F427946

General Info

Members Datasets Scaffolds Average Seq Length
378 290 314 125

Family's Representative Sequence

Representative Sequence 3300005456|Ga0070678_100635901|Ga0070678_1006359012
Length 140
Sequence MSLTAEAGLSRVSQGHGGAHGAADAAKHSQTAHGSFRSYVTGFVLSVVLTAIPFWLVMGNVLNDTLRTSIVIMALAAVQIVVHMICFLHMNTKSEGGWTFLALAFTLTLVVVTLVGSVWVMYHMDQNMMPMSPHEALQRP

Samples

Sample ID Description Type Environment
1 2508501050 Microvirga lupini Lut6 Isolate Nodule
2 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
3 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
4 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
5 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
6 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
7 2545555834 Methylobacterium sp. WSM2598 Isolate Nodule
8 2595698237 Methylobacterium sp. UNCCL125 Isolate Unclassified
9 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
10 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
11 2643221568 Rhizobium sp. Root564 Isolate Unclassified
12 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
13 2671180139 Chelativorans sp. A52C2 Isolate Unclassified
14 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
15 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
16 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
17 2829745981 Methylorubrum rhodinum DSM 2163 Isolate Rhizosphere
18 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
19 2842698319 Methylobacterium sp. R-72139 Isolate Unclassified
20 2842775625 Roseomonas sp. R-71825 Isolate Unclassified
21 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
22 2843744320 Caulobacter flavus RHGG3 Isolate Unclassified
23 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
24 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
25 2851153111 Caulobacter radicis 736 Isolate Unclassified
26 2861691609 Methylorubrum thiocyanatum DSM 11490 Isolate Rhizosphere
27 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
28 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
29 2889306138 Methylobacterium sp. PvR107 Isolate Rhizosphere
30 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
31 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere
32 2902330777 Methylobacterium sp. 2A Isolate Unclassified
33 2902405164 Methylobacterium sp. P1-11 Isolate Unclassified
34 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
35 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
36 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
37 2904456579 Variovorax sp. 2002 Isolate Unclassified
38 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
39 2904699407
40 2906610324
41 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
42 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
43 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
44 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
45 2922425934
46 2928125067 Methylobacterium sp. 1973 Isolate Unclassified
47 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
48 2929520902 Variovorax beijingensis 502 Isolate Unclassified
49 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
50 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
51 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
52 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
53 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
54 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
55 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
56 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
57 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
58 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
59 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
60 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
61 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
62 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
63 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
64 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
65 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
66 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
67 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
68 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
69 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
70 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
71 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
72 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
73 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
74 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
75 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
76 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
77 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
78 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
79 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
80 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
81 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
82 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
83 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
84 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
85 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
86 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
87 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
88 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
89 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
90 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
91 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
92 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
93 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
94 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
95 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
96 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
97 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
98 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
99 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
100 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
101 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
102 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
103 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
104 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
105 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
106 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
109 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
110 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
111 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
112 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
113 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
142 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
143 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
144 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
145 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
146 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
147 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
148 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
149 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
150 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
151 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
152 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
153 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
154 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
155 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
156 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
157 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
158 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
159 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
160 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
161 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
162 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
163 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
164 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
165 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
166 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
167 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
168 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
169 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
170 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
171 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
172 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
173 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
174 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
175 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
176 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
177 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
178 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
179 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
180 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
181 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
182 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
183 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
184 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
185 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
186 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
187 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
188 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
189 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
190 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
191 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
192 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
193 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
194 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
195 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
196 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
197 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
198 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
199 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
200 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
201 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
202 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
203 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
204 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
205 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
206 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
207 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
208 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
209 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
210 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
211 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
212 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
213 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
214 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
215 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
216 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
217 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
218 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
219 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
220 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
221 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
222 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
223 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
224 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
225 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
226 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
227 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
228 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
229 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
230 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
231 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
232 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
233 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
234 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
235 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
236 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
238 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
239 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
240 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
241 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
242 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
243 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
244 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
245 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
246 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
247 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
248 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
249 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
250 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
251 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
252 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
253 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
254 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
255 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
256 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
257 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
258 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
259 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
260 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
261 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
262 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
263 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
264 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
265 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
266 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
267 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
268 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
269 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
270 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
271 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
272 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
273 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
274 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
275 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
276 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
277 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
278 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
279 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
280 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
281 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
282 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
283 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
284 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
285 641522639 Methylobacterium sp. 4-46 Isolate Nodule
286 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
287 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
288 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
289 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
290 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 83.2
Metatranscriptomes 0.53
Isolates 16.27

Biome Distribution

Category Percentage (%)
Aerial Root 0.26
Bulb 0
Endosphere 18.25
Nodule 5.82
Rhizoplane 5.56
Rhizosphere 48.68
Stem 0
Stem Tuber 0
Unclassified 21.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10058607 3300003323 Bacteria 1697
2 Ga0006562J51391_1044288 3300003578 Bacteria 2680
3 Ga0055535_1010434 3300003761 Bacteria 1526
4 Ga0055526_1024857 3300003771 Bacteria 1942
5 Ga0070683_100424470 3300005329 Bacteria 1268
6 Ga0070682_101940480 3300005337 Bacteria 517
7 Ga0070689_101040216 3300005340 Bacteria 730
8 Ga0070691_10500675 3300005341 Bacteria 702
9 Ga0070668_101117179 3300005347 Bacteria 712
10 Ga0070659_101684806 3300005366 Bacteria 567
11 Ga0070713_100221090 3300005436 Bacteria 1718
12 Ga0070663_100147249 3300005455 Bacteria 1802
13 Ga0070678_100635901 3300005456 Bacteria 956
14 Ga0070685_10140060 3300005466 Bacteria 1522
15 Ga0070679_101711810 3300005530 Bacteria 577
16 Ga0070684_101102475 3300005535 Bacteria 746
17 Ga0070665_100115763 3300005548 Bacteria 2684
18 Ga0070665_100765594 3300005548 Bacteria 978
19 Ga0070664_100102721 3300005564 Bacteria 2487
20 Ga0070664_100897981 3300005564 Bacteria 831
21 Ga0068857_100521988 3300005577 Bacteria 1116
22 Ga0068864_100086320 3300005618 Bacteria 2760
23 Ga0068870_10183516 3300005840 Bacteria 1258
24 Ga0070717_10079243 3300006028 Bacteria 2754
25 Ga0070717_11491009 3300006028 Bacteria 614
26 Ga0075365_10017620 3300006038 Bacteria 4375
27 Ga0075365_10677863 3300006038 Bacteria 728
28 Ga0075364_10018250 3300006051 Bacteria 4390
29 Ga0075364_10300895 3300006051 Bacteria 1092
30 Ga0075364_11172748 3300006051 Bacteria 521
31 Ga0075369_10040424 3300006186 Bacteria 1993
32 Ga0075369_10140610 3300006186 Bacteria 1100
33 Ga0075369_10463720 3300006186 Bacteria 600
34 Ga0075366_10572720 3300006195 Bacteria 699
35 Ga0075370_10027181 3300006353 Bacteria 3173
36 Ga0075370_10221430 3300006353 Bacteria 1118
37 Ga0068871_101316915 3300006358 Bacteria 680
38 Ga0068871_101680656 3300006358 Bacteria 602
39 Ga0068865_100725063 3300006881 Bacteria 852
40 Ga0105240_10000461 3300009093 Bacteria 74925
41 Ga0105240_10001328 3300009093 Bacteria 42581
42 Ga0105240_10116596 3300009093 Bacteria 3221
43 Ga0105240_10304782 3300009093 Bacteria 1821
44 Ga0105242_11253911 3300009176 Bacteria 763
45 Ga0105248_11400019 3300009177 Bacteria 791
46 Ga0105237_11111058 3300009545 Bacteria 797
47 Ga0105238_10644545 3300009551 Bacteria 1069
48 Ga0105249_10757679 3300009553 Bacteria 1033
49 Ga0105239_10000063 3300010375 Bacteria 151845
50 Ga0105239_10075729 3300010375 Bacteria 3701
51 Ga0105239_11429921 3300010375 Bacteria 799
52 Ga0105246_10918918 3300011119 Bacteria 786
53 Ga0157373_10020259 3300013100 Bacteria 4837
54 Ga0157371_10010140 3300013102 Bacteria 7361
55 Ga0157369_10075062 3300013105 Bacteria 3625
56 Ga0157369_12532460 3300013105 Bacteria 519
57 Ga0157374_10137325 3300013296 Bacteria 2371
58 Ga0157374_10354724 3300013296 Bacteria 1458
59 Ga0157372_10072401 3300013307 Bacteria 3884
60 Ga0163163_10070620 3300014325 Bacteria 3478
61 Ga0163163_11127662 3300014325 Bacteria 847
62 Ga0157380_10186851 3300014326 Bacteria 1826
63 Ga0182008_10634814 3300014497 Bacteria 603
64 Ga0157377_10747228 3300014745 Bacteria 715
65 Ga0182006_1260897 3300015261 Bacteria 568
66 Ga0213872_10020920 3300021361 Bacteria 3014
67 Ga0209674_100014 3300025226 Bacteria 704989
68 Ga0209258_100795 3300025242 Bacteria 18748
69 Ga0209646_1013084 3300025246 Bacteria 1266
70 Ga0209233_1000947 3300025261 Bacteria 12594
71 Ga0209025_1063068 3300025294 Bacteria 1370
72 Ga0209564_1000383 3300025295 Bacteria 81061
73 Ga0207426_1091959 3300025302 Bacteria 801
74 Ga0209051_1000638 3300025303 Bacteria 40261
75 Ga0207656_10571403 3300025321 Bacteria 577
76 Ga0207680_10625654 3300025903 Bacteria 770
77 Ga0207699_10373568 3300025906 Bacteria 1011
78 Ga0207643_10008364 3300025908 Bacteria 5552
79 Ga0207705_10267762 3300025909 Bacteria 1306
80 Ga0207695_10000633 3300025913 Bacteria 70372
81 Ga0207695_10006171 3300025913 Bacteria 15623
82 Ga0207695_10091360 3300025913 Bacteria 3058
83 Ga0207649_11612820 3300025920 Bacteria 514
84 Ga0207694_11824077 3300025924 Bacteria 511
85 Ga0207650_10624559 3300025925 Bacteria 907
86 Ga0207686_11644864 3300025934 Bacteria 531
87 Ga0207670_10870535 3300025936 Bacteria 753
88 Ga0207669_10209768 3300025937 Bacteria 1421
89 Ga0207661_10722984 3300025944 Bacteria 916
90 Ga0207679_10386225 3300025945 Bacteria 1228
91 Ga0207712_10940564 3300025961 Bacteria 765
92 Ga0207668_10128589 3300025972 Bacteria 1931
93 Ga0207658_12192334 3300025986 Bacteria 501
94 Ga0207677_11771494 3300026023 Bacteria 573
95 Ga0207678_10059187 3300026067 Bacteria 3296
96 Ga0207678_10532840 3300026067 Bacteria 1026
97 Ga0207708_10248958 3300026075 Bacteria 1431
98 Ga0207702_10060702 3300026078 Bacteria 3223
99 Ga0207702_10632342 3300026078 Bacteria 1052
100 Ga0207641_10000872 3300026088 Bacteria 31574
101 Ga0207674_10181346 3300026116 Bacteria 2057
102 Ga0207674_10371646 3300026116 Bacteria 1382
103 Ga0207674_11748070 3300026116 Bacteria 590
104 Ga0207675_100395628 3300026118 Bacteria 1361
105 Ga0207698_11019775 3300026142 Bacteria 839
106 Ga0268266_10094238 3300028379 Bacteria 2628
107 Ga0268264_10000100 3300028381 Bacteria 227852
108 Ga0307515_10101689 3300028794 Bacteria 3466
109 Ga0307511_10396789 3300030521 Bacteria 569
110 Ga0307408_100112933 3300031548 Bacteria 2090
111 Ga0307408_100315815 3300031548 Bacteria 1314
112 Ga0307405_10413935 3300031731 Bacteria 1059
113 Ga0307405_11374931 3300031731 Bacteria 616
114 Ga0307413_10115624 3300031824 Bacteria 1806
115 Ga0307410_10054455 3300031852 Bacteria 2712
116 Ga0307406_10002366 3300031901 Bacteria 10259
117 Ga0307406_11398779 3300031901 Bacteria 613
118 Ga0307407_10072086 3300031903 Bacteria 2059
119 Ga0307409_100070215 3300031995 Bacteria 2779
120 Ga0307409_100657486 3300031995 Bacteria 1043
121 Ga0307416_100013447 3300032002 Bacteria 5562
122 Ga0307416_100520160 3300032002 Bacteria 1258
123 Ga0307414_10553872 3300032004 Bacteria 1025
124 Ga0307411_10085193 3300032005 Bacteria 2188
125 Ga0307411_11358949 3300032005 Bacteria 649
126 Ga0307415_100043727 3300032126 Bacteria 2990
127 Ga0373941_0218960 3300035115 Bacteria 731
128 Ga0373943_0149423 3300035170 Bacteria 1265
129 Ga0373943_0595440 3300035170 Bacteria 651
130 Ga0373947_0157076 3300035725 Bacteria 1468
131 Ga0373925_0348650 3300037068 Bacteria 1202
132 Ga0436365_1811392 3300039437 Bacteria 9704
133 Ga0436360_0558209 3300039438 Bacteria 538
134 Ga0436361_0268143 3300039447 Bacteria 1432
135 Ga0436363_1685537 3300039450 Bacteria 908
136 Ga0439466_0028497 3300041411 Bacteria 1928
137 Ga0451802_1602938 3300041460 Bacteria 611
138 Ga0451833_0732870 3300041491 Bacteria 502
139 Ga0451851_0836388 3300041507 Bacteria 1000
140 Ga0450893_0057358 3300042532 Bacteria 739
141 Ga0466969_0048374 3300044656 Bacteria 2102
142 Ga0466969_0052396 3300044656 Bacteria 2005
143 Ga0466966_0000520 3300044684 Bacteria 24509
144 Ga0466961_0001611 3300044693 Bacteria 13995
145 Ga0466963_1134185 3300044694 Bacteria 550
146 Ga0466971_0000766 3300044719 Bacteria 12899
147 Ga0466971_0267210 3300044719 Bacteria 817
148 Ga0466968_0048890 3300044735 Bacteria 1800
149 Ga0466968_0475299 3300044735 Bacteria 620
150 Ga0466970_0009347 3300044765 Bacteria 4952
151 Ga0466957_0252567 3300044842 Bacteria 1173
152 Ga0466960_0214983 3300044901 Bacteria 1056
153 Ga0466959_0002155 3300045049 Bacteria 12502
154 Ga0466959_0074377 3300045049 Bacteria 2457
155 Ga0466958_0122616 3300045836 Bacteria 1628
156 Ga0466967_0655518 3300045976 Bacteria 1038
157 Ga0495603_0239267 3300046455 Bacteria 1046
158 Ga0495638_0025749 3300046460 Bacteria 3819
159 Ga0495638_0055416 3300046460 Bacteria 2461
160 Ga0495641_0152475 3300046461 Bacteria 1033
161 Ga0495605_0145619 3300046474 Bacteria 1060
162 Ga0495639_0406552 3300046475 Bacteria 688
163 Ga0495607_0183459 3300046501 Bacteria 1047
164 Ga0495606_0095028 3300046507 Bacteria 1826
165 Ga0495610_0108406 3300046512 Bacteria 1233
166 Ga0495616_0087755 3300046513 Bacteria 1477
167 Ga0495620_0040462 3300046515 Bacteria 2051
168 Ga0495631_0076002 3300046518 Bacteria 1449
169 Ga0495632_0128925 3300046519 Bacteria 1178
170 Ga0495637_0041308 3300046520 Bacteria 1979
171 Ga0495643_0254333 3300046522 Bacteria 818
172 Ga0495648_0088121 3300046524 Bacteria 1745
173 Ga0495654_0065121 3300046530 Bacteria 1740
174 Ga0495609_0319309 3300046538 Bacteria 630
175 Ga0495597_0222801 3300046542 Bacteria 748
176 Ga0495633_0045864 3300046558 Bacteria 2069
177 Ga0495668_0048302 3300046616 Bacteria 2361
178 Ga0495625_0163716 3300046660 Bacteria 1488
179 Ga0495661_0061494 3300046665 Bacteria 2229
180 Ga0495588_0071360 3300046674 Bacteria 1806
181 Ga0495624_0164568 3300046690 Bacteria 1354
182 Ga0495670_0344588 3300046691 Bacteria 801
183 Ga0495671_0028986 3300046692 Bacteria 2847
184 Ga0495660_0047923 3300046810 Bacteria 2338
185 Ga0495581_0132903 3300047315 Bacteria 1450
186 Ga0495672_0093533 3300047320 Bacteria 1646
187 Ga0495676_0405404 3300047321 Bacteria 904
188 Ga0495673_0068597 3300047469 Bacteria 1498
189 Ga0495686_0036903 3300047472 Bacteria 3134
190 Ga0496101_0058521 3300048904 Bacteria 2791
191 Ga0496101_0364510 3300048904 Bacteria 1136
192 Ga0496102_0071675 3300048905 Bacteria 3182
193 Ga0496102_0129504 3300048905 Bacteria 2361
194 Ga0496104_0017803 3300048907 Bacteria 6479
195 Ga0496104_0018028 3300048907 Bacteria 6436
196 Ga0496105_0101999 3300048908 Bacteria 2369
197 Ga0496105_0468518 3300048908 Bacteria 993
198 Ga0496106_0441975 3300048909 Bacteria 1045
199 Ga0496107_0108094 3300048910 Bacteria 2043
200 Ga0496108_0517319 3300048911 Bacteria 1042
201 Ga0496109_0013318 3300048912 Bacteria 7127
202 Ga0496109_1775058 3300048912 Bacteria 550
203 Ga0496110_0015782 3300048913 Bacteria 6296
204 Ga0496112_0293137 3300048915 Bacteria 1573
205 Ga0496113_0023120 3300048916 Bacteria 4405
206 Ga0496115_0320508 3300048918 Bacteria 1268
207 Ga0496115_0544349 3300048918 Bacteria 928
208 Ga0496116_0000240 3300048919 Bacteria 100232
209 Ga0496116_0002755 3300048919 Bacteria 18052
210 Ga0496116_0393304 3300048919 Bacteria 616
211 Ga0496117_0008434 3300048920 Bacteria 9785
212 Ga0496117_0028999 3300048920 Bacteria 4273
213 Ga0496117_0109055 3300048920 Bacteria 1729
214 Ga0496117_0275431 3300048920 Bacteria 904
215 Ga0496118_0001680 3300048921 Bacteria 32392
216 Ga0496118_0003211 3300048921 Bacteria 20861
217 Ga0496118_0042339 3300048921 Bacteria 3594
218 Ga0496118_0070256 3300048921 Bacteria 2529
219 Ga0496118_0095402 3300048921 Bacteria 2030
220 Ga0496118_0489906 3300048921 Bacteria 614
221 Ga0496119_0000093 3300048922 Bacteria 130450
222 Ga0496119_0116907 3300048922 Bacteria 1471
223 Ga0496119_0206931 3300048922 Bacteria 1012
224 Ga0496119_0309231 3300048922 Bacteria 776
225 Ga0496120_0000170 3300048923 Bacteria 110378
226 Ga0496120_0004164 3300048923 Bacteria 12412
227 Ga0496120_0015907 3300048923 Bacteria 4939
228 Ga0496120_0117251 3300048923 Bacteria 1382
229 Ga0496121_0000001 3300048924 Bacteria 1830318
230 Ga0496121_0000013 3300048924 Bacteria 614976
231 Ga0496121_0047605 3300048924 Bacteria 3656
232 Ga0496121_0101807 3300048924 Bacteria 2214
233 Ga0496121_0122961 3300048924 Bacteria 1956
234 Ga0496121_0139971 3300048924 Bacteria 1797
235 Ga0496122_0008505 3300048925 Bacteria 11049
236 Ga0496122_0071224 3300048925 Bacteria 2478
237 Ga0496122_0115100 3300048925 Bacteria 1753
238 Ga0496123_0036723 3300048926 Bacteria 3468
239 Ga0496123_0098390 3300048926 Bacteria 1710
240 Ga0496124_0000458 3300048927 Bacteria 70719
241 Ga0496124_0648100 3300048927 Bacteria 678
242 Ga0496125_0000001 3300048928 Bacteria 1766138
243 Ga0496125_0002477 3300048928 Bacteria 23956
244 Ga0496125_0013644 3300048928 Bacteria 7975
245 Ga0496125_0140111 3300048928 Bacteria 1683
246 Ga0496126_0000322 3300048929 Bacteria 102330
247 Ga0496126_0000715 3300048929 Bacteria 60276
248 Ga0496126_0135755 3300048929 Bacteria 2122
249 Ga0496126_0137362 3300048929 Bacteria 2107
250 Ga0496126_0303067 3300048929 Bacteria 1317
251 Ga0495678_186501 3300049459 Bacteria 647
252 Ga0501318_081142 3300049534 Bacteria 526
253 Ga0501034_0147227 3300049571 Bacteria 2332
254 Ga0501034_0222562 3300049571 Bacteria 1839
255 Ga0501070_0370128 3300049586 Bacteria 1162
256 Ga0501075_1475595 3300049591 Bacteria 515
257 Ga0501081_0285082 3300049743 Bacteria 1210
258 Ga0501267_017214 3300049764 Bacteria 776
259 Ga0501282_033938 3300049778 Bacteria 592
260 Ga0501283_075186 3300049779 Bacteria 628
261 Ga0501212_036028 3300049851 Bacteria 809
262 nmdc:mga03683_287454_c1 3300050489 Bacteria 769
263 nmdc:mga00v17_125497_c1 3300050491 Bacteria 1637
264 nmdc:mga00v17_70872_c1 3300050491 Bacteria 2160
265 nmdc:mga00v17_938844_c1 3300050491 Bacteria 546
266 nmdc:mga0yw44_48090_c1 3300050492 Bacteria 2571
267 nmdc:mga0yw44_50277_c1 3300050492 Bacteria 2520
268 nmdc:mga0yw44_50595_c1 3300050492 Bacteria 2513
269 nmdc:mga0k408_311955_c1 3300050493 Bacteria 939
270 nmdc:mga07m45_32187_c1 3300050496 Bacteria 2909
271 nmdc:mga07m45_79144_c1 3300050496 Bacteria 1876
272 nmdc:mga0sz30_213322_c1 3300050516 Bacteria 858
273 nmdc:mga0sz30_232789_c1 3300050516 Bacteria 820
274 nmdc:mga0sz30_57345_c1 3300050516 Bacteria 1660
275 Ga0495655_0039297 3300053083 Bacteria 1199
276 Ga0500578_0045591 3300053086 Bacteria 2813
277 Ga0500643_013886 3300053087 Bacteria 2819
278 Ga0500644_0543831 3300053088 Bacteria 512
279 Ga0500581_066929 3300053089 Bacteria 1812
280 Ga0500651_0164858 3300053093 Bacteria 1323
281 Ga0500651_0208822 3300053093 Bacteria 1149
282 Ga0500651_0301413 3300053093 Bacteria 919
283 Ga0500566_0006293 3300053094 Bacteria 7054
284 Ga0500650_0007993 3300053098 Bacteria 4156
285 Ga0500555_031642 3300053103 Bacteria 1499
286 Ga0500556_0000006 3300053104 Bacteria 453982
287 Ga0500562_076337 3300053108 Bacteria 905
288 Ga0500569_022016 3300053109 Bacteria 1692
289 Ga0500592_001579 3300053116 Bacteria 3681
290 Ga0500593_081945 3300053117 Bacteria 1381
291 Ga0500594_0006672 3300053118 Bacteria 2601
292 Ga0500608_142955 3300053122 Bacteria 1058
293 Ga0500618_012564 3300053125 Bacteria 2214
294 Ga0500642_0000004 3300053130 Bacteria 433122
295 Ga0500652_031498 3300053131 Bacteria 2081
296 Ga0500658_0036262 3300053134 Bacteria 1955
297 Ga0500559_0000180 3300053136 Bacteria 50042
298 Ga0500568_0024176 3300053139 Bacteria 2575
299 Ga0500577_0219328 3300053142 Bacteria 823
300 Ga0500604_0001546 3300053151 Bacteria 6439
301 Ga0500616_0000022 3300053153 Bacteria 460463
302 Ga0500616_0036627 3300053153 Bacteria 2662
303 Ga0500622_0000739 3300053156 Bacteria 28518
304 Ga0500627_0013456 3300053158 Bacteria 3103
305 Ga0500633_0050926 3300053160 Bacteria 1428
306 Ga0500634_0276078 3300053161 Bacteria 681
307 Ga0500636_0001307 3300053177 Bacteria 13519
308 Ga0500636_0005025 3300053177 Bacteria 7506
309 Ga0500637_0301295 3300053178 Bacteria 874
310 Ga0500570_170154 3300053724 Bacteria 728
311 Ga0500645_023261 3300053730 Bacteria 1900
312 Ga0501082_1601352 3300060353 Bacteria 569
313 Ga0466962_0000390 3300061719 Bacteria 18948
314 Ga0466962_0443549 3300061719 Bacteria 653

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049571 Ga0501034_0147227 Ga0501034_0147227_84_452 107
2 3300039450 Ga0436363_1685537 Ga0436363_1685537_139_570 108
3 3300006051 Ga0075364_11172748 Ga0075364_111727481 109
4 3300044656 Ga0466969_0052396 Ga0466969_0052396_277_717 109
5 3300044694 Ga0466963_1134185 Ga0466963_1134185_58_447 109
6 3300045049 Ga0466959_0074377 Ga0466959_0074377_631_1071 109
7 3300045836 Ga0466958_0122616 Ga0466958_0122616_722_1162 109
8 3300045976 Ga0466967_0655518 Ga0466967_0655518_35_424 109
9 3300050491 nmdc:mga00v17_938844_c1 nmdc:mga00v17_938844_c1_38_439 109
10 3300006051 Ga0075364_10300895 Ga0075364_103008951 110
11 3300006881 Ga0068865_100725063 Ga0068865_1007250631 110
12 3300013102 Ga0157371_10010140 Ga0157371_100101403 110
13 3300013105 Ga0157369_10075062 Ga0157369_100750622 110
14 3300013307 Ga0157372_10072401 Ga0157372_100724014 110
15 3300015261 Ga0182006_1260897 Ga0182006_12608971 110
16 3300031548 Ga0307408_100315815 Ga0307408_1003158152 110
17 3300031731 Ga0307405_10413935 Ga0307405_104139352 110
18 3300031995 Ga0307409_100657486 Ga0307409_1006574862 110
19 3300048918 Ga0496115_0544349 Ga0496115_0544349_46_402 110
20 3300048919 Ga0496116_0000240 Ga0496116_0000240_91646_92059 110
21 3300048920 Ga0496117_0275431 Ga0496117_0275431_95_508 110
22 3300048921 Ga0496118_0489906 Ga0496118_0489906_160_573 110
23 3300048922 Ga0496119_0206931 Ga0496119_0206931_207_620 110
24 3300048929 Ga0496126_0000322 Ga0496126_0000322_93652_94065 110
25 3300049591 Ga0501075_1475595 Ga0501075_1475595_10_375 110
26 3300049743 Ga0501081_0285082 Ga0501081_0285082_343_708 110
27 3300060353 Ga0501082_1601352 Ga0501082_1601352_93_458 110
28 3300003761 Ga0055535_1010434 Ga0055535_10104342 111
29 3300025226 Ga0209674_100014 Ga0209674_10001428 111
30 3300025242 Ga0209258_100795 Ga0209258_1007952 111
31 3300025246 Ga0209646_1013084 Ga0209646_10130841 111
32 3300041491 Ga0451833_0732870 Ga0451833_0732870_52_459 111
33 3300053093 Ga0500651_0208822 Ga0500651_0208822_182_601 111
34 3300003578 Ga0006562J51391_1044288 Ga0006562J51391_10442883 112
35 3300006195 Ga0075366_10572720 Ga0075366_105727202 112
36 3300006353 Ga0075370_10027181 Ga0075370_100271813 112
37 3300013100 Ga0157373_10020259 Ga0157373_100202593 112
38 3300031731 Ga0307405_11374931 Ga0307405_113749311 112
39 3300031824 Ga0307413_10115624 Ga0307413_101156242 112
40 3300031901 Ga0307406_10002366 Ga0307406_100023662 112
41 3300032002 Ga0307416_100520160 Ga0307416_1005201601 112
42 3300039438 Ga0436360_0558209 Ga0436360_0558209_13_369 112
43 3300050493 nmdc:mga0k408_311955_c1 nmdc:mga0k408_311955_c1_511_900 112
44 3300050496 nmdc:mga07m45_32187_c1 nmdc:mga07m45_32187_c1_1495_1884 112
45 3300053177 Ga0500636_0001307 Ga0500636_0001307_2139_2561 112
46 iso_pu_bacteria 2643221547 2643757468 112
47 3300005455 Ga0070663_100147249 Ga0070663_1001472492 113
48 3300005548 Ga0070665_100115763 Ga0070665_1001157633 113
49 3300006051 Ga0075364_10018250 Ga0075364_100182504 113
50 3300006186 Ga0075369_10040424 Ga0075369_100404242 113
51 3300006186 Ga0075369_10140610 Ga0075369_101406102 113
52 3300006358 Ga0068871_101316915 Ga0068871_1013169152 113
53 3300025303 Ga0209051_1000638 Ga0209051_10006383 113
54 3300026067 Ga0207678_10059187 Ga0207678_100591872 113
55 3300028379 Ga0268266_10094238 Ga0268266_100942382 113
56 3300028794 Ga0307515_10101689 Ga0307515_101016892 113
57 3300030521 Ga0307511_10396789 Ga0307511_103967892 113
58 3300046460 Ga0495638_0025749 Ga0495638_0025749_1027_1416 113
59 3300046474 Ga0495605_0145619 Ga0495605_0145619_470_859 113
60 3300046501 Ga0495607_0183459 Ga0495607_0183459_469_858 113
61 3300046507 Ga0495606_0095028 Ga0495606_0095028_946_1335 113
62 3300046512 Ga0495610_0108406 Ga0495610_0108406_109_498 113
63 3300046513 Ga0495616_0087755 Ga0495616_0087755_355_744 113
64 3300046515 Ga0495620_0040462 Ga0495620_0040462_891_1280 113
65 3300046518 Ga0495631_0076002 Ga0495631_0076002_358_747 113
66 3300046519 Ga0495632_0128925 Ga0495632_0128925_342_731 113
67 3300046520 Ga0495637_0041308 Ga0495637_0041308_1113_1502 113
68 3300046522 Ga0495643_0254333 Ga0495643_0254333_324_713 113
69 3300046524 Ga0495648_0088121 Ga0495648_0088121_736_1125 113
70 3300046530 Ga0495654_0065121 Ga0495654_0065121_754_1143 113
71 3300046538 Ga0495609_0319309 Ga0495609_0319309_108_497 113
72 3300046542 Ga0495597_0222801 Ga0495597_0222801_267_656 113
73 3300046558 Ga0495633_0045864 Ga0495633_0045864_213_602 113
74 3300046616 Ga0495668_0048302 Ga0495668_0048302_673_1062 113
75 3300046660 Ga0495625_0163716 Ga0495625_0163716_1027_1416 113
76 3300046665 Ga0495661_0061494 Ga0495661_0061494_544_933 113
77 3300046691 Ga0495670_0344588 Ga0495670_0344588_313_702 113
78 3300046692 Ga0495671_0028986 Ga0495671_0028986_660_1049 113
79 3300046810 Ga0495660_0047923 Ga0495660_0047923_1564_1953 113
80 3300047469 Ga0495673_0068597 Ga0495673_0068597_961_1350 113
81 3300047472 Ga0495686_0036903 Ga0495686_0036903_1504_1893 113
82 3300048919 Ga0496116_0393304 Ga0496116_0393304_139_528 113
83 3300048920 Ga0496117_0109055 Ga0496117_0109055_1011_1400 113
84 3300048921 Ga0496118_0070256 Ga0496118_0070256_1241_1633 113
85 3300048921 Ga0496118_0095402 Ga0496118_0095402_1550_1939 113
86 3300048923 Ga0496120_0117251 Ga0496120_0117251_912_1301 113
87 3300048924 Ga0496121_0047605 Ga0496121_0047605_19_408 113
88 3300048925 Ga0496122_0008505 Ga0496122_0008505_3071_3460 113
89 3300048925 Ga0496122_0115100 Ga0496122_0115100_129_521 113
90 3300048926 Ga0496123_0098390 Ga0496123_0098390_1036_1425 113
91 3300048927 Ga0496124_0648100 Ga0496124_0648100_250_639 113
92 3300048929 Ga0496126_0135755 Ga0496126_0135755_835_1224 113
93 3300049459 Ga0495678_186501 Ga0495678_186501_190_579 113
94 3300049534 Ga0501318_081142 Ga0501318_081142_57_482 113
95 3300049571 Ga0501034_0222562 Ga0501034_0222562_193_588 113
96 3300050489 nmdc:mga03683_287454_c1 nmdc:mga03683_287454_c1_243_656 113
97 3300050491 nmdc:mga00v17_70872_c1 nmdc:mga00v17_70872_c1_687_1079 113
98 3300050492 nmdc:mga0yw44_50595_c1 nmdc:mga0yw44_50595_c1_1238_1627 113
99 3300050516 nmdc:mga0sz30_213322_c1 nmdc:mga0sz30_213322_c1_372_785 113
100 3300050516 nmdc:mga0sz30_232789_c1 nmdc:mga0sz30_232789_c1_52_441 113
101 3300050516 nmdc:mga0sz30_57345_c1 nmdc:mga0sz30_57345_c1_232_624 113
102 3300053083 Ga0495655_0039297 Ga0495655_0039297_329_718 113
103 3300053086 Ga0500578_0045591 Ga0500578_0045591_1590_1979 113
104 3300053087 Ga0500643_013886 Ga0500643_013886_337_726 113
105 3300053088 Ga0500644_0543831 Ga0500644_0543831_52_441 113
106 3300053089 Ga0500581_066929 Ga0500581_066929_1016_1405 113
107 3300053093 Ga0500651_0164858 Ga0500651_0164858_306_695 113
108 3300053093 Ga0500651_0301413 Ga0500651_0301413_412_801 113
109 3300053094 Ga0500566_0006293 Ga0500566_0006293_1543_1932 113
110 3300053098 Ga0500650_0007993 Ga0500650_0007993_27_416 113
111 3300053103 Ga0500555_031642 Ga0500555_031642_661_1050 113
112 3300053104 Ga0500556_0000006 Ga0500556_0000006_153103_153492 113
113 3300053108 Ga0500562_076337 Ga0500562_076337_174_563 113
114 3300053109 Ga0500569_022016 Ga0500569_022016_397_786 113
115 3300053116 Ga0500592_001579 Ga0500592_001579_176_565 113
116 3300053117 Ga0500593_081945 Ga0500593_081945_957_1346 113
117 3300053118 Ga0500594_0006672 Ga0500594_0006672_1294_1683 113
118 3300053122 Ga0500608_142955 Ga0500608_142955_480_869 113
119 3300053125 Ga0500618_012564 Ga0500618_012564_1463_1852 113
120 3300053130 Ga0500642_0000004 Ga0500642_0000004_330851_331240 113
121 3300053131 Ga0500652_031498 Ga0500652_031498_172_561 113
122 3300053134 Ga0500658_0036262 Ga0500658_0036262_997_1386 113
123 3300053136 Ga0500559_0000180 Ga0500559_0000180_47771_48160 113
124 3300053139 Ga0500568_0024176 Ga0500568_0024176_104_493 113
125 3300053142 Ga0500577_0219328 Ga0500577_0219328_160_549 113
126 3300053151 Ga0500604_0001546 Ga0500604_0001546_4820_5209 113
127 3300053158 Ga0500627_0013456 Ga0500627_0013456_1527_1916 113
128 3300053160 Ga0500633_0050926 Ga0500633_0050926_44_433 113
129 3300053161 Ga0500634_0276078 Ga0500634_0276078_178_567 113
130 3300053177 Ga0500636_0005025 Ga0500636_0005025_2863_3252 113
131 3300053178 Ga0500637_0301295 Ga0500637_0301295_420_788 113
132 3300053724 Ga0500570_170154 Ga0500570_170154_296_685 113
133 3300053730 Ga0500645_023261 Ga0500645_023261_435_824 113
134 iso_pu_bacteria 2511231027 2511388509 113
135 iso_pu_bacteria 2842871566 2842875380 113
136 iso_pu_bacteria 2928521798 2928525833 113
137 iso_pu_bacteria 2954011201 2954012078 113
138 iso_pu_bacteria 3002141150 3002145569 113
139 3300006038 Ga0075365_10017620 Ga0075365_100176202 114
140 3300009093 Ga0105240_10116596 Ga0105240_101165963 114
141 3300010375 Ga0105239_10075729 Ga0105239_100757293 114
142 3300021361 Ga0213872_10020920 Ga0213872_100209202 114
143 3300025913 Ga0207695_10091360 Ga0207695_100913603 114
144 3300039447 Ga0436361_0268143 Ga0436361_0268143_230_631 114
145 3300041411 Ga0439466_0028497 Ga0439466_0028497_253_651 114
146 3300042532 Ga0450893_0057358 Ga0450893_0057358_154_549 114
147 3300048927 Ga0496124_0000458 Ga0496124_0000458_1821_2207 114
148 3300048928 Ga0496125_0140111 Ga0496125_0140111_664_1050 114
149 3300050492 nmdc:mga0yw44_50277_c1 nmdc:mga0yw44_50277_c1_2041_2433 114
150 3300053153 Ga0500616_0000022 Ga0500616_0000022_152357_152746 114
151 3300053153 Ga0500616_0036627 Ga0500616_0036627_1028_1402 114
152 3300003771 Ga0055526_1024857 Ga0055526_10248572 115
153 3300005366 Ga0070659_101684806 Ga0070659_1016848061 115
154 3300006038 Ga0075365_10677863 Ga0075365_106778631 115
155 3300006186 Ga0075369_10463720 Ga0075369_104637201 115
156 3300006353 Ga0075370_10221430 Ga0075370_102214302 115
157 3300025295 Ga0209564_1000383 Ga0209564_100038316 115
158 3300048919 Ga0496116_0002755 Ga0496116_0002755_16163_16552 115
159 3300048928 Ga0496125_0013644 Ga0496125_0013644_7053_7442 115
160 3300050492 nmdc:mga0yw44_48090_c1 nmdc:mga0yw44_48090_c1_33_422 115
161 3300050496 nmdc:mga07m45_79144_c1 nmdc:mga07m45_79144_c1_324_713 115
162 3300053156 Ga0500622_0000739 Ga0500622_0000739_16127_16516 115
163 iso_pu_bacteria 2849573788 2849574676 115
164 iso_pu_bacteria 2893066018 2893067547 115
165 iso_pu_bacteria 2919073203 2919073976 115
166 iso_pu_bacteria 2954767861 2954768742 115
167 3300005337 Ga0070682_101940480 Ga0070682_1019404801 116
168 3300005341 Ga0070691_10500675 Ga0070691_105006752 116
169 3300005564 Ga0070664_100102721 Ga0070664_1001027212 116
170 3300006358 Ga0068871_101680656 Ga0068871_1016806562 116
171 3300009093 Ga0105240_10000461 Ga0105240_1000046131 116
172 3300009093 Ga0105240_10001328 Ga0105240_100013285 116
173 3300009551 Ga0105238_10644545 Ga0105238_106445452 116
174 3300010375 Ga0105239_10000063 Ga0105239_100000635 116
175 3300025294 Ga0209025_1063068 Ga0209025_10630682 116
176 3300025913 Ga0207695_10000633 Ga0207695_100006335 116
177 3300025913 Ga0207695_10006171 Ga0207695_100061716 116
178 3300025924 Ga0207694_11824077 Ga0207694_118240772 116
179 3300026116 Ga0207674_10181346 Ga0207674_101813462 116
180 3300044656 Ga0466969_0048374 Ga0466969_0048374_929_1312 116
181 3300044684 Ga0466966_0000520 Ga0466966_0000520_9569_9952 116
182 3300044693 Ga0466961_0001611 Ga0466961_0001611_4440_4823 116
183 3300044719 Ga0466971_0000766 Ga0466971_0000766_4074_4457 116
184 3300044735 Ga0466968_0475299 Ga0466968_0475299_204_587 116
185 3300044765 Ga0466970_0009347 Ga0466970_0009347_2471_2854 116
186 3300045049 Ga0466959_0002155 Ga0466959_0002155_7849_8232 116
187 3300048904 Ga0496101_0058521 Ga0496101_0058521_2212_2598 116
188 3300048905 Ga0496102_0071675 Ga0496102_0071675_1037_1423 116
189 3300048907 Ga0496104_0017803 Ga0496104_0017803_194_580 116
190 3300048908 Ga0496105_0468518 Ga0496105_0468518_560_946 116
191 3300048920 Ga0496117_0008434 Ga0496117_0008434_470_856 116
192 3300048920 Ga0496117_0028999 Ga0496117_0028999_2636_3028 116
193 3300048921 Ga0496118_0001680 Ga0496118_0001680_27632_28018 116
194 3300048921 Ga0496118_0003211 Ga0496118_0003211_18762_19148 116
195 3300048921 Ga0496118_0042339 Ga0496118_0042339_1939_2331 116
196 3300048922 Ga0496119_0000093 Ga0496119_0000093_69435_69821 116
197 3300048922 Ga0496119_0309231 Ga0496119_0309231_265_651 116
198 3300048923 Ga0496120_0000170 Ga0496120_0000170_108403_108789 116
199 3300048923 Ga0496120_0004164 Ga0496120_0004164_10444_10830 116
200 3300048923 Ga0496120_0015907 Ga0496120_0015907_767_1159 116
201 3300048924 Ga0496121_0000001 Ga0496121_0000001_192851_193243 116
202 3300048924 Ga0496121_0000013 Ga0496121_0000013_66237_66623 116
203 3300048924 Ga0496121_0122961 Ga0496121_0122961_521_907 116
204 3300048925 Ga0496122_0071224 Ga0496122_0071224_617_1009 116
205 3300048926 Ga0496123_0036723 Ga0496123_0036723_2019_2411 116
206 3300048928 Ga0496125_0000001 Ga0496125_0000001_304734_305126 116
207 3300048929 Ga0496126_0000715 Ga0496126_0000715_30748_31134 116
208 3300048929 Ga0496126_0137362 Ga0496126_0137362_1199_1591 116
209 3300048929 Ga0496126_0303067 Ga0496126_0303067_64_456 116
210 3300061719 Ga0466962_0000390 Ga0466962_0000390_8183_8566 116
211 iso_pu_bacteria 2599185236 2599718664 116
212 iso_pu_bacteria 2842775625 2842778545 116
213 iso_pu_bacteria 2843744320 2843747990 116
214 iso_pu_bacteria 2851153111 2851153577 116
215 iso_pu_bacteria 2898329390 2898329883 116
216 iso_pu_bacteria 2904449895 2904451912 116
217 iso_pu_bacteria 2904456579 2904458942 116
218 iso_pu_bacteria 2929520902 2929523540 116
219 3300041460 Ga0451802_1602938 Ga0451802_1602938_148_510 117
220 3300041507 Ga0451851_0836388 Ga0451851_0836388_22_417 117
221 3300046460 Ga0495638_0055416 Ga0495638_0055416_1573_1980 117
222 3300048922 Ga0496119_0116907 Ga0496119_0116907_217_591 117
223 3300048928 Ga0496125_0002477 Ga0496125_0002477_21763_22137 117
224 3300049586 Ga0501070_0370128 Ga0501070_0370128_383_769 117
225 iso_pu_bacteria 2671180139 2671694040 117
226 iso_pu_bacteria 2842698319 2842702356 117
227 iso_pu_bacteria 2844533157 2844535213 117
228 iso_pu_bacteria 2919166419 2919166604 117
229 3300005466 Ga0070685_10140060 Ga0070685_101400603 118
230 3300005548 Ga0070665_100765594 Ga0070665_1007655942 118
231 3300009176 Ga0105242_11253911 Ga0105242_112539112 118
232 3300025934 Ga0207686_11644864 Ga0207686_116448641 118
233 3300026075 Ga0207708_10248958 Ga0207708_102489582 118
234 3300039437 Ga0436365_1811392 Ga0436365_1811392_5234_5626 118
235 3300044719 Ga0466971_0267210 Ga0466971_0267210_278_670 118
236 3300048915 Ga0496112_0293137 Ga0496112_0293137_721_1113 118
237 3300061719 Ga0466962_0443549 Ga0466962_0443549_204_596 118
238 iso_pu_bacteria 2508501050 2508728796 118
239 iso_pu_bacteria 2508501114 2509077807 118
240 iso_pu_bacteria 2775506901 2776257313 118
241 iso_pu_bacteria 2835312727 2835313325 118
242 iso_pu_bacteria 8056689827 8056692659 118
243 3300006028 Ga0070717_11491009 Ga0070717_114910092 119
244 3300035115 Ga0373941_0218960 Ga0373941_0218960_258_650 119
245 3300044735 Ga0466968_0048890 Ga0466968_0048890_1232_1651 119
246 3300044901 Ga0466960_0214983 Ga0466960_0214983_556_975 119
247 iso_pu_bacteria 2861691609 2861693940 119
248 3300005340 Ga0070689_101040216 Ga0070689_1010402161 120
249 3300005347 Ga0070668_101117179 Ga0070668_1011171792 120
250 3300005535 Ga0070684_101102475 Ga0070684_1011024752 120
251 3300005840 Ga0068870_10183516 Ga0068870_101835162 120
252 3300009553 Ga0105249_10757679 Ga0105249_107576792 120
253 3300011119 Ga0105246_10918918 Ga0105246_109189182 120
254 3300014325 Ga0163163_11127662 Ga0163163_111276622 120
255 3300014326 Ga0157380_10186851 Ga0157380_101868513 120
256 3300014497 Ga0182008_10634814 Ga0182008_106348141 120
257 3300014745 Ga0157377_10747228 Ga0157377_107472282 120
258 3300025908 Ga0207643_10008364 Ga0207643_100083642 120
259 3300025925 Ga0207650_10624559 Ga0207650_106245592 120
260 3300025936 Ga0207670_10870535 Ga0207670_108705352 120
261 3300025961 Ga0207712_10940564 Ga0207712_109405642 120
262 3300025972 Ga0207668_10128589 Ga0207668_101285892 120
263 3300026023 Ga0207677_11771494 Ga0207677_117714941 120
264 3300026078 Ga0207702_10632342 Ga0207702_106323422 120
265 3300026142 Ga0207698_11019775 Ga0207698_110197752 120
266 3300031548 Ga0307408_100112933 Ga0307408_1001129332 120
267 3300031852 Ga0307410_10054455 Ga0307410_100544553 120
268 3300031901 Ga0307406_11398779 Ga0307406_113987792 120
269 3300031903 Ga0307407_10072086 Ga0307407_100720862 120
270 3300031995 Ga0307409_100070215 Ga0307409_1000702153 120
271 3300032002 Ga0307416_100013447 Ga0307416_1000134472 120
272 3300032004 Ga0307414_10553872 Ga0307414_105538722 120
273 3300032005 Ga0307411_10085193 Ga0307411_100851933 120
274 3300032126 Ga0307415_100043727 Ga0307415_1000437272 120
275 3300035170 Ga0373943_0595440 Ga0373943_0595440_71_493 120
276 3300047320 Ga0495672_0093533 Ga0495672_0093533_679_1086 120
277 3300048911 Ga0496108_0517319 Ga0496108_0517319_316_738 120
278 3300048912 Ga0496109_1775058 Ga0496109_1775058_46_468 120
279 3300048924 Ga0496121_0139971 Ga0496121_0139971_894_1268 120
280 3300049764 Ga0501267_017214 Ga0501267_017214_189_599 120
281 3300049778 Ga0501282_033938 Ga0501282_033938_55_465 120
282 3300049779 Ga0501283_075186 Ga0501283_075186_43_453 120
283 3300049851 Ga0501212_036028 Ga0501212_036028_262_672 120
284 iso_pu_bacteria 2517572143 2517888390 120
285 iso_pu_bacteria 2524023210 2524470034 120
286 iso_pu_bacteria 2524023228 2524535307 120
287 iso_pu_bacteria 2667528175 2671124213 120
288 iso_pu_bacteria 2728368998 2728747921 120
289 iso_pu_bacteria 2791355197 2793067204 120
290 iso_pu_bacteria 2885383462 2885386351 120
291 iso_pu_bacteria 2903768456 2903771411 120
292 iso_pu_bacteria 2904690495 2904692274 120
293 iso_pu_bacteria 2904699407 2904707780 120
294 iso_pu_bacteria 2906610324 2906614256 120
295 iso_pu_bacteria 2908756301 2908758918 120
296 iso_pu_bacteria 2922425934 2922426079 120
297 iso_pu_bacteria 2935630451 2935632491 120
298 iso_pu_bacteria 2941507105 2941508845 120
299 iso_pu_bacteria 2941515067 2941516675 120
300 iso_pu_bacteria 2941523033 2941524309 120
301 iso_pu_bacteria 8006933436 8006936777 120
302 iso_pu_bacteria 8006973647 8006976748 120
303 iso_pu_bacteria 8019555841 8019561911 120
304 3300005329 Ga0070683_100424470 Ga0070683_1004244702 121
305 3300005436 Ga0070713_100221090 Ga0070713_1002210902 121
306 3300005456 Ga0070678_100635901 Ga0070678_1006359012 121
307 3300005530 Ga0070679_101711810 Ga0070679_1017118101 121
308 3300005564 Ga0070664_100897981 Ga0070664_1008979812 121
309 3300005577 Ga0068857_100521988 Ga0068857_1005219882 121
310 3300005618 Ga0068864_100086320 Ga0068864_1000863204 121
311 3300006028 Ga0070717_10079243 Ga0070717_100792432 121
312 3300009177 Ga0105248_11400019 Ga0105248_114000192 121
313 3300013296 Ga0157374_10137325 Ga0157374_101373252 121
314 3300013296 Ga0157374_10354724 Ga0157374_103547242 121
315 3300014325 Ga0163163_10070620 Ga0163163_100706203 121
316 3300025906 Ga0207699_10373568 Ga0207699_103735681 121
317 3300025909 Ga0207705_10267762 Ga0207705_102677622 121
318 3300025920 Ga0207649_11612820 Ga0207649_116128201 121
319 3300025937 Ga0207669_10209768 Ga0207669_102097682 121
320 3300025944 Ga0207661_10722984 Ga0207661_107229842 121
321 3300025945 Ga0207679_10386225 Ga0207679_103862251 121
322 3300026116 Ga0207674_10371646 Ga0207674_103716462 121
323 3300026118 Ga0207675_100395628 Ga0207675_1003956282 121
324 3300035170 Ga0373943_0149423 Ga0373943_0149423_812_1231 121
325 3300035725 Ga0373947_0157076 Ga0373947_0157076_836_1255 121
326 3300037068 Ga0373925_0348650 Ga0373925_0348650_195_614 121
327 3300046455 Ga0495603_0239267 Ga0495603_0239267_415_834 121
328 3300046461 Ga0495641_0152475 Ga0495641_0152475_312_731 121
329 3300046475 Ga0495639_0406552 Ga0495639_0406552_232_651 121
330 3300046674 Ga0495588_0071360 Ga0495588_0071360_1223_1642 121
331 3300046690 Ga0495624_0164568 Ga0495624_0164568_118_537 121
332 3300047315 Ga0495581_0132903 Ga0495581_0132903_649_1068 121
333 3300047321 Ga0495676_0405404 Ga0495676_0405404_349_768 121
334 3300048904 Ga0496101_0364510 Ga0496101_0364510_345_764 121
335 3300048905 Ga0496102_0129504 Ga0496102_0129504_1530_1949 121
336 3300048907 Ga0496104_0018028 Ga0496104_0018028_5645_6064 121
337 3300048908 Ga0496105_0101999 Ga0496105_0101999_1277_1696 121
338 3300048909 Ga0496106_0441975 Ga0496106_0441975_186_605 121
339 3300048910 Ga0496107_0108094 Ga0496107_0108094_265_684 121
340 3300048912 Ga0496109_0013318 Ga0496109_0013318_5888_6307 121
341 3300048913 Ga0496110_0015782 Ga0496110_0015782_5302_5721 121
342 3300048916 Ga0496113_0023120 Ga0496113_0023120_35_454 121
343 iso_pu_bacteria 2643221568 2643857417 121
344 iso_pu_bacteria 2984587000 2984591241 121
345 iso_pu_bacteria 8054460903 8054461005 121
346 3300009093 Ga0105240_10304782 Ga0105240_103047823 122
347 3300048918 Ga0496115_0320508 Ga0496115_0320508_482_862 122
348 iso_pu_bacteria 2545555834 2545675114 122
349 iso_pu_bacteria 2829745981 2829747085 122
350 iso_pu_bacteria 641522639 641645841 122
351 3300010375 Ga0105239_11429921 Ga0105239_114299212 123
352 3300013105 Ga0157369_12532460 Ga0157369_125324601 123
353 iso_pu_bacteria 2861691609 2861696773 123
354 iso_pu_bacteria 2903748898 2903753286 123
355 iso_pu_bacteria 3005474847 3005483461 123
356 3300009545 Ga0105237_11111058 Ga0105237_111110582 124
357 3300025261 Ga0209233_1000947 Ga0209233_10009478 124
358 3300032005 Ga0307411_11358949 Ga0307411_113589492 124
359 3300048924 Ga0496121_0101807 Ga0496121_0101807_1709_2101 124
360 iso_pu_bacteria 2595698237 2596371268 124
361 iso_pu_bacteria 2885374607 2885380446 124
362 iso_pu_bacteria 2889306138 2889306339 124
363 iso_pu_bacteria 2902330777 2902334955 124
364 iso_pu_bacteria 2902405164 2902408071 124
365 iso_pu_bacteria 2908739725 2908746916 124
366 iso_pu_bacteria 2928125067 2928126197 124
367 3300025321 Ga0207656_10571403 Ga0207656_105714031 125
368 3300025903 Ga0207680_10625654 Ga0207680_106256542 125
369 3300025986 Ga0207658_12192334 Ga0207658_121923341 125
370 3300026067 Ga0207678_10532840 Ga0207678_105328402 125
371 3300026078 Ga0207702_10060702 Ga0207702_100607022 125
372 3300026088 Ga0207641_10000872 Ga0207641_1000087215 125
373 3300026116 Ga0207674_11748070 Ga0207674_117480702 125
374 3300028381 Ga0268264_10000100 Ga0268264_10000100198 125
375 3300044842 Ga0466957_0252567 Ga0466957_0252567_144_548 125
376 3300025302 Ga0207426_1091959 Ga0207426_10919592 127
377 3300050491 nmdc:mga00v17_125497_c1 nmdc:mga00v17_125497_c1_730_1125 127
378 3300003323 rootH1_10058607 rootH1_100586072 130

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03626

COX4_pro

Prokaryotic Cytochrome C oxidase subunit IV

40

114

0.93

Feature Viewer

pLDDT pTM Quality
66.68 0.42 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map