F427861

General Info

Members Datasets Scaffolds Average Seq Length
377 238 754 224

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2515154155|2515856452
Length 262
Sequence SITEYHPFTDHPQLSGWLSFEKDRGASHGDQAAIGANGDEAVRIDPIAGELVTETFEYDGGRQATVYVPPDPPEAVVFAGDGQLISQWGGYLEAVDVPHTMIVGAYRTADEDEMARIKEYSPPFDEERFAAHERFFVEDVRSWVRSRFGVALPAERTAVCGVSASGELALAMGLRHPDIYGAVFSASPGGGYRPPAVMPNPLPRTYLVAGTLEPFFLENATRWADALRDAGADVVMTERVGTHGDPFWQAEFPLMVAWAFGR

Samples

Sample ID Description Type Environment
1 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
15 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
34 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
35 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
36 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
37 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
38 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
39 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
40 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
41 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
42 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
43 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
44 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
45 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
46 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
47 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
51 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
52 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
53 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
54 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
55 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
56 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
57 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
58 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
59 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
60 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
61 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
62 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
63 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
64 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
65 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
66 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
67 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
68 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
98 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
101 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
102 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
103 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
104 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
105 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
106 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
107 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
108 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
109 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
110 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
111 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
112 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
113 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
114 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
115 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
116 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
117 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
118 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
119 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
120 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
121 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
122 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
123 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
124 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
125 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
126 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
127 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
128 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
129 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
130 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
131 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
132 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
133 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
134 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
135 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
136 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
137 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
138 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
139 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
140 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
141 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
142 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
143 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
144 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
145 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
146 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
147 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
148 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
149 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
150 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
151 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
152 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
153 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
154 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
155 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
156 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
157 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
158 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
159 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
160 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
161 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
162 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
163 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
164 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
165 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
166 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
167 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
168 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
169 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
170 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
171 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
172 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
173 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
174 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
175 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
176 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
177 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
178 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
179 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
180 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
181 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
182 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
183 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
184 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
185 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
186 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
187 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
188 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
189 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
190 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
204 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
205 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
206 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
207 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
208 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
209 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
210 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
211 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
212 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
213 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
215 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
216 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
217 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
218 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
219 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
220 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
221 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
222 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
223 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
224 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
225 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
226 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
227 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
228 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
229 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
230 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
231 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
232 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
233 2675903058 Actinopolymorpha cephalotaxi CPCC 202808 Isolate Rhizosphere
234 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
235 2827628540 Actinopolymorpha cephalotaxi DSM 45117 Isolate Rhizosphere
236 2857453340 Paenibacillus sp. R-74130 Isolate Unclassified
237 2889049205 Paenibacillus rhizovicinus 14171R-81 Isolate Rhizosphere
238 3006984091 Lederbergia citrea FJAT-49754 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.61
Metatranscriptomes 0.53
Isolates 1.86

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.12
Nodule 0
Rhizoplane 8.22
Rhizosphere 85.41
Stem 0
Stem Tuber 0
Unclassified 4.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10023753 3300001989 Bacteria 2164
2 rootH1_10149529 3300003323 Bacteria 1690
3 Ga0070683_100017574 3300005329 Bacteria 6322
4 Ga0070683_100102660 3300005329 Bacteria 2693
5 Ga0070670_100059193 3300005331 Bacteria 3288
6 Ga0070670_100089457 3300005331 Bacteria 2646
7 Ga0070682_100154478 3300005337 Bacteria 1578
8 Ga0068868_100067016 3300005338 Bacteria 2856
9 Ga0070660_100306832 3300005339 Bacteria 1302
10 Ga0070692_10396583 3300005345 Bacteria 870
11 Ga0070673_100474037 3300005364 Bacteria 1129
12 Ga0070659_100474818 3300005366 Bacteria 1063
13 Ga0070714_100010589 3300005435 Bacteria 7294
14 Ga0070714_100060395 3300005435 Bacteria 3253
15 Ga0070714_100130758 3300005435 Bacteria 2243
16 Ga0070714_100265178 3300005435 Bacteria 1591
17 Ga0070713_100016662 3300005436 Bacteria 5529
18 Ga0070713_100033201 3300005436 Bacteria 4131
19 Ga0070713_100054665 3300005436 Bacteria 3313
20 Ga0070713_100578689 3300005436 Bacteria 1065
21 Ga0070711_100014194 3300005439 Bacteria 5015
22 Ga0070711_100228615 3300005439 Bacteria 1450
23 Ga0070711_100707273 3300005439 Bacteria 849
24 Ga0070700_100074989 3300005441 Bacteria 2169
25 Ga0070662_100181061 3300005457 Bacteria 1661
26 Ga0070681_10013153 3300005458 Bacteria 8221
27 Ga0070681_10062219 3300005458 Bacteria 3706
28 Ga0068867_100797888 3300005459 Bacteria 842
29 Ga0070707_100218405 3300005468 Bacteria 1857
30 Ga0070707_100509086 3300005468 Bacteria 1166
31 Ga0070698_100040920 3300005471 Bacteria 4760
32 Ga0070698_100808117 3300005471 Unclassified 882
33 Ga0070699_100352718 3300005518 Bacteria 1325
34 Ga0070679_100041894 3300005530 Bacteria 4559
35 Ga0070679_100232547 3300005530 Bacteria 1802
36 Ga0070679_100832686 3300005530 Bacteria 866
37 Ga0070684_100058711 3300005535 Bacteria 3362
38 Ga0070684_100361682 3300005535 Bacteria 1335
39 Ga0070697_100551313 3300005536 Bacteria 1011
40 Ga0068853_100009079 3300005539 Bacteria 8005
41 Ga0070672_100279161 3300005543 Bacteria 1412
42 Ga0070665_101080099 3300005548 Unclassified 814
43 Ga0070664_100008069 3300005564 Bacteria 8508
44 Ga0070664_100383252 3300005564 Bacteria 1284
45 Ga0068856_100008601 3300005614 Bacteria 9925
46 Ga0070702_100079596 3300005615 Bacteria 1959
47 Ga0068852_100126226 3300005616 Bacteria 2350
48 Ga0068859_100204275 3300005617 Bacteria 2061
49 Ga0068864_100027598 3300005618 Bacteria 4796
50 Ga0068851_10074171 3300005834 Bacteria 1766
51 Ga0068863_100042639 3300005841 Bacteria 4312
52 Ga0081455_10039899 3300005937 Bacteria 4144
53 Ga0081455_10071013 3300005937 Bacteria 2888
54 Ga0081455_10071857 3300005937 Bacteria 2867
55 Ga0081455_10315651 3300005937 Bacteria 1115
56 Ga0081538_10000761 3300005981 Bacteria 35201
57 Ga0081540_1003583 3300005983 Bacteria 12200
58 Ga0081539_10014945 3300005985 Bacteria 5694
59 Ga0070717_10009832 3300006028 Bacteria 7203
60 Ga0070717_10035921 3300006028 Bacteria 4016
61 Ga0070717_10140445 3300006028 Bacteria 2083
62 Ga0070717_10803957 3300006028 Bacteria 855
63 Ga0075363_100043857 3300006048 Bacteria 2367
64 Ga0070712_100228870 3300006175 Bacteria 1475
65 Ga0070712_100298272 3300006175 Bacteria 1303
66 Ga0070712_100446818 3300006175 Bacteria 1076
67 Ga0068871_100018485 3300006358 Bacteria 5298
68 Ga0068871_100026839 3300006358 Bacteria 4498
69 Ga0075433_10507898 3300006852 Bacteria 1061
70 Ga0075433_10611419 3300006852 Bacteria 957
71 Ga0075433_10649852 3300006852 Bacteria 925
72 Ga0075434_100772291 3300006871 Bacteria 977
73 Ga0075429_100257220 3300006880 Bacteria 1529
74 Ga0075436_100723785 3300006914 Bacteria 738
75 Ga0097620_100204271 3300006931 Bacteria 2061
76 Ga0111539_10024110 3300009094 Bacteria 7472
77 Ga0111539_10623062 3300009094 Bacteria 1256
78 Ga0114129_10036935 3300009147 Bacteria 6897
79 Ga0114129_10253413 3300009147 Bacteria 2362
80 Ga0105243_10833515 3300009148 Bacteria 912
81 Ga0105242_10282513 3300009176 Bacteria 1508
82 Ga0105248_11374485 3300009177 Bacteria 799
83 Ga0105237_10000037 3300009545 Bacteria 190855
84 Ga0105238_10043677 3300009551 Bacteria 4534
85 Ga0105238_10064755 3300009551 Bacteria 3655
86 Ga0105238_11174761 3300009551 Bacteria 791
87 Ga0105249_10000964 3300009553 Bacteria 25455
88 Ga0105249_10346363 3300009553 Bacteria 1504
89 Ga0105239_10027692 3300010375 Bacteria 6235
90 Ga0157370_10020338 3300013104 Bacteria 6629
91 Ga0157370_10089508 3300013104 Bacteria 2891
92 Ga0157369_10027965 3300013105 Bacteria 6245
93 Ga0157369_10195005 3300013105 Bacteria 2127
94 Ga0157369_10324964 3300013105 Bacteria 1599
95 Ga0157374_10018752 3300013296 Bacteria 6113
96 Ga0157374_10171558 3300013296 Bacteria 2116
97 Ga0157378_10366324 3300013297 Bacteria 1412
98 Ga0157372_11517128 3300013307 Bacteria 772
99 Ga0157375_10591771 3300013308 Bacteria 1269
100 Ga0163163_10044510 3300014325 Bacteria 4355
101 Ga0163163_10083736 3300014325 Bacteria 3195
102 Ga0157376_10005320 3300014969 Bacteria 8988
103 Ga0163161_10185300 3300017792 Bacteria 1598
104 Ga0206356_10922965 3300020070 Bacteria 1097
105 Ga0213875_10082770 3300021388 Bacteria 1498
106 Ga0213875_10112676 3300021388 Bacteria 1270
107 Ga0213875_10133780 3300021388 Bacteria 1159
108 Ga0207647_10320843 3300025904 Unclassified 880
109 Ga0207645_10138280 3300025907 Bacteria 1587
110 Ga0207707_10098438 3300025912 Bacteria 2556
111 Ga0207695_10701526 3300025913 Bacteria 892
112 Ga0207671_10000129 3300025914 Bacteria 117585
113 Ga0207693_10009825 3300025915 Bacteria 7788
114 Ga0207693_10013930 3300025915 Bacteria 6475
115 Ga0207693_10200678 3300025915 Bacteria 1569
116 Ga0207663_10159044 3300025916 Bacteria 1592
117 Ga0207657_10252467 3300025919 Bacteria 1405
118 Ga0207652_10098022 3300025921 Bacteria 2585
119 Ga0207646_10182871 3300025922 Bacteria 1893
120 Ga0207646_10273278 3300025922 Bacteria 1527
121 Ga0207681_10036789 3300025923 Bacteria 3232
122 Ga0207650_10034256 3300025925 Bacteria 3682
123 Ga0207700_10019891 3300025928 Bacteria 4544
124 Ga0207700_10024608 3300025928 Bacteria 4169
125 Ga0207700_10055718 3300025928 Bacteria 2972
126 Ga0207700_10299980 3300025928 Bacteria 1387
127 Ga0207664_10016519 3300025929 Bacteria 5386
128 Ga0207664_10021802 3300025929 Bacteria 4773
129 Ga0207664_10084962 3300025929 Bacteria 2582
130 Ga0207664_10392493 3300025929 Bacteria 1233
131 Ga0207690_10060658 3300025932 Bacteria 2568
132 Ga0207706_10141486 3300025933 Bacteria 2117
133 Ga0207709_10562615 3300025935 Bacteria 898
134 Ga0207669_10351441 3300025937 Bacteria 1139
135 Ga0207665_10222392 3300025939 Bacteria 1384
136 Ga0207691_10282186 3300025940 Bacteria 1429
137 Ga0207661_10040694 3300025944 Bacteria 3655
138 Ga0207661_10177621 3300025944 Bacteria 1857
139 Ga0207661_10208996 3300025944 Bacteria 1719
140 Ga0207661_10504747 3300025944 Bacteria 1105
141 Ga0207679_10099481 3300025945 Bacteria 2271
142 Ga0207651_10011705 3300025960 Bacteria 4923
143 Ga0207678_10135012 3300026067 Bacteria 2105
144 Ga0207708_10048302 3300026075 Bacteria 3240
145 Ga0207708_10300158 3300026075 Bacteria 1306
146 Ga0207676_10591847 3300026095 Bacteria 1064
147 Ga0207674_10569147 3300026116 Bacteria 1095
148 Ga0207675_100760322 3300026118 Bacteria 981
149 Ga0207698_10254322 3300026142 Bacteria 1610
150 Ga0207428_10095751 3300027907 Bacteria 2299
151 Ga0207428_10128345 3300027907 Bacteria 1941
152 Ga0268266_10560829 3300028379 Bacteria 1095
153 Ga0268264_10225957 3300028381 Bacteria 1726
154 Ga0265338_10163830 3300028800 Bacteria 1714
155 Ga0265338_10261771 3300028800 Bacteria 1271
156 Ga0265760_10021390 3300031090 Bacteria 1872
157 Ga0265320_10025798 3300031240 Bacteria 3085
158 Ga0265339_10026196 3300031249 Bacteria 3341
159 Ga0307513_10007048 3300031456 Bacteria 14619
160 Ga0265314_10100880 3300031711 Bacteria 1856
161 Ga0307407_10509584 3300031903 Bacteria 883
162 Ga0373929_0040053 3300035085 Bacteria 1037
163 Ga0373934_0032175 3300035086 Bacteria 2056
164 Ga0373923_0035750 3300035111 Bacteria 2024
165 Ga0373953_0017550 3300035117 Bacteria 2633
166 Ga0373954_0010735 3300035118 Bacteria 4049
167 Ga0373954_0195871 3300035118 Bacteria 992
168 Ga0373957_0039769 3300035120 Bacteria 1765
169 Ga0373957_0056272 3300035120 Bacteria 1514
170 Ga0373957_0061102 3300035120 Bacteria 1459
171 Ga0373955_0006512 3300035172 Bacteria 5324
172 Ga0373955_0108332 3300035172 Bacteria 1604
173 Ga0373955_0132318 3300035172 Unclassified 1457
174 Ga0373924_0005610 3300035410 Bacteria 4451
175 Ga0373931_0000041 3300035691 Bacteria 72297
176 Ga0373931_0312474 3300035691 Bacteria 974
177 Ga0373935_0033063 3300035692 Bacteria 3218
178 Ga0373927_0083242 3300035695 Bacteria 2074
179 Ga0373927_0479329 3300035695 Bacteria 822
180 Ga0373933_0038067 3300035724 Bacteria 2825
181 Ga0373933_0054672 3300035724 Bacteria 2393
182 Ga0373933_0124626 3300035724 Bacteria 1616
183 Ga0373947_0338370 3300035725 Bacteria 1008
184 Ga0373937_0006547 3300036401 Bacteria 10060
185 Ga0373937_0046043 3300036401 Bacteria 3988
186 Ga0373937_0062398 3300036401 Bacteria 3427
187 Ga0373937_0116814 3300036401 Bacteria 2485
188 Ga0373937_1039951 3300036401 Unclassified 768
189 Ga0395899_0180466 3300037312 Unclassified 1482
190 Ga0395900_0058891 3300037418 Bacteria 3954
191 Ga0395898_0157578 3300037466 Unclassified 2171
192 Ga0436364_0057290 3300037853 Bacteria 2575
193 Ga0436364_0422992 3300037853 Bacteria 6671
194 Ga0436364_0678470 3300037853 Bacteria 1436
195 Ga0436364_0742501 3300037853 Bacteria 1710
196 Ga0436364_1381017 3300037853 Bacteria 9645
197 Ga0395901_0158729 3300038443 Bacteria 2375
198 Ga0395901_0184635 3300038443 Bacteria 2187
199 Ga0395901_0349269 3300038443 Unclassified 1526
200 Ga0395901_0459692 3300038443 Bacteria 1301
201 Ga0436365_1100293 3300039437 Bacteria 1111
202 Ga0436361_0137320 3300039447 Bacteria 1569
203 Ga0451793_1250367 3300041452 Bacteria 2363
204 Ga0451797_0542134 3300041453 Bacteria 1193
205 Ga0451841_1328848 3300041498 Bacteria 1653
206 Ga0451853_3818578 3300041512 Bacteria 1230
207 Ga0466969_0128188 3300044656 Bacteria 1177
208 Ga0466965_0304691 3300044683 Bacteria 865
209 Ga0466961_0010382 3300044693 Bacteria 5942
210 Ga0451576_0765087 3300045051 Bacteria 1014
211 Ga0466967_0133155 3300045976 Bacteria 2310
212 Ga0495627_022960 3300046453 Bacteria 2048
213 Ga0495592_0120490 3300046454 Bacteria 1846
214 Ga0495592_0187851 3300046454 Bacteria 1402
215 Ga0495592_0288594 3300046454 Bacteria 1070
216 Ga0495641_0104642 3300046461 Bacteria 1263
217 Ga0495651_0004322 3300046462 Bacteria 10884
218 Ga0495651_0006654 3300046462 Bacteria 8836
219 Ga0495651_0053593 3300046462 Bacteria 3104
220 Ga0495651_0495691 3300046462 Unclassified 783
221 Ga0495653_0007030 3300046463 Bacteria 9238
222 Ga0495653_0207248 3300046463 Bacteria 1326
223 Ga0495639_0214924 3300046475 Bacteria 944
224 Ga0495664_0028356 3300046477 Bacteria 3269
225 Ga0495664_0125073 3300046477 Bacteria 1555
226 Ga0495608_0004968 3300046511 Bacteria 9519
227 Ga0495608_0007911 3300046511 Bacteria 7470
228 Ga0495608_0080522 3300046511 Bacteria 2117
229 Ga0495618_0094770 3300046514 Bacteria 1908
230 Ga0495628_0030805 3300046516 Bacteria 4342
231 Ga0495628_0319655 3300046516 Bacteria 1145
232 Ga0495628_0479136 3300046516 Bacteria 901
233 Ga0495630_0044787 3300046517 Bacteria 3307
234 Ga0495630_0078124 3300046517 Bacteria 2496
235 Ga0495630_0696578 3300046517 Bacteria 777
236 Ga0495644_0117007 3300046523 Bacteria 1013
237 Ga0495663_0112792 3300046525 Bacteria 905
238 Ga0495652_0007133 3300046529 Bacteria 10311
239 Ga0495652_0125504 3300046529 Bacteria 2039
240 Ga0495652_0249270 3300046529 Bacteria 1317
241 Ga0495665_0053089 3300046531 Bacteria 2145
242 Ga0495640_0012977 3300046533 Bacteria 6349
243 Ga0495640_0044073 3300046533 Bacteria 3103
244 Ga0495640_0103008 3300046533 Bacteria 1872
245 Ga0495587_0004454 3300046536 Bacteria 9226
246 Ga0495645_0012494 3300046543 Bacteria 5984
247 Ga0495633_0228138 3300046558 Bacteria 852
248 Ga0495667_0000774 3300046559 Bacteria 20517
249 Ga0495667_0031458 3300046559 Bacteria 3562
250 Ga0495656_0258877 3300046615 Bacteria 881
251 Ga0495634_0066150 3300046642 Bacteria 2393
252 Ga0495635_0033236 3300046663 Bacteria 3577
253 Ga0495635_0042313 3300046663 Bacteria 3145
254 Ga0495635_0048450 3300046663 Bacteria 2929
255 Ga0495657_0005161 3300046675 Bacteria 10345
256 Ga0495657_0053410 3300046675 Bacteria 2704
257 Ga0495599_0032940 3300046678 Bacteria 3254
258 Ga0495599_0040252 3300046678 Bacteria 2935
259 Ga0495623_0160591 3300046679 Bacteria 1321
260 Ga0495623_0255107 3300046679 Bacteria 985
261 Ga0495646_0024446 3300046680 Bacteria 3804
262 Ga0495646_0312265 3300046680 Bacteria 830
263 Ga0495613_0204195 3300046689 Bacteria 1392
264 Ga0495624_0214568 3300046690 Bacteria 1167
265 Ga0495624_0352432 3300046690 Bacteria 885
266 Ga0495600_0029986 3300046809 Bacteria 3523
267 Ga0495600_0227740 3300046809 Bacteria 1191
268 Ga0495604_0003346 3300047317 Bacteria 12779
269 Ga0495604_0124780 3300047317 Bacteria 1858
270 Ga0495604_0375636 3300047317 Bacteria 940
271 Ga0495674_0001752 3300047319 Bacteria 21368
272 Ga0495674_0007586 3300047319 Bacteria 10365
273 Ga0495674_0120882 3300047319 Bacteria 2213
274 Ga0495674_0167131 3300047319 Bacteria 1837
275 Ga0495676_0086249 3300047321 Bacteria 2363
276 Ga0495680_0001798 3300047322 Bacteria 22690
277 Ga0495675_0036090 3300047444 Bacteria 3155
278 Ga0495675_0069084 3300047444 Bacteria 2231
279 Ga0495684_0005201 3300047471 Bacteria 10141
280 Ga0495684_0038025 3300047471 Bacteria 3691
281 Ga0495602_0050540 3300048088 Bacteria 3713
282 Ga0495602_0106134 3300048088 Bacteria 2293
283 Ga0496100_0042619 3300048903 Unclassified 2899
284 Ga0496100_0539382 3300048903 Bacteria 902
285 Ga0496101_0046384 3300048904 Bacteria 3116
286 Ga0496102_0012164 3300048905 Bacteria 7440
287 Ga0496102_0057070 3300048905 Bacteria 3563
288 Ga0496103_0078848 3300048906 Unclassified 2069
289 Ga0496104_0017256 3300048907 Bacteria 6570
290 Ga0496104_0622685 3300048907 Bacteria 989
291 Ga0496105_0004920 3300048908 Bacteria 10101
292 Ga0496107_0052161 3300048910 Bacteria 2950
293 Ga0496107_0082711 3300048910 Bacteria 2341
294 Ga0496108_0104861 3300048911 Bacteria 2413
295 Ga0496109_0025145 3300048912 Bacteria 5303
296 Ga0496109_0103365 3300048912 Bacteria 2644
297 Ga0496109_0106441 3300048912 Bacteria 2605
298 Ga0496109_0571951 3300048912 Bacteria 1065
299 Ga0496110_0077295 3300048913 Bacteria 2961
300 Ga0496111_0011344 3300048914 Bacteria 6000
301 Ga0496111_0310724 3300048914 Unclassified 1168
302 Ga0496112_0186587 3300048915 Bacteria 2037
303 Ga0496112_0577484 3300048915 Bacteria 1057
304 Ga0496112_0589716 3300048915 Bacteria 1044
305 Ga0496113_0666149 3300048916 Bacteria 832
306 Ga0496114_0011574 3300048917 Bacteria 7050
307 Ga0496115_0037598 3300048918 Bacteria 3837
308 Ga0496115_0052235 3300048918 Bacteria 3279
309 Ga0496115_0117273 3300048918 Bacteria 2190
310 Ga0496115_0301221 3300048918 Bacteria 1314
311 Ga0496115_0755474 3300048918 Bacteria 760
312 Ga0496126_0115054 3300048929 Bacteria 2339
313 Ga0496126_0118614 3300048929 Bacteria 2297
314 Ga0501031_0000626 3300049568 Bacteria 20896
315 Ga0501032_0000242 3300049569 Bacteria 45220
316 Ga0501033_0000436 3300049570 Bacteria 40039
317 Ga0501034_0002702 3300049571 Bacteria 20883
318 Ga0501036_0001869 3300049572 Bacteria 16326
319 Ga0501037_0001390 3300049573 Bacteria 17748
320 Ga0501038_0000410 3300049574 Bacteria 37104
321 Ga0501039_0000818 3300049575 Bacteria 22434
322 Ga0501042_0351309 3300049578 Bacteria 1066
323 Ga0501043_0003532 3300049579 Bacteria 12849
324 Ga0501046_0001865 3300049580 Bacteria 20059
325 Ga0501047_0003101 3300049581 Bacteria 15772
326 Ga0501048_0000188 3300049582 Bacteria 39628
327 Ga0501067_0033438 3300049583 Bacteria 2853
328 Ga0501069_0032085 3300049585 Bacteria 2891
329 Ga0501070_0000445 3300049586 Bacteria 37672
330 Ga0501072_0001238 3300049588 Bacteria 19059
331 Ga0501072_0356579 3300049588 Bacteria 1161
332 Ga0501073_0007377 3300049589 Bacteria 8174
333 Ga0501073_0020870 3300049589 Bacteria 4724
334 Ga0501074_0016891 3300049590 Bacteria 5295
335 Ga0501076_0146810 3300049592 Bacteria 1918
336 Ga0501079_0338202 3300049741 Bacteria 1179
337 Ga0501080_0000503 3300049742 Bacteria 30704
338 Ga0501083_0013575 3300049744 Bacteria 5695
339 Ga0501035_0007658 3300049822 Bacteria 10089
340 Ga0501044_0002644 3300049823 Bacteria 20387
341 nmdc:mga03n38_274365_c1 3300050490 Bacteria 898
342 nmdc:mga00v17_397587_c1 3300050491 Bacteria 895
343 nmdc:mga04h51_138107_c1 3300050495 Bacteria 922
344 nmdc:mga05p37_150868_c1 3300050507 Unclassified 2843
345 nmdc:mga05p37_30579_c1 3300050507 Bacteria 4884
346 nmdc:mga05p37_996568_c1 3300050507 Bacteria 890
347 nmdc:mga08y16_20392_c1 3300050511 Bacteria 6996
348 nmdc:mga08y16_527892_c1 3300050511 Bacteria 1196
349 nmdc:mga08y16_843629_c1 3300050511 Bacteria 906
350 nmdc:mga0n895_567188_c1 3300050512 Bacteria 1140
351 nmdc:mga0rr50_333585_c1 3300050513 Unclassified 1273
352 nmdc:mga0a205_338176_c1 3300050515 Bacteria 1374
353 nmdc:mga0a205_371075_c1 3300050515 Bacteria 1297
354 Ga0495601_0058549 3300053077 Bacteria 2442
355 Ga0495601_0258823 3300053077 Bacteria 1136
356 Ga0495612_0013404 3300053078 Bacteria 3302
357 Ga0495595_0121954 3300053084 Bacteria 1270
358 Ga0495595_0143891 3300053084 Unclassified 1171
359 Ga0495595_0183180 3300053084 Bacteria 1039
360 Ga0495619_0014455 3300053085 Bacteria 4986
361 Ga0495619_0196064 3300053085 Unclassified 1398
362 Ga0495619_0275523 3300053085 Bacteria 1166
363 Ga0495619_0332636 3300053085 Bacteria 1051
364 Ga0500568_0001682 3300053139 Bacteria 13802
365 Ga0500568_0016079 3300053139 Bacteria 3334
366 Ga0500577_0002984 3300053142 Bacteria 4362
367 Ga0500616_0000763 3300053153 Bacteria 37050
368 Ga0501084_0000310 3300054114 Bacteria 37009
369 Ga0501082_0019828 3300060353 Bacteria 5799
370 Ga0501082_0505008 3300060353 Unclassified 1057
371 2515856452 2515154155 Bacteria 7985436
372 2676476597 2675903058 Bacteria 6822861
373 2816424405 2816332119 Bacteria 8120218
374 2827630677 2827628540 Bacteria 6858585
375 2857454598 2857453340 Bacteria 8090534
376 2889049370 2889049205 Bacteria 7524325
377 3006985110 3006984091 Bacteria 4207523
378 JGI24739J22299_10023753
379 rootH1_10149529
380 Ga0070683_100017574
381 Ga0070683_100102660
382 Ga0070670_100059193
383 Ga0070670_100089457
384 Ga0070682_100154478
385 Ga0068868_100067016
386 Ga0070660_100306832
387 Ga0070692_10396583
388 Ga0070673_100474037
389 Ga0070659_100474818
390 Ga0070714_100010589
391 Ga0070714_100060395
392 Ga0070714_100130758
393 Ga0070714_100265178
394 Ga0070713_100016662
395 Ga0070713_100033201
396 Ga0070713_100054665
397 Ga0070713_100578689
398 Ga0070711_100014194
399 Ga0070711_100228615
400 Ga0070711_100707273
401 Ga0070700_100074989
402 Ga0070662_100181061
403 Ga0070681_10013153
404 Ga0070681_10062219
405 Ga0068867_100797888
406 Ga0070707_100218405
407 Ga0070707_100509086
408 Ga0070698_100040920
409 Ga0070698_100808117
410 Ga0070699_100352718
411 Ga0070679_100041894
412 Ga0070679_100232547
413 Ga0070679_100832686
414 Ga0070684_100058711
415 Ga0070684_100361682
416 Ga0070697_100551313
417 Ga0068853_100009079
418 Ga0070672_100279161
419 Ga0070665_101080099
420 Ga0070664_100008069
421 Ga0070664_100383252
422 Ga0068856_100008601
423 Ga0070702_100079596
424 Ga0068852_100126226
425 Ga0068859_100204275
426 Ga0068864_100027598
427 Ga0068851_10074171
428 Ga0068863_100042639
429 Ga0081455_10039899
430 Ga0081455_10071013
431 Ga0081455_10071857
432 Ga0081455_10315651
433 Ga0081538_10000761
434 Ga0081540_1003583
435 Ga0081539_10014945
436 Ga0070717_10009832
437 Ga0070717_10035921
438 Ga0070717_10140445
439 Ga0070717_10803957
440 Ga0075363_100043857
441 Ga0070712_100228870
442 Ga0070712_100298272
443 Ga0070712_100446818
444 Ga0068871_100018485
445 Ga0068871_100026839
446 Ga0075433_10507898
447 Ga0075433_10611419
448 Ga0075433_10649852
449 Ga0075434_100772291
450 Ga0075429_100257220
451 Ga0075436_100723785
452 Ga0097620_100204271
453 Ga0111539_10024110
454 Ga0111539_10623062
455 Ga0114129_10036935
456 Ga0114129_10253413
457 Ga0105243_10833515
458 Ga0105242_10282513
459 Ga0105248_11374485
460 Ga0105237_10000037
461 Ga0105238_10043677
462 Ga0105238_10064755
463 Ga0105238_11174761
464 Ga0105249_10000964
465 Ga0105249_10346363
466 Ga0105239_10027692
467 Ga0157370_10020338
468 Ga0157370_10089508
469 Ga0157369_10027965
470 Ga0157369_10195005
471 Ga0157369_10324964
472 Ga0157374_10018752
473 Ga0157374_10171558
474 Ga0157378_10366324
475 Ga0157372_11517128
476 Ga0157375_10591771
477 Ga0163163_10044510
478 Ga0163163_10083736
479 Ga0157376_10005320
480 Ga0163161_10185300
481 Ga0206356_10922965
482 Ga0213875_10082770
483 Ga0213875_10112676
484 Ga0213875_10133780
485 Ga0207647_10320843
486 Ga0207645_10138280
487 Ga0207707_10098438
488 Ga0207695_10701526
489 Ga0207671_10000129
490 Ga0207693_10009825
491 Ga0207693_10013930
492 Ga0207693_10200678
493 Ga0207663_10159044
494 Ga0207657_10252467
495 Ga0207652_10098022
496 Ga0207646_10182871
497 Ga0207646_10273278
498 Ga0207681_10036789
499 Ga0207650_10034256
500 Ga0207700_10019891
501 Ga0207700_10024608
502 Ga0207700_10055718
503 Ga0207700_10299980
504 Ga0207664_10016519
505 Ga0207664_10021802
506 Ga0207664_10084962
507 Ga0207664_10392493
508 Ga0207690_10060658
509 Ga0207706_10141486
510 Ga0207709_10562615
511 Ga0207669_10351441
512 Ga0207665_10222392
513 Ga0207691_10282186
514 Ga0207661_10040694
515 Ga0207661_10177621
516 Ga0207661_10208996
517 Ga0207661_10504747
518 Ga0207679_10099481
519 Ga0207651_10011705
520 Ga0207678_10135012
521 Ga0207708_10048302
522 Ga0207708_10300158
523 Ga0207676_10591847
524 Ga0207674_10569147
525 Ga0207675_100760322
526 Ga0207698_10254322
527 Ga0207428_10095751
528 Ga0207428_10128345
529 Ga0268266_10560829
530 Ga0268264_10225957
531 Ga0265338_10163830
532 Ga0265338_10261771
533 Ga0265760_10021390
534 Ga0265320_10025798
535 Ga0265339_10026196
536 Ga0307513_10007048
537 Ga0265314_10100880
538 Ga0307407_10509584
539 Ga0373929_0040053
540 Ga0373934_0032175
541 Ga0373923_0035750
542 Ga0373953_0017550
543 Ga0373954_0010735
544 Ga0373954_0195871
545 Ga0373957_0039769
546 Ga0373957_0056272
547 Ga0373957_0061102
548 Ga0373955_0006512
549 Ga0373955_0108332
550 Ga0373955_0132318
551 Ga0373924_0005610
552 Ga0373931_0000041
553 Ga0373931_0312474
554 Ga0373935_0033063
555 Ga0373927_0083242
556 Ga0373927_0479329
557 Ga0373933_0038067
558 Ga0373933_0054672
559 Ga0373933_0124626
560 Ga0373947_0338370
561 Ga0373937_0006547
562 Ga0373937_0046043
563 Ga0373937_0062398
564 Ga0373937_0116814
565 Ga0373937_1039951
566 Ga0395899_0180466
567 Ga0395900_0058891
568 Ga0395898_0157578
569 Ga0436364_0057290
570 Ga0436364_0422992
571 Ga0436364_0678470
572 Ga0436364_0742501
573 Ga0436364_1381017
574 Ga0395901_0158729
575 Ga0395901_0184635
576 Ga0395901_0349269
577 Ga0395901_0459692
578 Ga0436365_1100293
579 Ga0436361_0137320
580 Ga0451793_1250367
581 Ga0451797_0542134
582 Ga0451841_1328848
583 Ga0451853_3818578
584 Ga0466969_0128188
585 Ga0466965_0304691
586 Ga0466961_0010382
587 Ga0451576_0765087
588 Ga0466967_0133155
589 Ga0495627_022960
590 Ga0495592_0120490
591 Ga0495592_0187851
592 Ga0495592_0288594
593 Ga0495641_0104642
594 Ga0495651_0004322
595 Ga0495651_0006654
596 Ga0495651_0053593
597 Ga0495651_0495691
598 Ga0495653_0007030
599 Ga0495653_0207248
600 Ga0495639_0214924
601 Ga0495664_0028356
602 Ga0495664_0125073
603 Ga0495608_0004968
604 Ga0495608_0007911
605 Ga0495608_0080522
606 Ga0495618_0094770
607 Ga0495628_0030805
608 Ga0495628_0319655
609 Ga0495628_0479136
610 Ga0495630_0044787
611 Ga0495630_0078124
612 Ga0495630_0696578
613 Ga0495644_0117007
614 Ga0495663_0112792
615 Ga0495652_0007133
616 Ga0495652_0125504
617 Ga0495652_0249270
618 Ga0495665_0053089
619 Ga0495640_0012977
620 Ga0495640_0044073
621 Ga0495640_0103008
622 Ga0495587_0004454
623 Ga0495645_0012494
624 Ga0495633_0228138
625 Ga0495667_0000774
626 Ga0495667_0031458
627 Ga0495656_0258877
628 Ga0495634_0066150
629 Ga0495635_0033236
630 Ga0495635_0042313
631 Ga0495635_0048450
632 Ga0495657_0005161
633 Ga0495657_0053410
634 Ga0495599_0032940
635 Ga0495599_0040252
636 Ga0495623_0160591
637 Ga0495623_0255107
638 Ga0495646_0024446
639 Ga0495646_0312265
640 Ga0495613_0204195
641 Ga0495624_0214568
642 Ga0495624_0352432
643 Ga0495600_0029986
644 Ga0495600_0227740
645 Ga0495604_0003346
646 Ga0495604_0124780
647 Ga0495604_0375636
648 Ga0495674_0001752
649 Ga0495674_0007586
650 Ga0495674_0120882
651 Ga0495674_0167131
652 Ga0495676_0086249
653 Ga0495680_0001798
654 Ga0495675_0036090
655 Ga0495675_0069084
656 Ga0495684_0005201
657 Ga0495684_0038025
658 Ga0495602_0050540
659 Ga0495602_0106134
660 Ga0496100_0042619
661 Ga0496100_0539382
662 Ga0496101_0046384
663 Ga0496102_0012164
664 Ga0496102_0057070
665 Ga0496103_0078848
666 Ga0496104_0017256
667 Ga0496104_0622685
668 Ga0496105_0004920
669 Ga0496107_0052161
670 Ga0496107_0082711
671 Ga0496108_0104861
672 Ga0496109_0025145
673 Ga0496109_0103365
674 Ga0496109_0106441
675 Ga0496109_0571951
676 Ga0496110_0077295
677 Ga0496111_0011344
678 Ga0496111_0310724
679 Ga0496112_0186587
680 Ga0496112_0577484
681 Ga0496112_0589716
682 Ga0496113_0666149
683 Ga0496114_0011574
684 Ga0496115_0037598
685 Ga0496115_0052235
686 Ga0496115_0117273
687 Ga0496115_0301221
688 Ga0496115_0755474
689 Ga0496126_0115054
690 Ga0496126_0118614
691 Ga0501031_0000626
692 Ga0501032_0000242
693 Ga0501033_0000436
694 Ga0501034_0002702
695 Ga0501036_0001869
696 Ga0501037_0001390
697 Ga0501038_0000410
698 Ga0501039_0000818
699 Ga0501042_0351309
700 Ga0501043_0003532
701 Ga0501046_0001865
702 Ga0501047_0003101
703 Ga0501048_0000188
704 Ga0501067_0033438
705 Ga0501069_0032085
706 Ga0501070_0000445
707 Ga0501072_0001238
708 Ga0501072_0356579
709 Ga0501073_0007377
710 Ga0501073_0020870
711 Ga0501074_0016891
712 Ga0501076_0146810
713 Ga0501079_0338202
714 Ga0501080_0000503
715 Ga0501083_0013575
716 Ga0501035_0007658
717 Ga0501044_0002644
718 nmdc:mga03n38_274365_c1
719 nmdc:mga00v17_397587_c1
720 nmdc:mga04h51_138107_c1
721 nmdc:mga05p37_150868_c1
722 nmdc:mga05p37_30579_c1
723 nmdc:mga05p37_996568_c1
724 nmdc:mga08y16_20392_c1
725 nmdc:mga08y16_527892_c1
726 nmdc:mga08y16_843629_c1
727 nmdc:mga0n895_567188_c1
728 nmdc:mga0rr50_333585_c1
729 nmdc:mga0a205_338176_c1
730 nmdc:mga0a205_371075_c1
731 Ga0495601_0058549
732 Ga0495601_0258823
733 Ga0495612_0013404
734 Ga0495595_0121954
735 Ga0495595_0143891
736 Ga0495595_0183180
737 Ga0495619_0014455
738 Ga0495619_0196064
739 Ga0495619_0275523
740 Ga0495619_0332636
741 Ga0500568_0001682
742 Ga0500568_0016079
743 Ga0500577_0002984
744 Ga0500616_0000763
745 Ga0501084_0000310
746 Ga0501082_0019828
747 Ga0501082_0505008
748 2515856452
749 2676476597
750 2816424405
751 2827630677
752 2857454598
753 2889049370
754 3006985110

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00756

Esterase

Putative esterase

61

259

0.65

Structural Annotation

Top 5 Hits

ID Description Score Start End
3c8h-assembly2.cif.gz_B crystal structure of the enterobactin esterase fes from shigella flexneri in the presence of 2,3-di-hydroxy-n-benzoyl-serine 0.781 8 214
3c8d-assembly5.cif.gz_A crystal structure of the enterobactin esterase fes from shigella flexneri in the presence of 2,3-di-hydroxy-n-benzoyl-glycine 0.7691 7 212
3c87-assembly3.cif.gz_A crystal structure of the enterobactin esterase fes from shigella flexneri in the presence of enterobactin 0.7606 1 212
7xrv-assembly1.cif.gz_H bacteroides thetaiotaomicron ferulic acid esterase - s150a (bt_4077-s150a) complex with trans-methylferulate 0.7584 6 216
7xrt-assembly1.cif.gz_I bacteroides thetaiotaomicron ferulic acid esterase (bt_4077) 0.7526 6 216
ID Description Score Start End Superfamily
af_Q2FZQ0_2_248_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8411 7 218 3.40.50.1820
af_Q2FZQ0_2_248_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8163 7 218 3.40.50.1820
af_O01862_163_451_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7641 117 200 3.40.50.1820
af_P31471_131_389_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.764 1 218 3.40.50.1820
af_P31471_131_389_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.761 1 218 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A4R0J5L9-F1-model_v4 Esterase 0.9973 6 216
AF-A0A1H8IY92-F1-model_v4 Enterochelin esterase 0.9941 3 218
AF-A0A1H2AVK0-F1-model_v4 Putative esterase 0.9921 73 218
AF-A0A6J4LWG3-F1-model_v4 Esterase 0.9853 2 215
AF-A0A4R0J5L9-F1-model_v4 Esterase 0.9788 6 216

Map