F427930

General Info

Members Datasets Scaffolds Average Seq Length
378 192 756 386

Family's Representative Sequence

Representative Sequence 3300005366|Ga0070659_100173827|Ga0070659_1001738272
Length 391
Sequence VDHALSFESIVTHGDQGIEETLDVAPPIHQTSTFVAETAEDFARQATDPRPDAYYTRAGNPTHRRAEAILAKLEGAEAGIVTASGMGAITCSILAHVAAGDHVVAQKNHYMAASKFVTDILPRFGVQSTVVDQTDPDAFAAAIRTETKVIFVETPSNPTGQITDLREVANLAEQHGITTICDNTFASPINQQPIALGIDVVVHSATKYLGGHHDLIAGAVLGSSNHVETIWRFTNMFGPTLGPIDAWLLLRGLRTLPLRVRHHNEVGCAVARHLEEHPKIEAVHYPGLPSHPDYAVASRQMTGYGATFSFQVRGGYQDTQRFMASLQMVKQAVSLGGFETLAVHAAAMWGGSLSDEQVREAGVEPNMVRISIGLEAADDVIADLDHALSAV

Samples

Sample ID Description Type Environment
1 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
31 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
49 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
50 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
54 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
55 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
56 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
57 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
58 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
73 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
78 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
79 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
80 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
81 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
82 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
116 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
119 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
120 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
121 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
122 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
123 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
124 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
125 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
126 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
127 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
128 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
129 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
130 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
131 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
132 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
133 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
134 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
135 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
136 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
137 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
138 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
139 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
140 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
141 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
142 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
143 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
144 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
145 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
146 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
147 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
148 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
149 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
150 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
151 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
152 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
153 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
154 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
155 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
156 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
157 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
158 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
159 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
160 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
161 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
162 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
163 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
164 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
165 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
166 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
167 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
168 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
169 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
170 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
171 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
174 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
175 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
176 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
177 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
178 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
179 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
180 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
181 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
182 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
183 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
184 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
185 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
186 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
187 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
188 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
189 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
190 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
191 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
192 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.32
Nodule 0
Rhizoplane 4.5
Rhizosphere 94.18
Stem 0
Stem Tuber 0
Unclassified 4.76

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070659_100173827 3300005366 Bacteria 1766
2 Ga0065712_10068825 3300005290 Bacteria 8888
3 Ga0065712_10079498 3300005290 Bacteria 3207
4 Ga0065712_10080207 3300005290 Bacteria 3133
5 Ga0065715_10018279 3300005293 Bacteria 2341
6 Ga0065715_10100203 3300005293 Bacteria 3327
7 Ga0065707_10092502 3300005295 Bacteria 3761
8 Ga0070683_100002122 3300005329 Bacteria 15653
9 Ga0070670_100021999 3300005331 Bacteria 5487
10 Ga0070670_100110134 3300005331 Bacteria 2373
11 Ga0070670_100150010 3300005331 Unclassified 2018
12 Ga0068868_100074292 3300005338 Bacteria 2715
13 Ga0068868_100139203 3300005338 Bacteria 1991
14 Ga0070691_10002389 3300005341 Bacteria 8321
15 Ga0070661_100005736 3300005344 Bacteria 8553
16 Ga0070669_100005896 3300005353 Bacteria 8840
17 Ga0070669_100037757 3300005353 Bacteria 3504
18 Ga0070675_100000409 3300005354 Bacteria 29206
19 Ga0070675_100009807 3300005354 Bacteria 7461
20 Ga0070675_100050133 3300005354 Bacteria 3428
21 Ga0070675_100090618 3300005354 Unclassified 2561
22 Ga0070671_100031762 3300005355 Bacteria 4365
23 Ga0070671_100178001 3300005355 Bacteria 1800
24 Ga0070674_100005662 3300005356 Bacteria 7239
25 Ga0070674_100037351 3300005356 Bacteria 3266
26 Ga0070688_100012408 3300005365 Bacteria 4775
27 Ga0070667_100021833 3300005367 Bacteria 5312
28 Ga0070714_100017843 3300005435 Bacteria 5754
29 Ga0070701_10003008 3300005438 Bacteria 6598
30 Ga0070711_100145255 3300005439 Bacteria 1783
31 Ga0070705_100011730 3300005440 Bacteria 4432
32 Ga0070705_100014094 3300005440 Bacteria 4104
33 Ga0070694_100050901 3300005444 Bacteria 2794
34 Ga0070678_100075704 3300005456 Bacteria 2533
35 Ga0070681_10038513 3300005458 Bacteria 4794
36 Ga0070681_10159793 3300005458 Bacteria 2177
37 Ga0068867_100030230 3300005459 Bacteria 3907
38 Ga0068867_100134296 3300005459 Bacteria 1927
39 Ga0068867_100159472 3300005459 Unclassified 1778
40 Ga0070707_100031217 3300005468 Bacteria 5073
41 Ga0070707_100121722 3300005468 Bacteria 2534
42 Ga0070698_100008495 3300005471 Bacteria 11087
43 Ga0070698_100012149 3300005471 Bacteria 9125
44 Ga0070699_100005740 3300005518 Bacteria 10863
45 Ga0070699_100196001 3300005518 Bacteria 1795
46 Ga0070699_100231411 3300005518 Bacteria 1648
47 Ga0070684_100000667 3300005535 Bacteria 23730
48 Ga0070684_100363461 3300005535 Bacteria 1332
49 Ga0070697_100068326 3300005536 Bacteria 2909
50 Ga0070672_100078800 3300005543 Bacteria 2636
51 Ga0070686_100006282 3300005544 Bacteria 6599
52 Ga0070686_100027864 3300005544 Bacteria 3422
53 Ga0070695_100015578 3300005545 Bacteria 4590
54 Ga0070695_100065878 3300005545 Bacteria 2360
55 Ga0070696_100222792 3300005546 Bacteria 1416
56 Ga0070696_100264943 3300005546 Bacteria 1304
57 Ga0070693_100121209 3300005547 Bacteria 1622
58 Ga0070665_100218510 3300005548 Bacteria 1906
59 Ga0070704_100026390 3300005549 Bacteria 3837
60 Ga0070704_100177003 3300005549 Bacteria 1702
61 Ga0070664_100003674 3300005564 Bacteria 12364
62 Ga0070664_100244724 3300005564 Bacteria 1611
63 Ga0068857_100035857 3300005577 Bacteria 4394
64 Ga0068857_100089382 3300005577 Unclassified 2756
65 Ga0068854_100007383 3300005578 Bacteria 7024
66 Ga0070702_100004774 3300005615 Bacteria 6226
67 Ga0068859_100004805 3300005617 Bacteria 13756
68 Ga0068859_100068703 3300005617 Bacteria 3578
69 Ga0068859_100252746 3300005617 Bacteria 1853
70 Ga0068864_100059039 3300005618 Bacteria 3318
71 Ga0068864_100069255 3300005618 Bacteria 3068
72 Ga0068866_10085448 3300005718 Bacteria 1705
73 Ga0068861_100011211 3300005719 Bacteria 6224
74 Ga0068861_100178563 3300005719 Bacteria 1765
75 Ga0068863_100002670 3300005841 Bacteria 17625
76 Ga0068858_100013708 3300005842 Bacteria 7650
77 Ga0068858_100051966 3300005842 Bacteria 3792
78 Ga0068858_100178194 3300005842 Bacteria 2006
79 Ga0068860_100145415 3300005843 Bacteria 2281
80 Ga0068860_100355665 3300005843 Bacteria 1442
81 Ga0068862_100013760 3300005844 Bacteria 6705
82 Ga0068862_100049811 3300005844 Bacteria 3578
83 Ga0081455_10045108 3300005937 Bacteria 3838
84 Ga0081539_10048581 3300005985 Bacteria 2412
85 Ga0075364_10087588 3300006051 Bacteria 2064
86 Ga0097621_100014963 3300006237 Bacteria 5823
87 Ga0097621_100119597 3300006237 Bacteria 2233
88 Ga0068871_100009539 3300006358 Bacteria 7041
89 Ga0068871_100112006 3300006358 Bacteria 2296
90 Ga0075428_100021139 3300006844 Bacteria 7207
91 Ga0075428_100023413 3300006844 Bacteria 6835
92 Ga0075428_100078246 3300006844 Bacteria 3610
93 Ga0075428_100171126 3300006844 Bacteria 2354
94 Ga0075430_100003980 3300006846 Bacteria 12461
95 Ga0075430_100125092 3300006846 Bacteria 2143
96 Ga0075430_100146043 3300006846 Bacteria 1970
97 Ga0075431_100003517 3300006847 Bacteria 15177
98 Ga0075431_100043955 3300006847 Bacteria 4608
99 Ga0075431_100045212 3300006847 Bacteria 4540
100 Ga0075431_100273746 3300006847 Bacteria 1710
101 Ga0075433_10032193 3300006852 Bacteria 4490
102 Ga0075433_10129276 3300006852 Unclassified 2244
103 Ga0075434_100000538 3300006871 Bacteria 28855
104 Ga0075434_100017873 3300006871 Bacteria 6840
105 Ga0075434_100214678 3300006871 Bacteria 1944
106 Ga0075434_100283916 3300006871 Unclassified 1675
107 Ga0075434_100305459 3300006871 Bacteria 1611
108 Ga0075429_100001876 3300006880 Bacteria 17415
109 Ga0075429_100050799 3300006880 Bacteria 3608
110 Ga0075429_100216502 3300006880 Bacteria 1678
111 Ga0068865_100009473 3300006881 Bacteria 6041
112 Ga0075436_100003568 3300006914 Bacteria 10659
113 Ga0075436_100008599 3300006914 Bacteria 6978
114 Ga0075436_100025624 3300006914 Bacteria 4059
115 Ga0075436_100030799 3300006914 Bacteria 3692
116 Ga0075436_100034359 3300006914 Bacteria 3496
117 Ga0097620_100004804 3300006931 Bacteria 13756
118 Ga0097620_100068703 3300006931 Bacteria 3578
119 Ga0097620_100252738 3300006931 Bacteria 1853
120 Ga0075435_100000009 3300007076 Bacteria 114381
121 Ga0075435_100009079 3300007076 Bacteria 7174
122 Ga0075435_100023056 3300007076 Bacteria 4806
123 Ga0075435_100033300 3300007076 Bacteria 4073
124 Ga0075435_100239971 3300007076 Bacteria 1541
125 Ga0105240_10012235 3300009093 Bacteria 11861
126 Ga0111539_10000245 3300009094 Bacteria 65047
127 Ga0111539_10003253 3300009094 Bacteria 21476
128 Ga0111539_10012163 3300009094 Bacteria 10796
129 Ga0111539_10059662 3300009094 Bacteria 4523
130 Ga0111539_10103630 3300009094 Bacteria 3339
131 Ga0105245_10111981 3300009098 Bacteria 2539
132 Ga0105247_10003314 3300009101 Bacteria 10549
133 Ga0114129_10000118 3300009147 Bacteria 79809
134 Ga0114129_10001599 3300009147 Bacteria 30786
135 Ga0114129_10001632 3300009147 Bacteria 30462
136 Ga0114129_10002906 3300009147 Bacteria 23976
137 Ga0114129_10006983 3300009147 Bacteria 16069
138 Ga0114129_10011851 3300009147 Bacteria 12401
139 Ga0114129_10019296 3300009147 Bacteria 9712
140 Ga0114129_10034409 3300009147 Bacteria 7156
141 Ga0114129_10036744 3300009147 Bacteria 6916
142 Ga0114129_10056065 3300009147 Bacteria 5522
143 Ga0114129_10061814 3300009147 Bacteria 5234
144 Ga0114129_10130011 3300009147 Bacteria 3460
145 Ga0114129_10162802 3300009147 Bacteria 3046
146 Ga0114129_10218621 3300009147 Bacteria 2572
147 Ga0114129_10234212 3300009147 Bacteria 2472
148 Ga0114129_10472345 3300009147 Bacteria 1642
149 Ga0105243_10021816 3300009148 Bacteria 4862
150 Ga0105242_10056778 3300009176 Bacteria 3204
151 Ga0105242_10075096 3300009176 Bacteria 2813
152 Ga0105242_10117562 3300009176 Unclassified 2276
153 Ga0105248_10027382 3300009177 Bacteria 6345
154 Ga0105248_10029296 3300009177 Bacteria 6141
155 Ga0105248_10033048 3300009177 Bacteria 5778
156 Ga0105248_10059501 3300009177 Bacteria 4291
157 Ga0105248_10098649 3300009177 Bacteria 3291
158 Ga0105248_10608263 3300009177 Unclassified 1233
159 Ga0105249_10000683 3300009553 Bacteria 30864
160 Ga0157374_10023052 3300013296 Bacteria 5562
161 Ga0157374_10062390 3300013296 Bacteria 3493
162 Ga0157378_10307358 3300013297 Unclassified 1537
163 Ga0163162_10060048 3300013306 Bacteria 3835
164 Ga0163162_10241521 3300013306 Bacteria 1937
165 Ga0157375_10024484 3300013308 Bacteria 5588
166 Ga0163163_10000533 3300014325 Bacteria 33787
167 Ga0163163_10003156 3300014325 Bacteria 13963
168 Ga0163163_10075254 3300014325 Bacteria 3370
169 Ga0157380_10145413 3300014326 Bacteria 2042
170 Ga0157380_10153728 3300014326 Bacteria 1992
171 Ga0157380_10240672 3300014326 Bacteria 1631
172 Ga0157380_10408602 3300014326 Bacteria 1290
173 Ga0157377_10031781 3300014745 Bacteria 2871
174 Ga0157379_10053141 3300014968 Bacteria 3619
175 Ga0157376_10042219 3300014969 Bacteria 3738
176 Ga0157376_10399232 3300014969 Bacteria 1329
177 Ga0213871_10030860 3300021441 Unclassified 1396
178 Ga0207697_10003176 3300025315 Bacteria 8173
179 Ga0207688_10016478 3300025901 Bacteria 4008
180 Ga0207680_10021329 3300025903 Bacteria 3503
181 Ga0207680_10117571 3300025903 Bacteria 1734
182 Ga0207645_10004189 3300025907 Bacteria 10710
183 Ga0207643_10070157 3300025908 Bacteria 2015
184 Ga0207707_10137395 3300025912 Bacteria 2137
185 Ga0207695_10055106 3300025913 Bacteria 4146
186 Ga0207695_10113425 3300025913 Bacteria 2687
187 Ga0207652_10222778 3300025921 Bacteria 1699
188 Ga0207646_10079923 3300025922 Bacteria 2923
189 Ga0207646_10290575 3300025922 Bacteria 1477
190 Ga0207681_10002998 3300025923 Bacteria 10612
191 Ga0207681_10247487 3300025923 Bacteria 1390
192 Ga0207650_10091850 3300025925 Bacteria 2321
193 Ga0207659_10007517 3300025926 Bacteria 6708
194 Ga0207659_10150823 3300025926 Bacteria 1815
195 Ga0207664_10109085 3300025929 Bacteria 2299
196 Ga0207644_10102217 3300025931 Unclassified 2155
197 Ga0207686_10013375 3300025934 Bacteria 4539
198 Ga0207686_10031633 3300025934 Bacteria 3143
199 Ga0207686_10074404 3300025934 Bacteria 2195
200 Ga0207709_10151683 3300025935 Bacteria 1606
201 Ga0207670_10076362 3300025936 Bacteria 2331
202 Ga0207670_10148869 3300025936 Bacteria 1734
203 Ga0207669_10223934 3300025937 Bacteria 1382
204 Ga0207691_10046230 3300025940 Bacteria 4001
205 Ga0207691_10078626 3300025940 Bacteria 2969
206 Ga0207691_10082967 3300025940 Bacteria 2878
207 Ga0207691_10114869 3300025940 Bacteria 2391
208 Ga0207711_10008546 3300025941 Bacteria 8564
209 Ga0207711_10102352 3300025941 Bacteria 2535
210 Ga0207711_10141825 3300025941 Bacteria 2163
211 Ga0207711_10182334 3300025941 Bacteria 1910
212 Ga0207661_10003548 3300025944 Bacteria 10840
213 Ga0207661_10079557 3300025944 Bacteria 2702
214 Ga0207679_10001740 3300025945 Bacteria 13555
215 Ga0207679_10128802 3300025945 Bacteria 2027
216 Ga0207679_10312795 3300025945 Bacteria 1357
217 Ga0207712_10022960 3300025961 Bacteria 4114
218 Ga0207712_10065186 3300025961 Bacteria 2599
219 Ga0207712_10200399 3300025961 Bacteria 1582
220 Ga0207640_10011905 3300025981 Bacteria 4940
221 Ga0207658_10065673 3300025986 Bacteria 2726
222 Ga0207677_10106025 3300026023 Bacteria 2081
223 Ga0207677_10274665 3300026023 Bacteria 1380
224 Ga0207703_10025270 3300026035 Bacteria 4671
225 Ga0207703_10225373 3300026035 Bacteria 1678
226 Ga0207708_10019835 3300026075 Bacteria 5069
227 Ga0207641_10001805 3300026088 Bacteria 20587
228 Ga0207641_10120684 3300026088 Bacteria 2339
229 Ga0207648_10032563 3300026089 Bacteria 4601
230 Ga0207648_10105134 3300026089 Bacteria 2476
231 Ga0207676_10002962 3300026095 Bacteria 12111
232 Ga0207676_10022387 3300026095 Bacteria 4647
233 Ga0207676_10149161 3300026095 Bacteria 2012
234 Ga0207674_10011945 3300026116 Bacteria 9735
235 Ga0207674_10048625 3300026116 Bacteria 4340
236 Ga0207674_10084966 3300026116 Bacteria 3162
237 Ga0207675_100012017 3300026118 Bacteria 8092
238 Ga0207675_100121373 3300026118 Bacteria 2473
239 Ga0207428_10003684 3300027907 Bacteria 14736
240 Ga0207428_10009308 3300027907 Bacteria 8813
241 Ga0207428_10011498 3300027907 Bacteria 7824
242 Ga0207428_10023085 3300027907 Bacteria 5236
243 Ga0268265_10006410 3300028380 Bacteria 7976
244 Ga0268264_10124453 3300028381 Bacteria 2276
245 Ga0307408_100008938 3300031548 Bacteria 6617
246 Ga0307408_100017316 3300031548 Bacteria 4822
247 Ga0307408_100022772 3300031548 Bacteria 4261
248 Ga0307405_10078028 3300031731 Bacteria 2154
249 Ga0307410_10031687 3300031852 Bacteria 3396
250 Ga0307407_10052702 3300031903 Bacteria 2338
251 Ga0307407_10190906 3300031903 Bacteria 1365
252 Ga0307412_10003490 3300031911 Bacteria 8738
253 Ga0307412_10056999 3300031911 Bacteria 2606
254 Ga0307412_10325482 3300031911 Bacteria 1225
255 Ga0307416_100007781 3300032002 Bacteria 6851
256 Ga0307416_100029650 3300032002 Bacteria 4091
257 Ga0307416_100192691 3300032002 Bacteria 1924
258 Ga0307411_10125048 3300032005 Bacteria 1868
259 Ga0373930_0006264 3300034816 Bacteria 2006
260 Ga0373948_0002941 3300034817 Bacteria 2573
261 Ga0373950_0001697 3300034818 Bacteria 2918
262 Ga0373958_0001671 3300034819 Bacteria 3009
263 Ga0373959_0001067 3300034820 Bacteria 4498
264 Ga0373938_0000873 3300034957 Bacteria 4846
265 Ga0373928_0007111 3300035084 Bacteria 2157
266 Ga0373940_0001149 3300035088 Bacteria 4631
267 Ga0373949_0002557 3300035090 Bacteria 4624
268 Ga0373952_0006453 3300035092 Bacteria 2165
269 Ga0373932_0001232 3300035112 Bacteria 7255
270 Ga0373939_0001940 3300035114 Bacteria 4948
271 Ga0373941_0010511 3300035115 Bacteria 2366
272 Ga0373960_0034623 3300035121 Bacteria 1429
273 Ga0373943_0079019 3300035170 Bacteria 1683
274 Ga0373946_0124345 3300035171 Unclassified 1181
275 Ga0373942_0000349 3300035207 Bacteria 12604
276 Ga0373942_0044431 3300035207 Bacteria 1224
277 Ga0373961_0000574 3300035241 Bacteria 13881
278 Ga0373931_0004689 3300035691 Bacteria 6258
279 Ga0373937_0201658 3300036401 Bacteria 1870
280 Ga0373925_0279183 3300037068 Bacteria 1345
281 Ga0436360_0515054 3300039438 Bacteria 27735
282 Ga0436361_0354795 3300039447 Bacteria 18583
283 Ga0436362_0182731 3300039453 Bacteria 2227
284 Ga0453684_0163207 3300044712 Bacteria 2633
285 Ga0453684_0408162 3300044712 Bacteria 1520
286 Ga0451576_0008919 3300045051 Bacteria 11699
287 Ga0451576_0014199 3300045051 Bacteria 8876
288 Ga0466967_0145734 3300045976 Bacteria 2209
289 Ga0495638_0048585 3300046460 Bacteria 2655
290 Ga0495628_0089123 3300046516 Bacteria 2390
291 Ga0495586_0065038 3300046535 Bacteria 1988
292 Ga0495586_0128235 3300046535 Bacteria 1420
293 Ga0495621_0014689 3300046539 Bacteria 2483
294 Ga0495656_0052304 3300046615 Bacteria 1751
295 Ga0495635_0183190 3300046663 Unclassified 1423
296 Ga0495646_0087322 3300046680 Bacteria 1808
297 Ga0495613_0000118 3300046689 Eukaryota 78516
298 Ga0495613_0149174 3300046689 Bacteria 1668
299 Ga0495604_0046783 3300047317 Bacteria 3373
300 Ga0495684_0116875 3300047471 Bacteria 2010
301 Ga0496102_0050500 3300048905 Bacteria 3787
302 Ga0496102_0393710 3300048905 Bacteria 1303
303 Ga0496104_0003484 3300048907 Bacteria 13574
304 Ga0496104_0010870 3300048907 Bacteria 8142
305 Ga0496104_0024318 3300048907 Bacteria 5572
306 Ga0496106_0177531 3300048909 Bacteria 1690
307 Ga0496106_0363880 3300048909 Bacteria 1162
308 Ga0496108_0016900 3300048911 Bacteria 5964
309 Ga0496108_0068219 3300048911 Bacteria 3000
310 Ga0496109_0011580 3300048912 Bacteria 7588
311 Ga0496109_0099176 3300048912 Bacteria 2702
312 Ga0496109_0129498 3300048912 Bacteria 2355
313 Ga0496111_0003512 3300048914 Bacteria 9701
314 Ga0496112_0005675 3300048915 Bacteria 10842
315 Ga0496112_0054994 3300048915 Bacteria 3912
316 Ga0496112_0461859 3300048915 Unclassified 1207
317 Ga0496113_0144185 3300048916 Bacteria 1875
318 Ga0501299_003100 3300049522 Unclassified 2377
319 Ga0501034_0162047 3300049571 Bacteria 2207
320 Ga0501042_0199429 3300049578 Bacteria 1443
321 Ga0501042_0208815 3300049578 Bacteria 1408
322 Ga0501072_0045650 3300049588 Bacteria 3446
323 Ga0501073_0040735 3300049589 Bacteria 3286
324 Ga0501075_0044007 3300049591 Bacteria 3349
325 Ga0501075_0048490 3300049591 Bacteria 3192
326 Ga0501075_0298947 3300049591 Bacteria 1226
327 Ga0501216_007548 3300049660 Archaea 1695
328 Ga0501079_0053655 3300049741 Bacteria 3110
329 Ga0501080_0144628 3300049742 Bacteria 2198
330 nmdc:mga00v17_81614_c1 3300050491 Bacteria 2020
331 nmdc:mga05p37_107210_c1 3300050507 Bacteria 3437
332 nmdc:mga05p37_1985_c1 3300050507 Bacteria 19185
333 nmdc:mga05p37_30_c1 3300050507 Bacteria 114300
334 nmdc:mga05p37_33385_c1 3300050507 Bacteria 5991
335 nmdc:mga05p37_3683_c2 3300050507 Bacteria 6981
336 nmdc:mga05p37_3981_c1 3300050507 Bacteria 17289
337 nmdc:mga05p37_4516_c1 3300050507 Bacteria 16267
338 nmdc:mga05p37_54192_c1 3300050507 Bacteria 4934
339 nmdc:mga05p37_5694_c1 3300050507 Bacteria 14644
340 nmdc:mga05p37_73241_c1 3300050507 Bacteria 4215
341 nmdc:mga05p37_92213_c1 3300050507 Bacteria 3732
342 nmdc:mga09592_18898_c1 3300050508 Bacteria 5653
343 nmdc:mga09592_7889_c1 3300050508 Bacteria 8652
344 nmdc:mga0qj67_171071_c1 3300050509 Bacteria 1764
345 nmdc:mga0qj67_229413_c1 3300050509 Bacteria 1507
346 nmdc:mga0qj67_39200_c1 3300050509 Unclassified 3720
347 nmdc:mga06r32_105412_c1 3300050510 Bacteria 2769
348 nmdc:mga06r32_154858_c1 3300050510 Unclassified 2273
349 nmdc:mga06r32_5351_c1 3300050510 Bacteria 11558
350 nmdc:mga08y16_11928_c1 3300050511 Bacteria 9129
351 nmdc:mga08y16_1461_c1 3300050511 Bacteria 23685
352 nmdc:mga08y16_18568_c1 3300050511 Bacteria 7327
353 nmdc:mga08y16_392901_c1 3300050511 Bacteria 1421
354 nmdc:mga0n895_123269_c1 3300050512 Bacteria 2614
355 nmdc:mga0n895_129721_c1 3300050512 Bacteria 2546
356 nmdc:mga0n895_198928_c1 3300050512 Bacteria 2035
357 nmdc:mga0n895_251447_c1 3300050512 Bacteria 1794
358 nmdc:mga0n895_45885_c1 3300050512 Bacteria 4267
359 nmdc:mga0n895_53391_c1 3300050512 Bacteria 3971
360 nmdc:mga0n895_67_c1 3300050512 Bacteria 61603
361 nmdc:mga0rr50_189783_c1 3300050513 Bacteria 1683
362 nmdc:mga0rr50_25_c1 3300050513 Bacteria 114931
363 nmdc:mga0rr50_2772_c1 3300050513 Bacteria 9956
364 nmdc:mga08x19_10588_c1 3300050514 Bacteria 5543
365 nmdc:mga08x19_16154_c1 3300050514 Bacteria 4548
366 nmdc:mga08x19_3247_c1 3300050514 Bacteria 9740
367 nmdc:mga08x19_94146_c1 3300050514 Bacteria 1981
368 nmdc:mga0a205_117377_c1 3300050515 Bacteria 2559
369 nmdc:mga0a205_134885_c1 3300050515 Unclassified 2369
370 nmdc:mga0a205_19997_c1 3300050515 Bacteria 6316
371 nmdc:mga0a205_3960_c2 3300050515 Bacteria 7327
372 nmdc:mga0a205_41014_c1 3300050515 Bacteria 4457
373 nmdc:mga0a205_4923_c1 3300050515 Bacteria 12016
374 nmdc:mga0a205_76759_c1 3300050515 Bacteria 3229
375 Ga0500555_000998 3300053103 Bacteria 9680
376 Ga0500616_0000262 3300053153 Bacteria 80829
377 Ga0500645_000671 3300053730 Bacteria 21515
378 Ga0501084_0090895 3300054114 Bacteria 2563
379 Ga0070659_100173827
380 Ga0065712_10068825
381 Ga0065712_10079498
382 Ga0065712_10080207
383 Ga0065715_10018279
384 Ga0065715_10100203
385 Ga0065707_10092502
386 Ga0070683_100002122
387 Ga0070670_100021999
388 Ga0070670_100110134
389 Ga0070670_100150010
390 Ga0068868_100074292
391 Ga0068868_100139203
392 Ga0070691_10002389
393 Ga0070661_100005736
394 Ga0070669_100005896
395 Ga0070669_100037757
396 Ga0070675_100000409
397 Ga0070675_100009807
398 Ga0070675_100050133
399 Ga0070675_100090618
400 Ga0070671_100031762
401 Ga0070671_100178001
402 Ga0070674_100005662
403 Ga0070674_100037351
404 Ga0070688_100012408
405 Ga0070667_100021833
406 Ga0070714_100017843
407 Ga0070701_10003008
408 Ga0070711_100145255
409 Ga0070705_100011730
410 Ga0070705_100014094
411 Ga0070694_100050901
412 Ga0070678_100075704
413 Ga0070681_10038513
414 Ga0070681_10159793
415 Ga0068867_100030230
416 Ga0068867_100134296
417 Ga0068867_100159472
418 Ga0070707_100031217
419 Ga0070707_100121722
420 Ga0070698_100008495
421 Ga0070698_100012149
422 Ga0070699_100005740
423 Ga0070699_100196001
424 Ga0070699_100231411
425 Ga0070684_100000667
426 Ga0070684_100363461
427 Ga0070697_100068326
428 Ga0070672_100078800
429 Ga0070686_100006282
430 Ga0070686_100027864
431 Ga0070695_100015578
432 Ga0070695_100065878
433 Ga0070696_100222792
434 Ga0070696_100264943
435 Ga0070693_100121209
436 Ga0070665_100218510
437 Ga0070704_100026390
438 Ga0070704_100177003
439 Ga0070664_100003674
440 Ga0070664_100244724
441 Ga0068857_100035857
442 Ga0068857_100089382
443 Ga0068854_100007383
444 Ga0070702_100004774
445 Ga0068859_100004805
446 Ga0068859_100068703
447 Ga0068859_100252746
448 Ga0068864_100059039
449 Ga0068864_100069255
450 Ga0068866_10085448
451 Ga0068861_100011211
452 Ga0068861_100178563
453 Ga0068863_100002670
454 Ga0068858_100013708
455 Ga0068858_100051966
456 Ga0068858_100178194
457 Ga0068860_100145415
458 Ga0068860_100355665
459 Ga0068862_100013760
460 Ga0068862_100049811
461 Ga0081455_10045108
462 Ga0081539_10048581
463 Ga0075364_10087588
464 Ga0097621_100014963
465 Ga0097621_100119597
466 Ga0068871_100009539
467 Ga0068871_100112006
468 Ga0075428_100021139
469 Ga0075428_100023413
470 Ga0075428_100078246
471 Ga0075428_100171126
472 Ga0075430_100003980
473 Ga0075430_100125092
474 Ga0075430_100146043
475 Ga0075431_100003517
476 Ga0075431_100043955
477 Ga0075431_100045212
478 Ga0075431_100273746
479 Ga0075433_10032193
480 Ga0075433_10129276
481 Ga0075434_100000538
482 Ga0075434_100017873
483 Ga0075434_100214678
484 Ga0075434_100283916
485 Ga0075434_100305459
486 Ga0075429_100001876
487 Ga0075429_100050799
488 Ga0075429_100216502
489 Ga0068865_100009473
490 Ga0075436_100003568
491 Ga0075436_100008599
492 Ga0075436_100025624
493 Ga0075436_100030799
494 Ga0075436_100034359
495 Ga0097620_100004804
496 Ga0097620_100068703
497 Ga0097620_100252738
498 Ga0075435_100000009
499 Ga0075435_100009079
500 Ga0075435_100023056
501 Ga0075435_100033300
502 Ga0075435_100239971
503 Ga0105240_10012235
504 Ga0111539_10000245
505 Ga0111539_10003253
506 Ga0111539_10012163
507 Ga0111539_10059662
508 Ga0111539_10103630
509 Ga0105245_10111981
510 Ga0105247_10003314
511 Ga0114129_10000118
512 Ga0114129_10001599
513 Ga0114129_10001632
514 Ga0114129_10002906
515 Ga0114129_10006983
516 Ga0114129_10011851
517 Ga0114129_10019296
518 Ga0114129_10034409
519 Ga0114129_10036744
520 Ga0114129_10056065
521 Ga0114129_10061814
522 Ga0114129_10130011
523 Ga0114129_10162802
524 Ga0114129_10218621
525 Ga0114129_10234212
526 Ga0114129_10472345
527 Ga0105243_10021816
528 Ga0105242_10056778
529 Ga0105242_10075096
530 Ga0105242_10117562
531 Ga0105248_10027382
532 Ga0105248_10029296
533 Ga0105248_10033048
534 Ga0105248_10059501
535 Ga0105248_10098649
536 Ga0105248_10608263
537 Ga0105249_10000683
538 Ga0157374_10023052
539 Ga0157374_10062390
540 Ga0157378_10307358
541 Ga0163162_10060048
542 Ga0163162_10241521
543 Ga0157375_10024484
544 Ga0163163_10000533
545 Ga0163163_10003156
546 Ga0163163_10075254
547 Ga0157380_10145413
548 Ga0157380_10153728
549 Ga0157380_10240672
550 Ga0157380_10408602
551 Ga0157377_10031781
552 Ga0157379_10053141
553 Ga0157376_10042219
554 Ga0157376_10399232
555 Ga0213871_10030860
556 Ga0207697_10003176
557 Ga0207688_10016478
558 Ga0207680_10021329
559 Ga0207680_10117571
560 Ga0207645_10004189
561 Ga0207643_10070157
562 Ga0207707_10137395
563 Ga0207695_10055106
564 Ga0207695_10113425
565 Ga0207652_10222778
566 Ga0207646_10079923
567 Ga0207646_10290575
568 Ga0207681_10002998
569 Ga0207681_10247487
570 Ga0207650_10091850
571 Ga0207659_10007517
572 Ga0207659_10150823
573 Ga0207664_10109085
574 Ga0207644_10102217
575 Ga0207686_10013375
576 Ga0207686_10031633
577 Ga0207686_10074404
578 Ga0207709_10151683
579 Ga0207670_10076362
580 Ga0207670_10148869
581 Ga0207669_10223934
582 Ga0207691_10046230
583 Ga0207691_10078626
584 Ga0207691_10082967
585 Ga0207691_10114869
586 Ga0207711_10008546
587 Ga0207711_10102352
588 Ga0207711_10141825
589 Ga0207711_10182334
590 Ga0207661_10003548
591 Ga0207661_10079557
592 Ga0207679_10001740
593 Ga0207679_10128802
594 Ga0207679_10312795
595 Ga0207712_10022960
596 Ga0207712_10065186
597 Ga0207712_10200399
598 Ga0207640_10011905
599 Ga0207658_10065673
600 Ga0207677_10106025
601 Ga0207677_10274665
602 Ga0207703_10025270
603 Ga0207703_10225373
604 Ga0207708_10019835
605 Ga0207641_10001805
606 Ga0207641_10120684
607 Ga0207648_10032563
608 Ga0207648_10105134
609 Ga0207676_10002962
610 Ga0207676_10022387
611 Ga0207676_10149161
612 Ga0207674_10011945
613 Ga0207674_10048625
614 Ga0207674_10084966
615 Ga0207675_100012017
616 Ga0207675_100121373
617 Ga0207428_10003684
618 Ga0207428_10009308
619 Ga0207428_10011498
620 Ga0207428_10023085
621 Ga0268265_10006410
622 Ga0268264_10124453
623 Ga0307408_100008938
624 Ga0307408_100017316
625 Ga0307408_100022772
626 Ga0307405_10078028
627 Ga0307410_10031687
628 Ga0307407_10052702
629 Ga0307407_10190906
630 Ga0307412_10003490
631 Ga0307412_10056999
632 Ga0307412_10325482
633 Ga0307416_100007781
634 Ga0307416_100029650
635 Ga0307416_100192691
636 Ga0307411_10125048
637 Ga0373930_0006264
638 Ga0373948_0002941
639 Ga0373950_0001697
640 Ga0373958_0001671
641 Ga0373959_0001067
642 Ga0373938_0000873
643 Ga0373928_0007111
644 Ga0373940_0001149
645 Ga0373949_0002557
646 Ga0373952_0006453
647 Ga0373932_0001232
648 Ga0373939_0001940
649 Ga0373941_0010511
650 Ga0373960_0034623
651 Ga0373943_0079019
652 Ga0373946_0124345
653 Ga0373942_0000349
654 Ga0373942_0044431
655 Ga0373961_0000574
656 Ga0373931_0004689
657 Ga0373937_0201658
658 Ga0373925_0279183
659 Ga0436360_0515054
660 Ga0436361_0354795
661 Ga0436362_0182731
662 Ga0453684_0163207
663 Ga0453684_0408162
664 Ga0451576_0008919
665 Ga0451576_0014199
666 Ga0466967_0145734
667 Ga0495638_0048585
668 Ga0495628_0089123
669 Ga0495586_0065038
670 Ga0495586_0128235
671 Ga0495621_0014689
672 Ga0495656_0052304
673 Ga0495635_0183190
674 Ga0495646_0087322
675 Ga0495613_0000118
676 Ga0495613_0149174
677 Ga0495604_0046783
678 Ga0495684_0116875
679 Ga0496102_0050500
680 Ga0496102_0393710
681 Ga0496104_0003484
682 Ga0496104_0010870
683 Ga0496104_0024318
684 Ga0496106_0177531
685 Ga0496106_0363880
686 Ga0496108_0016900
687 Ga0496108_0068219
688 Ga0496109_0011580
689 Ga0496109_0099176
690 Ga0496109_0129498
691 Ga0496111_0003512
692 Ga0496112_0005675
693 Ga0496112_0054994
694 Ga0496112_0461859
695 Ga0496113_0144185
696 Ga0501299_003100
697 Ga0501034_0162047
698 Ga0501042_0199429
699 Ga0501042_0208815
700 Ga0501072_0045650
701 Ga0501073_0040735
702 Ga0501075_0044007
703 Ga0501075_0048490
704 Ga0501075_0298947
705 Ga0501216_007548
706 Ga0501079_0053655
707 Ga0501080_0144628
708 nmdc:mga00v17_81614_c1
709 nmdc:mga05p37_107210_c1
710 nmdc:mga05p37_1985_c1
711 nmdc:mga05p37_30_c1
712 nmdc:mga05p37_33385_c1
713 nmdc:mga05p37_3683_c2
714 nmdc:mga05p37_3981_c1
715 nmdc:mga05p37_4516_c1
716 nmdc:mga05p37_54192_c1
717 nmdc:mga05p37_5694_c1
718 nmdc:mga05p37_73241_c1
719 nmdc:mga05p37_92213_c1
720 nmdc:mga09592_18898_c1
721 nmdc:mga09592_7889_c1
722 nmdc:mga0qj67_171071_c1
723 nmdc:mga0qj67_229413_c1
724 nmdc:mga0qj67_39200_c1
725 nmdc:mga06r32_105412_c1
726 nmdc:mga06r32_154858_c1
727 nmdc:mga06r32_5351_c1
728 nmdc:mga08y16_11928_c1
729 nmdc:mga08y16_1461_c1
730 nmdc:mga08y16_18568_c1
731 nmdc:mga08y16_392901_c1
732 nmdc:mga0n895_123269_c1
733 nmdc:mga0n895_129721_c1
734 nmdc:mga0n895_198928_c1
735 nmdc:mga0n895_251447_c1
736 nmdc:mga0n895_45885_c1
737 nmdc:mga0n895_53391_c1
738 nmdc:mga0n895_67_c1
739 nmdc:mga0rr50_189783_c1
740 nmdc:mga0rr50_25_c1
741 nmdc:mga0rr50_2772_c1
742 nmdc:mga08x19_10588_c1
743 nmdc:mga08x19_16154_c1
744 nmdc:mga08x19_3247_c1
745 nmdc:mga08x19_94146_c1
746 nmdc:mga0a205_117377_c1
747 nmdc:mga0a205_134885_c1
748 nmdc:mga0a205_19997_c1
749 nmdc:mga0a205_3960_c2
750 nmdc:mga0a205_41014_c1
751 nmdc:mga0a205_4923_c1
752 nmdc:mga0a205_76759_c1
753 Ga0500555_000998
754 Ga0500616_0000262
755 Ga0500645_000671
756 Ga0501084_0090895

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01053

Cys_Met_Meta_PP

Cys/Met metabolism PLP-dependent enzyme

8

389

0.95

PF00266

Aminotran_5

Aminotransferase class-V

64

212

0.86

PF01041

DegT_DnrJ_EryC1

DegT/DnrJ/EryC1/StrS aminotransferase family

37

194

0.83

PF01212

Beta_elim_lyase

Beta-eliminating lyase

31

287

0.79

PF00155

Aminotran_1_2

Aminotransferase class I and II

27

220

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
3qi6-assembly1.cif.gz_C crystal structure of cystathionine gamma-synthase metb (cgs) from mycobacterium ulcerans agy99 0.966 9 394
1pff-assembly1.cif.gz_A crystal structure of homocysteine alpha-, gamma-lyase at 1.8 angstroms 0.9654 71 393
5m3z-assembly1.cif.gz_A crystal structure of citrobacter freundii methionine gamma-lyase with c115h replacement in the complex with l-norleucine 0.9648 9 393
6egr-assembly1.cif.gz_A crystal structure of citrobacter freundii methionine gamma-lyase with v358y replacement 0.9643 9 393
3qi6-assembly1.cif.gz_C crystal structure of cystathionine gamma-synthase metb (cgs) from mycobacterium ulcerans agy99 0.9634 9 394
ID Description Score Start End Superfamily
af_A0A0P0VYR6_1_109_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9944 154 260 3.40.640.10
3ndnB02 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9683 263 394 3.90.1150.10
af_A0A0P0VYR6_1_109_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9674 154 260 3.40.640.10
1pffB01 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9639 71 260 3.40.640.10
af_A0A1D6P7H0_376_509_3.90.1150.10 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9592 263 393 3.90.1150.10
ID Description Score Start End GO Terms
AF-A0A2V8EVP9-F1-model_v4 Cystathionine gamma-synthase 0.9979 188 394 GO:0004123
GO:0005737
GO:0019343
GO:0019346
GO:0030170
AF-A0A528N2F8-F1-model_v4 Cystathionine beta-lyase 0.9959 156 232 GO:0005737
GO:0016846
GO:0019346
GO:0030170
AF-A0A2V8EVP9-F1-model_v4 Cystathionine gamma-synthase 0.9931 188 394 GO:0004123
GO:0005737
GO:0019343
GO:0019346
GO:0030170
AF-A0A139DGF1-F1-model_v4 Cystathionine gamma-synthase 0.987 190 394 GO:0005737
GO:0016846
GO:0019346
GO:0030170
AF-A0A7S2W7Z0-F1-model_v4 Cystathionine gamma-lyase 0.9855 145 227 GO:0005737
GO:0016846
GO:0019346
GO:0030170

Map