3794
296 Ga0496104_0101551 3300048907 Unclassified 2754
297 Ga0496105_0226855 3300048908 Bacteria 1519
298 Ga0496105_1070567 3300048908 Bacteria 600
299 Ga0496106_0025769 3300048909 Bacteria 4376
300 Ga0496106_0027806 3300048909 Bacteria 4211
301 Ga0496106_0227590 3300048909 Bacteria 1488
302 Ga0496106_0961427 3300048909 Unclassified 673
303 Ga0496107_0552795 3300048910 Unclassified 852
304 Ga0496108_0006227 3300048911 Bacteria 9662
305 Ga0496108_0289872 3300048911 Bacteria 1425
306 Ga0496108_0748099 3300048911 Bacteria 846
307 Ga0496109_0004692 3300048912 Bacteria 11405
308 Ga0496109_0813491 3300048912 Unclassified 872
309 Ga0496109_0927084 3300048912 Bacteria 809
310 Ga0496110_0091671 3300048913 Unclassified 2719
311 Ga0496110_0198681 3300048913 Bacteria 1822
312 Ga0496111_0005389 3300048914 Bacteria 8188
313 Ga0496112_0005309 3300048915 Bacteria 11119
314 Ga0496112_0083184 3300048915 Bacteria 3165
315 Ga0496112_0253519 3300048915 Bacteria 1710
316 Ga0496112_0863304 3300048915 Bacteria 828
317 Ga0496112_1048309 3300048915 Unclassified 734
318 Ga0496113_0403458 3300048916 Bacteria 1098
319 Ga0496114_0013258 3300048917 Bacteria 6607
320 Ga0496114_0050500 3300048917 Bacteria 3462
321 Ga0496114_0138032 3300048917 Bacteria 2109
322 Ga0496114_0611121 3300048917 Unclassified 961
323 Ga0496114_0713666 3300048917 Unclassified 879
324 Ga0496115_0001529 3300048918 Bacteria 16618
325 Ga0496115_0006719 3300048918 Bacteria 8439
326 Ga0496115_0036319 3300048918 Bacteria 3901
327 Ga0496115_0239344 3300048918 Bacteria 1496
328 Ga0496115_0923490 3300048918 Bacteria 672
329 Ga0501031_0142890 3300049568 Unclassified 1564
330 Ga0501032_0016408 3300049569 Bacteria 5210
331 Ga0501036_0248823 3300049572 Bacteria 1490
332 Ga0501037_0262813 3300049573 Bacteria 1206
333 Ga0501038_0462193 3300049574 Unclassified 975
334 Ga0501038_1071433 3300049574 Bacteria 589
335 Ga0501040_0059418 3300049576 Bacteria 2626
336 Ga0501041_0126620 3300049577 Bacteria 1590
337 Ga0501042_0304930 3300049578 Unclassified 1150
338 Ga0501043_0649820 3300049579 Bacteria 775
339 Ga0501047_0123777 3300049581 Bacteria 2466
340 Ga0501048_0004998 3300049582 Bacteria 10111
341 Ga0501067_0059930 3300049583 Bacteria 2107
342 Ga0501067_0226550 3300049583 Bacteria 1041
343 Ga0501067_0364576 3300049583 Bacteria 805
344 Ga0501068_0148549 3300049584 Bacteria 1472
345 Ga0501069_0100387 3300049585 Unclassified 1643
346 Ga0501070_0000221 3300049586 Bacteria 54147
347 Ga0501070_0105801 3300049586 Bacteria 2326
348 Ga0501070_0702001 3300049586 Unclassified 800
349 Ga0501071_0020149 3300049587 Bacteria 4633
350 Ga0501072_0001453 3300049588 Bacteria 17756
351 Ga0501073_1138692 3300049589 Bacteria 536
352 Ga0501074_0025096 3300049590 Bacteria 4330
353 Ga0501074_0339376 3300049590 Bacteria 1066
354 Ga0501074_0770250 3300049590 Bacteria 678
355 Ga0501075_0003708 3300049591 Bacteria 10260
356 Ga0501076_0057777 3300049592 Bacteria 3081
357 Ga0501079_0040527 3300049741 Bacteria 3592
358 Ga0501080_0264071 3300049742 Bacteria 1568
359 Ga0501080_0345067 3300049742 Bacteria 1345
360 Ga0501080_0970786 3300049742 Unclassified 738
361 Ga0501081_0037181 3300049743 Bacteria 3321
362 Ga0501083_0861195 3300049744 Unclassified 590
363 Ga0501035_0327516 3300049822 Bacteria 1286
364 Ga0501045_0018396 3300049824 Bacteria 4970
365 nmdc:mga0n895_1157808_c1 3300050512 Bacteria 749
366 nmdc:mga0rr50_75221_c1 3300050513 Bacteria 2588
367 Ga0495601_0028635 3300053077 Bacteria 3451
368 Ga0495601_0080470 3300053077 Bacteria 2090
369 Ga0495601_0726554 3300053077 Bacteria 633
370 Ga0495655_0002187 3300053083 Bacteria 3084
371 Ga0495619_0021361 3300053085 Bacteria 4131
372 Ga0495619_0037587 3300053085 Bacteria 3156
373 Ga0495619_0454574 3300053085 Unclassified 883
374 Ga0501084_0016644 3300054114 Bacteria 6106
375 Ga0501082_0066247 3300060353 Bacteria 3110
376 Ga0466962_0011271 3300061719 Bacteria 4305
377 Ga0466962_0234964 3300061719 Bacteria 899
378 Ga0530510_0015194 3300061734 Bacteria 5437
379 Ga0157372_10395006
380 Ga0070658_10834690
381 Ga0070683_100003255
382 Ga0070683_101796335
383 Ga0070680_100024996
384 Ga0070682_100436860
385 Ga0068868_101168946
386 Ga0070691_10214988
387 Ga0070661_100042538
388 Ga0070661_100140657
389 Ga0070671_100778317
390 Ga0070659_100089304
391 Ga0070667_100009650
392 Ga0070714_100560837
393 Ga0070714_101092495
394 Ga0070714_101800108
395 Ga0070714_102052245
396 Ga0070713_100423907
397 Ga0070710_10307124
398 Ga0070710_10693133
399 Ga0070711_100238837
400 Ga0070711_100316169
401 Ga0070708_101185140
402 Ga0070681_10061707
403 Ga0070681_10071390
404 Ga0070681_10163233
405 Ga0070681_10728469
406 Ga0070707_100718754
407 Ga0070679_100016954
408 Ga0070679_100036435
409 Ga0070684_100002494
410 Ga0070684_100147964
411 Ga0068853_100361764
412 Ga0070665_100175968
413 Ga0070665_101294842
414 Ga0068855_100043796
415 Ga0068855_100120010
416 Ga0068855_100151954
417 Ga0068855_100314283
418 Ga0068856_100037938
419 Ga0068856_101054335
420 Ga0068852_100447104
421 Ga0068852_100577429
422 Ga0070717_10226133
423 Ga0070717_10365626
424 Ga0097621_100280386
425 Ga0097621_100790429
426 Ga0105240_10150660
427 Ga0105240_10521961
428 Ga0105240_10875686
429 Ga0105240_10992708
430 Ga0105245_10687181
431 Ga0105245_10720988
432 Ga0105243_10120908
433 Ga0105241_10255580
434 Ga0105241_10324261
435 Ga0105241_11279260
436 Ga0105242_10310302
437 Ga0105238_10084021
438 Ga0105239_10194963
439 Ga0105239_11792602
440 Ga0105246_10627766
441 Ga0157370_10073115
442 Ga0157370_10414796
443 Ga0157370_10583529
444 Ga0157369_10001856
445 Ga0157369_10018598
446 Ga0157369_10023520
447 Ga0157369_10024980
448 Ga0157369_10436544
449 Ga0157369_11199028
450 Ga0157374_10265601
451 Ga0157374_10422206
452 Ga0163162_10929251
453 Ga0157372_10048909
454 Ga0157372_10318204
455 Ga0163163_10534110
456 Ga0182008_10082150
457 Ga0182006_1241797
458 Ga0182007_10048015
459 Ga0182007_10241580
460 Ga0197907_10408782
461 Ga0197907_11068698
462 Ga0206356_10170311
463 Ga0206356_10926635
464 Ga0206356_11622462
465 Ga0206352_10439837
466 Ga0206354_10210719
467 Ga0206354_11180317
468 Ga0206354_11282469
469 Ga0206354_11432084
470 Ga0206353_10539076
471 Ga0206353_10787298
472 Ga0206353_11349045
473 Ga0206353_11600863
474 Ga0206353_11611734
475 Ga0213876_10057939
476 Ga0207705_10097608
477 Ga0207705_10660736
478 Ga0207707_10073049
479 Ga0207707_10143486
480 Ga0207707_10198731
481 Ga0207707_10439270
482 Ga0207707_10478151
483 Ga0207707_10923674
484 Ga0207695_10085052
485 Ga0207695_10694401
486 Ga0207693_10200874
487 Ga0207693_10453233
488 Ga0207663_10106103
489 Ga0207663_10172969
490 Ga0207660_10027283
491 Ga0207660_10389048
492 Ga0207660_10447680
493 Ga0207657_10001075
494 Ga0207657_10553699
495 Ga0207649_10022734
496 Ga0207649_10137876
497 Ga0207652_10034456
498 Ga0207652_10104746
499 Ga0207652_10210123
500 Ga0207652_10605154
501 Ga0207652_10915251
502 Ga0207646_10113020
503 Ga0207664_10061057
504 Ga0207664_10496718
505 Ga0207644_10072800
506 Ga0207690_10018761
507 Ga0207690_10734585
508 Ga0207686_10192190
509 Ga0207661_10024234
510 Ga0207667_10170362
511 Ga0207667_10269243
512 Ga0207667_10297609
513 Ga0207667_10621007
514 Ga0207658_10002701
515 Ga0207703_10095192
516 Ga0207678_10286600
517 Ga0207702_10152049
518 Ga0207702_11342085
519 Ga0207698_10260891
520 Ga0265337_1066227
521 Ga0265319_1028096
522 Ga0265319_1037860
523 Ga0265334_10076096
524 Ga0265318_10166752
525 Ga0265322_10009193
526 Ga0265322_10018571
527 Ga0265336_10000672
528 Ga0265336_10131678
529 Ga0265338_10007755
530 Ga0265338_10019538
531 Ga0265338_10038928
532 Ga0265324_10001948
533 Ga0265330_10100006
534 Ga0265320_10234335
535 Ga0265320_10235598
536 Ga0265325_10018649
537 Ga0265329_10034715
538 Ga0265340_10011976
539 Ga0265340_10106305
540 Ga0265339_10023776
541 Ga0265331_10069021
542 Ga0265316_10380379
543 Ga0265313_10005402
544 Ga0265314_10017120
545 Ga0265314_10082720
546 Ga0307416_102913719
547 Ga0373936_0210854
548 Ga0373945_0008919
549 Ga0373943_0030792
550 Ga0373924_0051981
551 Ga0373935_0316537
552 Ga0373935_0634014
553 Ga0373947_0263058
554 Ga0373937_0041070
555 Ga0373937_0892729
556 Ga0373925_0035952
557 Ga0373925_0249554
558 Ga0373925_0534831
559 Ga0395900_0164697
560 Ga0395900_0978040
561 Ga0395900_1128935
562 Ga0395898_0076387
563 Ga0395898_0112693
564 Ga0395898_0134671
565 Ga0395898_0474042
566 Ga0395905_0080795
567 Ga0395905_0206418
568 Ga0395901_0067318
569 Ga0395901_0342462
570 Ga0395901_0473114
571 Ga0395901_0926092
572 Ga0436365_0585402
573 Ga0436360_0907928
574 Ga0451849_0689894
575 Ga0466972_0363101
576 Ga0466966_0004058
577 Ga0466966_0046950
578 Ga0466966_0078568
579 Ga0466966_0079873
580 Ga0466966_0218480
581 Ga0466961_0002181
582 Ga0466961_0088920
583 Ga0466961_0283015
584 Ga0466963_0008980
585 Ga0466963_0223133
586 Ga0466963_0806102
587 Ga0466964_0249350
588 Ga0466971_0053269
589 Ga0466971_0070988
590 Ga0466968_0057426
591 Ga0466968_0220625
592 Ga0466970_0311366
593 Ga0466970_0721821
594 Ga0466957_0285183
595 Ga0466957_0500644
596 Ga0466957_0763638
597 Ga0466960_0049239
598 Ga0466959_0031766
599 Ga0466959_0100015
600 Ga0466959_0419500
601 Ga0466958_0030850
602 Ga0466958_0294140
603 Ga0466958_0549688
604 Ga0466958_1000898
605 Ga0466967_0138829
606 Ga0466967_0159059
607 Ga0466967_0170412
608 Ga0466967_0215273
609 Ga0466967_0266019
610 Ga0466967_0332101
611 Ga0466967_0928663
612 Ga0495592_0062293
613 Ga0495592_0340172
614 Ga0495629_0152350
615 Ga0495641_0014195
616 Ga0495641_0180206
617 Ga0495651_0024376
618 Ga0495653_0074154
619 Ga0495582_0078032
620 Ga0495582_0402601
621 Ga0495662_0488225
622 Ga0495664_0066967
623 Ga0495664_0100285
624 Ga0495608_0043402
625 Ga0495608_0045121
626 Ga0495618_0058233
627 Ga0495628_0095416
628 Ga0495628_0195433
629 Ga0495630_0009794
630 Ga0495630_0031703
631 Ga0495630_1062819
632 Ga0495652_0036049
633 Ga0495652_0050591
634 Ga0495640_0007331
635 Ga0495587_0105085
636 Ga0495667_0011563
637 Ga0495667_0014154
638 Ga0495634_0025975
639 Ga0495635_0040418
640 Ga0495635_0405316
641 Ga0495623_0011518
642 Ga0495646_0104914
643 Ga0495658_0048715
644 Ga0495658_0427163
645 Ga0495613_0197631
646 Ga0495613_0970363
647 Ga0495624_0033658
648 Ga0495589_0031444
649 Ga0495600_0076312
650 Ga0495600_0760818
651 Ga0495604_0028031
652 Ga0495604_0132464
653 Ga0495674_0001135
654 Ga0495674_0049094
655 Ga0495676_0165912
656 Ga0495676_0830795
657 Ga0495680_0004067
658 Ga0495680_0094929
659 Ga0495675_0003965
660 Ga0495684_0012490
661 Ga0495602_0048079
662 Ga0495602_0129627
663 Ga0495614_0576686
664 Ga0496100_0009998
665 Ga0496100_0016460
666 Ga0496100_1634206
667 Ga0496101_0011095
668 Ga0496101_0018704
669 Ga0496101_0078657
670 Ga0496101_0809546
671 Ga0496102_0029674
672 Ga0496102_0158305
673 Ga0496103_0022526
674 Ga0496104_0101551
675 Ga0496105_0226855
676 Ga0496105_1070567
677 Ga0496106_0025769
678 Ga0496106_0027806
679 Ga0496106_0227590
680 Ga0496106_0961427
681 Ga0496107_0552795
682 Ga0496108_0006227
683 Ga0496108_0289872
684 Ga0496108_0748099
685 Ga0496109_0004692
686 Ga0496109_0813491
687 Ga0496109_0927084
688 Ga0496110_0091671
689 Ga0496110_0198681
690 Ga0496111_0005389
691 Ga0496112_0005309
692 Ga0496112_0083184
693 Ga0496112_0253519
694 Ga0496112_0863304
695 Ga0496112_1048309
696 Ga0496113_0403458
697 Ga0496114_0013258
698 Ga0496114_0050500
699 Ga0496114_0138032
700 Ga0496114_0611121
701 Ga0496114_0713666
702 Ga0496115_0001529
703 Ga0496115_0006719
704 Ga0496115_0036319
705 Ga0496115_0239344
706 Ga0496115_0923490
707 Ga0501031_0142890
708 Ga0501032_0016408
709 Ga0501036_0248823
710 Ga0501037_0262813
711 Ga0501038_0462193
712 Ga0501038_1071433
713 Ga0501040_0059418
714 Ga0501041_0126620
715 Ga0501042_0304930
716 Ga0501043_0649820
717 Ga0501047_0123777
718 Ga0501048_0004998
719 Ga0501067_0059930
720 Ga0501067_0226550
721 Ga0501067_0364576
722 Ga0501068_0148549
723 Ga0501069_0100387
724 Ga0501070_0000221
725 Ga0501070_0105801
726 Ga0501070_0702001
727 Ga0501071_0020149
728 Ga0501072_0001453
729 Ga0501073_1138692
730 Ga0501074_0025096
731 Ga0501074_0339376
732 Ga0501074_0770250
733 Ga0501075_0003708
734 Ga0501076_0057777
735 Ga0501079_0040527
736 Ga0501080_0264071
737 Ga0501080_0345067
738 Ga0501080_0970786
739 Ga0501081_0037181
740 Ga0501083_0861195
741 Ga0501035_0327516
742 Ga0501045_0018396
743 nmdc:mga0n895_1157808_c1
744 nmdc:mga0rr50_75221_c1
745 Ga0495601_0028635
746 Ga0495601_0080470
747 Ga0495601_0726554
748 Ga0495655_0002187
749 Ga0495619_0021361
750 Ga0495619_0037587
751 Ga0495619_0454574
752 Ga0501084_0016644
753 Ga0501082_0066247
754 Ga0466962_0011271
755 Ga0466962_0234964
756 Ga0530510_0015194

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14489

QueF

QueF-like protein

57

132

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
5k0p-assembly1.cif.gz_B crystal structure of the archaeosine synthase quef-like in the apo form 0.9259 26 122
4ghm-assembly1.cif.gz_B crystal structure of the h233a mutant of 7-cyano-7-deazaguanine reductase, quef from vibrio cholerae complexed with preq0 0.9018 25 121
3rj4-assembly1.cif.gz_B crystal structure of 7-cyano-7-deazaguanine reductase, quef from vibrio cholerae 0.899 23 121
4f8b-assembly1.cif.gz_B-2 crystal structure of the covalent thioimide intermediate of unimodular nitrile reductase quef 0.8964 19 122
3bp1-assembly2.cif.gz_A crystal structure of putative 7-cyano-7-deazaguanine reductase quef from vibrio cholerae o1 biovar eltor 0.8958 23 121
ID Description Score Start End Superfamily
af_Q2G081_22_166_3.30.1130.10 Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain 0.9028 19 122 3.30.1130.10
1a8rA02 Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain 0.8714 21 122 3.30.1130.10
af_Q8I5H7_254_381_3.30.1130.10 Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain 0.825 20 122 3.30.1130.10
4uqfA02 Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain 0.8027 26 122 3.30.1130.10
af_B4FH02_104_236_3.30.1130.10 Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain 0.8026 29 122 3.30.1130.10
ID Description Score Start End GO Terms
AF-A0A7V9EHI9-F1-model_v4 PreQ(1) synthase (EC 1.7.1.13) 0.9974 32 122 GO:0005737
GO:0008616
GO:0033739
AF-A0A7V9EHI9-F1-model_v4 PreQ(1) synthase (EC 1.7.1.13) 0.9865 32 122 GO:0005737
GO:0008616
GO:0033739
AF-A0A7X1B3P7-F1-model_v4 NADPH-dependent 7-cyano-7-deazaguanine reductase (EC 1.7.1.13) (7-cyano-7-carbaguanine reductase) (NADPH-dependent nitrile oxidoreductase) (PreQ(0) reductase) 0.9627 18 122 GO:0005737
GO:0006400
GO:0008616
GO:0033739
AF-T0YYQ9-F1-model_v4 Nitrile oxidoreductase, NADPH-dependent, QueF (EC 1.7.1.13) 0.9607 18 97 GO:0005737
GO:0008616
GO:0033739
AF-A0A847YQZ9-F1-model_v4 PreQ(1) synthase 0.9544 18 122 GO:0008616
GO:0033739

Map