F427743

General Info

Members Datasets Scaffolds Average Seq Length
377 214 376 218

Family's Representative Sequence

Representative Sequence 3300032126|Ga0307415_100319957|Ga0307415_1003199571
Length 259
Sequence LKGARDTLIAAAHGVRRTSEPEGGITLRGLPDLFANNRRWAANHVARDPAFFSRLAAQQVPAYLWIGCADSRVPANEIVDLLPGELFVHRNVANVVVHTDLNCLSVLQFAVDVLRVRHVIVCGHYGCGGVRAALEGARLGLIDNWLRHVQDVRAKYPGAVDAAPDAAARLDRLCELNVLEQAVHVCETTIVQDAWERGQPLAVHGWIYRLEDGLLRDLGFCVTAADEVQPSLDGALRVLESGGADPGVPSGACEADSGG

Samples

Sample ID Description Type Environment
1 2916178963 Pseudoalteromonas rhizosphaerae RA15 Isolate Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
33 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
34 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
35 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
36 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
41 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
42 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
43 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
44 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
45 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
46 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
47 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
48 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
54 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
55 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
56 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
57 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
58 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
59 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
60 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
61 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
62 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
63 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
64 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
65 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
66 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
67 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
68 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
69 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
113 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
114 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
115 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
116 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
117 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
118 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
119 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
120 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
121 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
122 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
123 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
124 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
125 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
126 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
127 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
128 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
129 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
130 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
131 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
132 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
133 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
134 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
135 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
136 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
137 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
138 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
139 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
140 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
141 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
142 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
143 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
144 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
145 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
146 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
147 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
148 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
149 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
150 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
151 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
152 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
153 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
154 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
155 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
156 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
157 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
158 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
159 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
160 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
161 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
162 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
163 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
164 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
165 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
166 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
167 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
168 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
169 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
170 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
171 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
172 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
173 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
174 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
175 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
176 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
191 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
192 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
193 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
194 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
195 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
196 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
197 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
198 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
199 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
200 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
201 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
202 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
204 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
205 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
206 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
207 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
208 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
209 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
210 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
211 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
212 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
213 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
214 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.73
Metatranscriptomes 0
Isolates 0.27

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.33
Nodule 0
Rhizoplane 1.33
Rhizosphere 95.76
Stem 0
Stem Tuber 0
Unclassified 1.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10017327 3300003323 Bacteria 10347
2 Ga0070658_10007570 3300005327 Bacteria 8762
3 Ga0070658_10020621 3300005327 Bacteria 5281
4 Ga0070676_10003650 3300005328 Bacteria 8053
5 Ga0070670_100089393 3300005331 Bacteria 2647
6 Ga0070670_100342424 3300005331 Bacteria 1313
7 Ga0070670_100346769 3300005331 Bacteria 1304
8 Ga0070670_100415678 3300005331 Bacteria 1188
9 Ga0070670_100607313 3300005331 Bacteria 979
10 Ga0068869_100064337 3300005334 Bacteria 2697
11 Ga0070682_100692815 3300005337 Bacteria 816
12 Ga0070660_100022501 3300005339 Bacteria 4662
13 Ga0070660_100272154 3300005339 Bacteria 1384
14 Ga0070660_100479013 3300005339 Bacteria 1034
15 Ga0070689_100221422 3300005340 Bacteria 1552
16 Ga0070687_100013187 3300005343 Bacteria 3674
17 Ga0070692_10229866 3300005345 Bacteria 1101
18 Ga0070668_100040923 3300005347 Bacteria 3548
19 Ga0070668_100137837 3300005347 Bacteria 1964
20 Ga0070675_100016074 3300005354 Bacteria 5931
21 Ga0070675_100028820 3300005354 Bacteria 4472
22 Ga0070675_100114547 3300005354 Bacteria 2285
23 Ga0070671_100074503 3300005355 Bacteria 2836
24 Ga0070674_100045539 3300005356 Bacteria 2998
25 Ga0070674_100186015 3300005356 Bacteria 1594
26 Ga0070688_100197801 3300005365 Bacteria 1404
27 Ga0070659_100713214 3300005366 Bacteria 868
28 Ga0070667_100237315 3300005367 Bacteria 1627
29 Ga0070667_100242479 3300005367 Bacteria 1610
30 Ga0070667_100323923 3300005367 Bacteria 1391
31 Ga0070714_100222545 3300005435 Bacteria 1735
32 Ga0070663_100095815 3300005455 Bacteria 2206
33 Ga0070662_100416561 3300005457 Bacteria 1111
34 Ga0070681_10019367 3300005458 Bacteria 6811
35 Ga0070681_10062206 3300005458 Bacteria 3706
36 Ga0068867_100726215 3300005459 Bacteria 879
37 Ga0070679_100017076 3300005530 Bacteria 7015
38 Ga0070679_100021305 3300005530 Bacteria 6326
39 Ga0070679_100156302 3300005530 Bacteria 2255
40 Ga0068853_100017949 3300005539 Bacteria 5847
41 Ga0070672_100064295 3300005543 Bacteria 2899
42 Ga0070672_100264950 3300005543 Bacteria 1450
43 Ga0070686_100032483 3300005544 Bacteria 3201
44 Ga0070665_100412138 3300005548 Bacteria 1360
45 Ga0068855_100070903 3300005563 Bacteria 4053
46 Ga0068855_100738638 3300005563 Bacteria 1050
47 Ga0068854_100122712 3300005578 Bacteria 1975
48 Ga0068852_100042154 3300005616 Bacteria 3863
49 Ga0068852_100254969 3300005616 Bacteria 1682
50 Ga0068852_100409983 3300005616 Bacteria 1335
51 Ga0068859_100665320 3300005617 Bacteria 1133
52 Ga0068864_100015213 3300005618 Bacteria 6400
53 Ga0068866_10028826 3300005718 Bacteria 2648
54 Ga0068851_10145992 3300005834 Bacteria 1290
55 Ga0068870_10030740 3300005840 Bacteria 2716
56 Ga0068863_100013000 3300005841 Bacteria 8027
57 Ga0068863_100023675 3300005841 Bacteria 5860
58 Ga0068863_100244957 3300005841 Bacteria 1731
59 Ga0068858_100473668 3300005842 Bacteria 1208
60 Ga0068858_100483614 3300005842 Bacteria 1195
61 Ga0068860_100066906 3300005843 Bacteria 3414
62 Ga0068860_100152529 3300005843 Bacteria 2225
63 Ga0068860_100185563 3300005843 Bacteria 2011
64 Ga0070712_100686099 3300006175 Bacteria 872
65 Ga0075367_10115416 3300006178 Bacteria 1651
66 Ga0075370_10447768 3300006353 Bacteria 777
67 Ga0068871_100249592 3300006358 Bacteria 1545
68 Ga0068871_100410377 3300006358 Unclassified 1208
69 Ga0075431_100283870 3300006847 Bacteria 1676
70 Ga0075434_100000519 3300006871 Bacteria 29333
71 Ga0075434_100057172 3300006871 Bacteria 3877
72 Ga0075429_100578461 3300006880 Bacteria 984
73 Ga0075429_100589898 3300006880 Bacteria 974
74 Ga0068865_100064548 3300006881 Bacteria 2577
75 Ga0075436_100041538 3300006914 Bacteria 3174
76 Ga0075436_100214458 3300006914 Bacteria 1365
77 Ga0097620_100665269 3300006931 Bacteria 1133
78 Ga0075435_100004741 3300007076 Bacteria 9387
79 Ga0075435_100184432 3300007076 Bacteria 1765
80 Ga0105240_10097365 3300009093 Bacteria 3585
81 Ga0105240_10401173 3300009093 Bacteria 1544
82 Ga0111539_10370318 3300009094 Bacteria 1667
83 Ga0105243_10244150 3300009148 Bacteria 1600
84 Ga0105238_10267062 3300009551 Bacteria 1691
85 Ga0105239_10306295 3300010375 Bacteria 1790
86 Ga0105246_10287215 3300011119 Bacteria 1322
87 Ga0157371_10160843 3300013102 Bacteria 1604
88 Ga0157370_10007970 3300013104 Bacteria 11476
89 Ga0157370_10171714 3300013104 Bacteria 2015
90 Ga0157370_10627896 3300013104 Bacteria 983
91 Ga0157370_10685873 3300013104 Bacteria 935
92 Ga0157374_10018471 3300013296 Bacteria 6155
93 Ga0157374_10142079 3300013296 Bacteria 2331
94 Ga0157378_10082122 3300013297 Bacteria 2914
95 Ga0157378_10099954 3300013297 Bacteria 2647
96 Ga0157378_10192629 3300013297 Bacteria 1924
97 Ga0163162_10000800 3300013306 Bacteria 29265
98 Ga0163162_10366989 3300013306 Bacteria 1573
99 Ga0157372_10008534 3300013307 Bacteria 10879
100 Ga0157372_10038324 3300013307 Bacteria 5289
101 Ga0157372_10079343 3300013307 Bacteria 3712
102 Ga0157372_11014388 3300013307 Bacteria 961
103 Ga0157375_10017927 3300013308 Bacteria 6407
104 Ga0157375_10257475 3300013308 Bacteria 1906
105 Ga0157375_10450886 3300013308 Bacteria 1452
106 Ga0163163_10019701 3300014325 Bacteria 6340
107 Ga0163163_10029469 3300014325 Bacteria 5280
108 Ga0163163_10761328 3300014325 Bacteria 1032
109 Ga0163163_11323906 3300014325 Bacteria 782
110 Ga0157377_10404554 3300014745 Bacteria 931
111 Ga0157379_10470306 3300014968 Bacteria 1162
112 Ga0157376_10275528 3300014969 Bacteria 1582
113 Ga0213875_10033007 3300021388 Bacteria 2445
114 Ga0207682_10001086 3300025893 Bacteria 12557
115 Ga0207688_10018108 3300025901 Bacteria 3834
116 Ga0207688_10035432 3300025901 Bacteria 2765
117 Ga0207688_10045896 3300025901 Bacteria 2438
118 Ga0207645_10006480 3300025907 Bacteria 8397
119 Ga0207645_10059991 3300025907 Bacteria 2429
120 Ga0207705_10260235 3300025909 Bacteria 1325
121 Ga0207705_10427624 3300025909 Bacteria 1026
122 Ga0207705_10433939 3300025909 Bacteria 1018
123 Ga0207705_10561244 3300025909 Bacteria 887
124 Ga0207654_10001770 3300025911 Bacteria 11224
125 Ga0207707_10030601 3300025912 Bacteria 4709
126 Ga0207707_10120918 3300025912 Bacteria 2289
127 Ga0207707_10723826 3300025912 Bacteria 834
128 Ga0207695_10007879 3300025913 Bacteria 13444
129 Ga0207695_10117630 3300025913 Bacteria 2630
130 Ga0207695_10356108 3300025913 Bacteria 1350
131 Ga0207663_10596215 3300025916 Bacteria 868
132 Ga0207662_10007644 3300025918 Bacteria 5891
133 Ga0207657_10007338 3300025919 Bacteria 11308
134 Ga0207657_10372188 3300025919 Bacteria 1126
135 Ga0207657_10406188 3300025919 Bacteria 1071
136 Ga0207649_10120833 3300025920 Bacteria 1766
137 Ga0207652_10019793 3300025921 Bacteria 5541
138 Ga0207652_10137449 3300025921 Bacteria 2183
139 Ga0207681_10093563 3300025923 Bacteria 2152
140 Ga0207681_10274828 3300025923 Bacteria 1324
141 Ga0207694_10027014 3300025924 Bacteria 4370
142 Ga0207694_10586922 3300025924 Bacteria 937
143 Ga0207650_10048957 3300025925 Bacteria 3119
144 Ga0207650_10179206 3300025925 Bacteria 1688
145 Ga0207659_10070196 3300025926 Bacteria 2554
146 Ga0207659_10129174 3300025926 Bacteria 1947
147 Ga0207659_10538509 3300025926 Bacteria 991
148 Ga0207700_10207088 3300025928 Bacteria 1656
149 Ga0207664_10102410 3300025929 Bacteria 2367
150 Ga0207664_10442376 3300025929 Bacteria 1159
151 Ga0207644_10096793 3300025931 Bacteria 2210
152 Ga0207644_10524710 3300025931 Bacteria 979
153 Ga0207706_10011714 3300025933 Bacteria 7996
154 Ga0207709_10032848 3300025935 Bacteria 3042
155 Ga0207670_10663556 3300025936 Bacteria 861
156 Ga0207669_10224958 3300025937 Bacteria 1380
157 Ga0207691_10016364 3300025940 Bacteria 7040
158 Ga0207691_10032086 3300025940 Bacteria 4900
159 Ga0207691_10047475 3300025940 Bacteria 3940
160 Ga0207691_10159286 3300025940 Bacteria 1981
161 Ga0207711_10113877 3300025941 Bacteria 2408
162 Ga0207689_10006304 3300025942 Bacteria 10506
163 Ga0207667_10072824 3300025949 Bacteria 3571
164 Ga0207651_10293138 3300025960 Bacteria 1350
165 Ga0207640_10066389 3300025981 Bacteria 2410
166 Ga0207658_10109329 3300025986 Bacteria 2182
167 Ga0207658_10124189 3300025986 Bacteria 2063
168 Ga0207703_10247367 3300026035 Bacteria 1605
169 Ga0207639_10013104 3300026041 Bacteria 5791
170 Ga0207639_10067519 3300026041 Bacteria 2782
171 Ga0207639_10398183 3300026041 Bacteria 1240
172 Ga0207678_10463677 3300026067 Bacteria 1102
173 Ga0207708_10054476 3300026075 Bacteria 3049
174 Ga0207702_10029005 3300026078 Bacteria 4602
175 Ga0207641_10009616 3300026088 Bacteria 7968
176 Ga0207641_10157229 3300026088 Bacteria 2063
177 Ga0207641_10305588 3300026088 Bacteria 1504
178 Ga0207641_10490742 3300026088 Bacteria 1191
179 Ga0207648_10006669 3300026089 Bacteria 11454
180 Ga0207648_10107099 3300026089 Bacteria 2453
181 Ga0207676_10004911 3300026095 Bacteria 9481
182 Ga0207676_10593490 3300026095 Bacteria 1063
183 Ga0207674_10010413 3300026116 Bacteria 10535
184 Ga0207674_10374774 3300026116 Bacteria 1376
185 Ga0207674_10816621 3300026116 Bacteria 900
186 Ga0207675_100092179 3300026118 Bacteria 2849
187 Ga0207675_100147653 3300026118 Bacteria 2236
188 Ga0207675_100153873 3300026118 Bacteria 2190
189 Ga0207698_10018525 3300026142 Bacteria 4746
190 Ga0207698_10029742 3300026142 Bacteria 3917
191 Ga0207698_10142910 3300026142 Bacteria 2065
192 Ga0207698_10592062 3300026142 Bacteria 1092
193 Ga0268266_10111691 3300028379 Bacteria 2422
194 Ga0268265_10434891 3300028380 Bacteria 1222
195 Ga0265337_1001221 3300028556 Bacteria 13029
196 Ga0265337_1010486 3300028556 Bacteria 3244
197 Ga0265319_1004138 3300028563 Bacteria 7284
198 Ga0265319_1013453 3300028563 Bacteria 3253
199 Ga0265319_1017284 3300028563 Bacteria 2744
200 Ga0265319_1017475 3300028563 Bacteria 2726
201 Ga0265319_1033307 3300028563 Bacteria 1781
202 Ga0265334_10005644 3300028573 Bacteria 5462
203 Ga0265318_10001535 3300028577 Bacteria 13446
204 Ga0265318_10004953 3300028577 Bacteria 6343
205 Ga0265318_10027063 3300028577 Bacteria 2255
206 Ga0265322_10011938 3300028654 Bacteria 2513
207 Ga0265338_10005139 3300028800 Bacteria 17233
208 Ga0265338_10008849 3300028800 Bacteria 12145
209 Ga0265338_10555399 3300028800 Bacteria 803
210 Ga0265324_10001458 3300029957 Bacteria 13471
211 Ga0265332_10002166 3300031238 Bacteria 10114
212 Ga0265332_10021357 3300031238 Bacteria 2860
213 Ga0265328_10000823 3300031239 Bacteria 14338
214 Ga0265328_10020399 3300031239 Bacteria 2537
215 Ga0265320_10000134 3300031240 Bacteria 63576
216 Ga0265320_10000388 3300031240 Bacteria 35663
217 Ga0265320_10008359 3300031240 Bacteria 6337
218 Ga0265320_10022549 3300031240 Bacteria 3366
219 Ga0265320_10022881 3300031240 Bacteria 3336
220 Ga0265320_10026053 3300031240 Bacteria 3066
221 Ga0265320_10045521 3300031240 Bacteria 2155
222 Ga0265325_10013102 3300031241 Bacteria 4725
223 Ga0265325_10033537 3300031241 Bacteria 2737
224 Ga0265329_10001043 3300031242 Bacteria 13741
225 Ga0265339_10025138 3300031249 Bacteria 3422
226 Ga0265339_10218628 3300031249 Bacteria 933
227 Ga0265331_10003621 3300031250 Bacteria 9879
228 Ga0265327_10001596 3300031251 Bacteria 27613
229 Ga0265327_10021261 3300031251 Bacteria 3919
230 Ga0265316_10060739 3300031344 Bacteria 2937
231 Ga0265316_10063265 3300031344 Bacteria 2869
232 Ga0307408_100332038 3300031548 Bacteria 1284
233 Ga0265313_10004375 3300031595 Bacteria 10901
234 Ga0265313_10007064 3300031595 Bacteria 7763
235 Ga0265313_10021217 3300031595 Bacteria 3558
236 Ga0265313_10036648 3300031595 Bacteria 2460
237 Ga0265313_10042815 3300031595 Bacteria 2221
238 Ga0307508_10016045 3300031616 Bacteria 6823
239 Ga0265314_10000042 3300031711 Bacteria 215775
240 Ga0265314_10003289 3300031711 Bacteria 15786
241 Ga0265314_10008321 3300031711 Bacteria 8896
242 Ga0265342_10007265 3300031712 Bacteria 8139
243 Ga0265342_10027177 3300031712 Bacteria 3579
244 Ga0265342_10117651 3300031712 Bacteria 1499
245 Ga0265342_10126231 3300031712 Bacteria 1436
246 Ga0316576_10448536 3300031727 Bacteria 953
247 Ga0307405_10011980 3300031731 Bacteria 4568
248 Ga0307405_10309546 3300031731 Bacteria 1202
249 Ga0307405_10386532 3300031731 Bacteria 1091
250 Ga0307413_10000331 3300031824 Bacteria 14874
251 Ga0307410_10001187 3300031852 Bacteria 11524
252 Ga0307406_10636965 3300031901 Bacteria 883
253 Ga0307407_10000199 3300031903 Bacteria 18144
254 Ga0307407_10000688 3300031903 Bacteria 10937
255 Ga0307412_10005960 3300031911 Bacteria 6869
256 Ga0307412_10108304 3300031911 Bacteria 1979
257 Ga0307412_10504615 3300031911 Bacteria 1008
258 Ga0307409_100014585 3300031995 Bacteria 5120
259 Ga0307409_100018960 3300031995 Bacteria 4644
260 Ga0307416_100008662 3300032002 Bacteria 6586
261 Ga0307416_100024711 3300032002 Bacteria 4391
262 Ga0307416_100085719 3300032002 Bacteria 2682
263 Ga0307416_100132571 3300032002 Bacteria 2247
264 Ga0307416_100159054 3300032002 Bacteria 2085
265 Ga0307416_100238329 3300032002 Bacteria 1760
266 Ga0307411_10002915 3300032005 Bacteria 7751
267 Ga0307411_10024475 3300032005 Bacteria 3600
268 Ga0307411_10035379 3300032005 Bacteria 3118
269 Ga0307411_10396824 3300032005 Bacteria 1139
270 Ga0307415_100007250 3300032126 Bacteria 6053
271 Ga0307415_100034938 3300032126 Bacteria 3278
272 Ga0307415_100319957 3300032126 Bacteria 1293
273 Ga0316583_10007936 3300032133 Bacteria 3827
274 Ga0373951_0002825 3300035091 Bacteria 4324
275 Ga0373956_0261363 3300035119 Bacteria 823
276 Ga0316574_0155883 3300035398 Bacteria 1471
277 Ga0395899_0008555 3300037312 Bacteria 7885
278 Ga0395900_0012827 3300037418 Bacteria 8564
279 Ga0395898_0090934 3300037466 Bacteria 2937
280 Ga0395905_0006691 3300037471 Bacteria 11550
281 Ga0395905_0021739 3300037471 Bacteria 6069
282 Ga0395905_0350058 3300037471 Bacteria 1369
283 Ga0436364_1255504 3300037853 Bacteria 7134
284 Ga0395901_0032746 3300038443 Bacteria 5362
285 Ga0436365_0152357 3300039437 Bacteria 1309
286 Ga0436365_1023130 3300039437 Bacteria 856
287 Ga0451577_0000033 3300042876 Bacteria 378714
288 Ga0451577_0001114 3300042876 Bacteria 38128
289 Ga0453683_0002482 3300044673 Bacteria 14260
290 Ga0466966_0194812 3300044684 Bacteria 1227
291 Ga0466961_0497282 3300044693 Bacteria 736
292 Ga0466961_0523538 3300044693 Bacteria 715
293 Ga0466963_0400120 3300044694 Bacteria 968
294 Ga0453684_0000109 3300044712 Bacteria 361015
295 Ga0453684_0029956 3300044712 Bacteria 7705
296 Ga0453684_0287652 3300044712 Bacteria 1872
297 Ga0466957_0078583 3300044842 Bacteria 2052
298 Ga0466960_0271607 3300044901 Bacteria 948
299 Ga0466959_0119820 3300045049 Bacteria 1872
300 Ga0451576_0000071 3300045051 Bacteria 258795
301 Ga0451576_0315958 3300045051 Bacteria 1634
302 Ga0466958_0056517 3300045836 Bacteria 2384
303 Ga0466967_0611593 3300045976 Bacteria 1076
304 Ga0495592_0014799 3300046454 Bacteria 5923
305 Ga0495590_0091563 3300046457 Bacteria 1076
306 Ga0495594_0372356 3300046499 Bacteria 813
307 Ga0495658_0078243 3300046683 Bacteria 1935
308 Ga0495669_0175562 3300046684 Bacteria 1020
309 Ga0496108_0129780 3300048911 Bacteria 2167
310 Ga0496112_0195782 3300048915 Bacteria 1982
311 Ga0496113_0158626 3300048916 Bacteria 1788
312 Ga0496114_0000008 3300048917 Bacteria 420692
313 Ga0496114_0321775 3300048917 Bacteria 1367
314 Ga0501031_0104085 3300049568 Bacteria 1852
315 Ga0501032_0199603 3300049569 Bacteria 1305
316 Ga0501033_0000329 3300049570 Bacteria 45324
317 Ga0501034_0198426 3300049571 Bacteria 1965
318 Ga0501034_0223118 3300049571 Bacteria 1836
319 Ga0501036_0008335 3300049572 Bacteria 8492
320 Ga0501037_0000815 3300049573 Bacteria 23310
321 Ga0501038_0025213 3300049574 Bacteria 5300
322 Ga0501039_0006941 3300049575 Bacteria 8619
323 Ga0501040_0337460 3300049576 Bacteria 1079
324 Ga0501041_0091706 3300049577 Bacteria 1876
325 Ga0501043_0070547 3300049579 Bacteria 2744
326 Ga0501043_0176838 3300049579 Bacteria 1663
327 Ga0501046_0004658 3300049580 Bacteria 12390
328 Ga0501047_0075093 3300049581 Bacteria 3253
329 Ga0501047_0198022 3300049581 Bacteria 1870
330 Ga0501048_0167202 3300049582 Bacteria 1557
331 Ga0501067_0018589 3300049583 Bacteria 3847
332 Ga0501068_0302709 3300049584 Bacteria 1023
333 Ga0501070_0053497 3300049586 Bacteria 3349
334 Ga0501070_0354522 3300049586 Bacteria 1190
335 Ga0501072_0372458 3300049588 Bacteria 1133
336 Ga0501073_0008238 3300049589 Bacteria 7730
337 Ga0501073_0022971 3300049589 Bacteria 4485
338 Ga0501074_0036597 3300049590 Bacteria 3555
339 Ga0501074_0117005 3300049590 Bacteria 1907
340 Ga0501075_0170643 3300049591 Bacteria 1660
341 Ga0501075_0240583 3300049591 Bacteria 1380
342 Ga0501076_0235039 3300049592 Bacteria 1499
343 Ga0501079_0073700 3300049741 Bacteria 2639
344 Ga0501080_0008196 3300049742 Bacteria 9462
345 Ga0501080_0029693 3300049742 Bacteria 5089
346 Ga0501080_0159604 3300049742 Bacteria 2083
347 Ga0501081_0132048 3300049743 Bacteria 1785
348 Ga0501083_0060027 3300049744 Bacteria 2542
349 Ga0501083_0258397 3300049744 Bacteria 1133
350 Ga0501035_0082050 3300049822 Bacteria 2845
351 Ga0501035_0236322 3300049822 Bacteria 1556
352 Ga0501035_0323277 3300049822 Bacteria 1296
353 Ga0501035_0334692 3300049822 Bacteria 1269
354 Ga0501035_0493164 3300049822 Bacteria 1009
355 Ga0501044_0005832 3300049823 Bacteria 13640
356 Ga0501044_0046331 3300049823 Bacteria 4502
357 Ga0501044_0200215 3300049823 Bacteria 1955
358 nmdc:mga07m45_635187_c1 3300050496 Bacteria 616
359 nmdc:mga09592_359404_c1 3300050508 Bacteria 1260
360 nmdc:mga08y16_118907_c1 3300050511 Bacteria 2750
361 nmdc:mga0n895_15857_c1 3300050512 Bacteria 6891
362 nmdc:mga0n895_218916_c1 3300050512 Bacteria 1933
363 nmdc:mga0n895_518272_c1 3300050512 Bacteria 1200
364 nmdc:mga0rr50_197659_c1 3300050513 Bacteria 1651
365 nmdc:mga0rr50_3950_c1 3300050513 Bacteria 8624
366 nmdc:mga0rr50_568361_c1 3300050513 Bacteria 966
367 nmdc:mga0rr50_625464_c1 3300050513 Bacteria 918
368 nmdc:mga0rr50_792059_c1 3300050513 Bacteria 809
369 nmdc:mga08x19_2557_c1 3300050514 Bacteria 11056
370 nmdc:mga08x19_60864_c1 3300050514 Bacteria 2446
371 Ga0495595_0075110 3300053084 Bacteria 1603
372 Ga0500555_000003 3300053103 Bacteria 392994
373 Ga0500616_0031323 3300053153 Bacteria 2913
374 Ga0501084_0246737 3300054114 Unclassified 1507
375 Ga0501084_0434847 3300054114 Bacteria 1109
376 Ga0466962_0101035 3300061719 Bacteria 1385

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006178 Ga0075367_10115416 Ga0075367_101154162 184
2 3300006353 Ga0075370_10447768 Ga0075370_104477681 184
3 3300031903 Ga0307407_10000199 Ga0307407_1000019912 184
4 3300032002 Ga0307416_100008662 Ga0307416_1000086626 184
5 3300032005 Ga0307411_10035379 Ga0307411_100353792 184
6 3300050496 nmdc:mga07m45_635187_c1 nmdc:mga07m45_635187_c1_35_589 184
7 3300005327 Ga0070658_10020621 Ga0070658_100206219 199
8 3300013297 Ga0157378_10082122 Ga0157378_100821224 199
9 3300032002 Ga0307416_100238329 Ga0307416_1002383292 208
10 3300032005 Ga0307411_10396824 Ga0307411_103968241 208
11 3300028380 Ga0268265_10434891 Ga0268265_104348911 209
12 3300031731 Ga0307405_10309546 Ga0307405_103095462 209
13 3300031911 Ga0307412_10108304 Ga0307412_101083042 209
14 3300032002 Ga0307416_100159054 Ga0307416_1001590543 209
15 3300044673 Ga0453683_0002482 Ga0453683_0002482_8728_9357 209
16 3300006871 Ga0075434_100000519 Ga0075434_10000051925 210
17 3300006914 Ga0075436_100041538 Ga0075436_1000415383 210
18 3300007076 Ga0075435_100004741 Ga0075435_1000047419 210
19 3300031727 Ga0316576_10448536 Ga0316576_104485362 210
20 3300035398 Ga0316574_0155883 Ga0316574_0155883_235_882 210
21 3300050512 nmdc:mga0n895_15857_c1 nmdc:mga0n895_15857_c1_4307_4939 210
22 3300050513 nmdc:mga0rr50_3950_c1 nmdc:mga0rr50_3950_c1_6156_6788 210
23 3300050514 nmdc:mga08x19_60864_c1 nmdc:mga08x19_60864_c1_1014_1646 210
24 3300005337 Ga0070682_100692815 Ga0070682_1006928151 211
25 3300013296 Ga0157374_10142079 Ga0157374_101420792 211
26 3300013308 Ga0157375_10450886 Ga0157375_104508862 211
27 3300014969 Ga0157376_10275528 Ga0157376_102755281 211
28 3300025937 Ga0207669_10224958 Ga0207669_102249582 211
29 3300048917 Ga0496114_0321775 Ga0496114_0321775_284_919 211
30 3300005327 Ga0070658_10007570 Ga0070658_100075703 212
31 3300005339 Ga0070660_100479013 Ga0070660_1004790132 212
32 3300025909 Ga0207705_10561244 Ga0207705_105612442 212
33 3300025919 Ga0207657_10372188 Ga0207657_103721882 212
34 3300026142 Ga0207698_10592062 Ga0207698_105920622 212
35 iso_pu_bacteria 2916178963 2916182495 212
36 3300005616 Ga0068852_100409983 Ga0068852_1004099834 213
37 3300013296 Ga0157374_10018471 Ga0157374_100184714 213
38 3300025909 Ga0207705_10260235 Ga0207705_102602352 213
39 3300025924 Ga0207694_10586922 Ga0207694_105869222 213
40 3300026142 Ga0207698_10018525 Ga0207698_100185259 213
41 3300044684 Ga0466966_0194812 Ga0466966_0194812_275_916 213
42 3300044693 Ga0466961_0523538 Ga0466961_0523538_64_705 213
43 3300044694 Ga0466963_0400120 Ga0466963_0400120_18_659 213
44 3300044842 Ga0466957_0078583 Ga0466957_0078583_216_857 213
45 3300045836 Ga0466958_0056517 Ga0466958_0056517_110_751 213
46 3300049576 Ga0501040_0337460 Ga0501040_0337460_79_720 213
47 3300049577 Ga0501041_0091706 Ga0501041_0091706_162_803 213
48 3300049581 Ga0501047_0075093 Ga0501047_0075093_223_864 213
49 3300049591 Ga0501075_0170643 Ga0501075_0170643_846_1487 213
50 3300049592 Ga0501076_0235039 Ga0501076_0235039_400_1041 213
51 3300049822 Ga0501035_0323277 Ga0501035_0323277_286_927 213
52 3300049822 Ga0501035_0493164 Ga0501035_0493164_244_885 213
53 3300049823 Ga0501044_0046331 Ga0501044_0046331_1036_1677 213
54 3300054114 Ga0501084_0246737 Ga0501084_0246737_204_866 213
55 3300061719 Ga0466962_0101035 Ga0466962_0101035_345_986 213
56 3300005328 Ga0070676_10003650 Ga0070676_100036507 214
57 3300005331 Ga0070670_100089393 Ga0070670_1000893934 214
58 3300005339 Ga0070660_100272154 Ga0070660_1002721542 214
59 3300006871 Ga0075434_100057172 Ga0075434_1000571722 214
60 3300006914 Ga0075436_100214458 Ga0075436_1002144582 214
61 3300013102 Ga0157371_10160843 Ga0157371_101608433 214
62 3300013104 Ga0157370_10171714 Ga0157370_101717142 214
63 3300013297 Ga0157378_10099954 Ga0157378_100999541 214
64 3300013307 Ga0157372_10079343 Ga0157372_100793436 214
65 3300013307 Ga0157372_11014388 Ga0157372_110143882 214
66 3300025907 Ga0207645_10006480 Ga0207645_100064806 214
67 3300025912 Ga0207707_10723826 Ga0207707_107238261 214
68 3300025913 Ga0207695_10356108 Ga0207695_103561082 214
69 3300025919 Ga0207657_10406188 Ga0207657_104061881 214
70 3300025925 Ga0207650_10048957 Ga0207650_100489571 214
71 3300025929 Ga0207664_10442376 Ga0207664_104423762 214
72 3300032133 Ga0316583_10007936 Ga0316583_100079364 214
73 3300035119 Ga0373956_0261363 Ga0373956_0261363_35_679 214
74 3300037471 Ga0395905_0350058 Ga0395905_0350058_420_1082 214
75 3300042876 Ga0451577_0000033 Ga0451577_0000033_105071_105715 214
76 3300042876 Ga0451577_0001114 Ga0451577_0001114_15059_15706 214
77 3300044712 Ga0453684_0000109 Ga0453684_0000109_256371_257015 214
78 3300044712 Ga0453684_0287652 Ga0453684_0287652_1009_1656 214
79 3300046454 Ga0495592_0014799 Ga0495592_0014799_3850_4494 214
80 3300048915 Ga0496112_0195782 Ga0496112_0195782_469_1113 214
81 3300048916 Ga0496113_0158626 Ga0496113_0158626_1048_1692 214
82 3300050512 nmdc:mga0n895_218916_c1 nmdc:mga0n895_218916_c1_1102_1746 214
83 3300050513 nmdc:mga0rr50_568361_c1 nmdc:mga0rr50_568361_c1_54_701 214
84 3300053084 Ga0495595_0075110 Ga0495595_0075110_904_1548 214
85 3300053103 Ga0500555_000003 Ga0500555_000003_93730_94380 214
86 3300053153 Ga0500616_0031323 Ga0500616_0031323_140_790 214
87 3300005331 Ga0070670_100607313 Ga0070670_1006073132 215
88 3300005339 Ga0070660_100022501 Ga0070660_1000225016 215
89 3300005355 Ga0070671_100074503 Ga0070671_1000745033 215
90 3300005435 Ga0070714_100222545 Ga0070714_1002225453 215
91 3300005458 Ga0070681_10019367 Ga0070681_100193673 215
92 3300005458 Ga0070681_10062206 Ga0070681_100622063 215
93 3300005530 Ga0070679_100156302 Ga0070679_1001563023 215
94 3300005563 Ga0068855_100738638 Ga0068855_1007386382 215
95 3300005616 Ga0068852_100042154 Ga0068852_1000421547 215
96 3300005618 Ga0068864_100015213 Ga0068864_1000152135 215
97 3300005841 Ga0068863_100013000 Ga0068863_1000130008 215
98 3300005842 Ga0068858_100473668 Ga0068858_1004736683 215
99 3300005843 Ga0068860_100185563 Ga0068860_1001855632 215
100 3300006358 Ga0068871_100410377 Ga0068871_1004103771 215
101 3300006847 Ga0075431_100283870 Ga0075431_1002838702 215
102 3300006880 Ga0075429_100589898 Ga0075429_1005898981 215
103 3300009093 Ga0105240_10097365 Ga0105240_100973654 215
104 3300009093 Ga0105240_10401173 Ga0105240_104011732 215
105 3300009551 Ga0105238_10267062 Ga0105238_102670623 215
106 3300013104 Ga0157370_10685873 Ga0157370_106858732 215
107 3300013306 Ga0163162_10000800 Ga0163162_100008005 215
108 3300013307 Ga0157372_10038324 Ga0157372_100383243 215
109 3300013308 Ga0157375_10017927 Ga0157375_100179271 215
110 3300025909 Ga0207705_10427624 Ga0207705_104276241 215
111 3300025911 Ga0207654_10001770 Ga0207654_100017704 215
112 3300025912 Ga0207707_10120918 Ga0207707_101209182 215
113 3300025913 Ga0207695_10007879 Ga0207695_100078792 215
114 3300025919 Ga0207657_10007338 Ga0207657_100073381 215
115 3300025924 Ga0207694_10027014 Ga0207694_100270145 215
116 3300025929 Ga0207664_10102410 Ga0207664_101024102 215
117 3300025931 Ga0207644_10096793 Ga0207644_100967933 215
118 3300025949 Ga0207667_10072824 Ga0207667_100728242 215
119 3300026041 Ga0207639_10398183 Ga0207639_103981832 215
120 3300026078 Ga0207702_10029005 Ga0207702_100290053 215
121 3300026088 Ga0207641_10009616 Ga0207641_100096168 215
122 3300026095 Ga0207676_10004911 Ga0207676_1000491111 215
123 3300026116 Ga0207674_10010413 Ga0207674_100104135 215
124 3300026142 Ga0207698_10029742 Ga0207698_100297426 215
125 3300031242 Ga0265329_10001043 Ga0265329_100010433 215
126 3300031548 Ga0307408_100332038 Ga0307408_1003320382 215
127 3300031711 Ga0265314_10000042 Ga0265314_1000004257 215
128 3300031731 Ga0307405_10386532 Ga0307405_103865321 215
129 3300031901 Ga0307406_10636965 Ga0307406_106369652 215
130 3300031911 Ga0307412_10504615 Ga0307412_105046152 215
131 3300045049 Ga0466959_0119820 Ga0466959_0119820_1095_1757 215
132 3300046457 Ga0495590_0091563 Ga0495590_0091563_218_865 215
133 3300046499 Ga0495594_0372356 Ga0495594_0372356_14_661 215
134 3300049568 Ga0501031_0104085 Ga0501031_0104085_723_1448 215
135 3300049569 Ga0501032_0199603 Ga0501032_0199603_65_790 215
136 3300049570 Ga0501033_0000329 Ga0501033_0000329_26115_26840 215
137 3300049571 Ga0501034_0198426 Ga0501034_0198426_949_1596 215
138 3300049572 Ga0501036_0008335 Ga0501036_0008335_7218_7943 215
139 3300049573 Ga0501037_0000815 Ga0501037_0000815_4101_4826 215
140 3300049574 Ga0501038_0025213 Ga0501038_0025213_120_845 215
141 3300049575 Ga0501039_0006941 Ga0501039_0006941_6670_7395 215
142 3300049579 Ga0501043_0070547 Ga0501043_0070547_549_1274 215
143 3300049579 Ga0501043_0176838 Ga0501043_0176838_388_1035 215
144 3300049580 Ga0501046_0004658 Ga0501046_0004658_9580_10305 215
145 3300049581 Ga0501047_0198022 Ga0501047_0198022_549_1274 215
146 3300049582 Ga0501048_0167202 Ga0501048_0167202_213_938 215
147 3300049584 Ga0501068_0302709 Ga0501068_0302709_24_671 215
148 3300049586 Ga0501070_0354522 Ga0501070_0354522_495_1142 215
149 3300049589 Ga0501073_0008238 Ga0501073_0008238_1471_2196 215
150 3300049590 Ga0501074_0036597 Ga0501074_0036597_538_1263 215
151 3300049742 Ga0501080_0159604 Ga0501080_0159604_1336_1983 215
152 3300049822 Ga0501035_0082050 Ga0501035_0082050_832_1479 215
153 3300049822 Ga0501035_0334692 Ga0501035_0334692_389_1036 215
154 3300049823 Ga0501044_0005832 Ga0501044_0005832_11733_12380 215
155 3300049823 Ga0501044_0200215 Ga0501044_0200215_549_1274 215
156 3300050508 nmdc:mga09592_359404_c1 nmdc:mga09592_359404_c1_318_965 215
157 3300005331 Ga0070670_100346769 Ga0070670_1003467692 216
158 3300005347 Ga0070668_100137837 Ga0070668_1001378371 216
159 3300005354 Ga0070675_100016074 Ga0070675_1000160743 216
160 3300005354 Ga0070675_100028820 Ga0070675_1000288203 216
161 3300005356 Ga0070674_100045539 Ga0070674_1000455394 216
162 3300005366 Ga0070659_100713214 Ga0070659_1007132142 216
163 3300005367 Ga0070667_100237315 Ga0070667_1002373151 216
164 3300005367 Ga0070667_100242479 Ga0070667_1002424792 216
165 3300005455 Ga0070663_100095815 Ga0070663_1000958153 216
166 3300005543 Ga0070672_100064295 Ga0070672_1000642952 216
167 3300005548 Ga0070665_100412138 Ga0070665_1004121382 216
168 3300005578 Ga0068854_100122712 Ga0068854_1001227123 216
169 3300005617 Ga0068859_100665320 Ga0068859_1006653202 216
170 3300005834 Ga0068851_10145992 Ga0068851_101459921 216
171 3300005842 Ga0068858_100483614 Ga0068858_1004836142 216
172 3300006175 Ga0070712_100686099 Ga0070712_1006860991 216
173 3300006931 Ga0097620_100665269 Ga0097620_1006652692 216
174 3300013306 Ga0163162_10366989 Ga0163162_103669892 216
175 3300013308 Ga0157375_10257475 Ga0157375_102574752 216
176 3300025901 Ga0207688_10018108 Ga0207688_100181082 216
177 3300025901 Ga0207688_10045896 Ga0207688_100458962 216
178 3300025907 Ga0207645_10059991 Ga0207645_100599911 216
179 3300025920 Ga0207649_10120833 Ga0207649_101208332 216
180 3300025923 Ga0207681_10274828 Ga0207681_102748282 216
181 3300025926 Ga0207659_10129174 Ga0207659_101291742 216
182 3300025926 Ga0207659_10538509 Ga0207659_105385092 216
183 3300025928 Ga0207700_10207088 Ga0207700_102070882 216
184 3300025931 Ga0207644_10524710 Ga0207644_105247101 216
185 3300025936 Ga0207670_10663556 Ga0207670_106635561 216
186 3300025940 Ga0207691_10016364 Ga0207691_100163644 216
187 3300025940 Ga0207691_10047475 Ga0207691_100474754 216
188 3300025960 Ga0207651_10293138 Ga0207651_102931381 216
189 3300025981 Ga0207640_10066389 Ga0207640_100663893 216
190 3300025986 Ga0207658_10124189 Ga0207658_101241891 216
191 3300026089 Ga0207648_10107099 Ga0207648_101070992 216
192 3300026118 Ga0207675_100092179 Ga0207675_1000921793 216
193 3300028379 Ga0268266_10111691 Ga0268266_101116912 216
194 3300028556 Ga0265337_1001221 Ga0265337_10012215 216
195 3300028563 Ga0265319_1013453 Ga0265319_10134533 216
196 3300028563 Ga0265319_1017284 Ga0265319_10172842 216
197 3300028563 Ga0265319_1033307 Ga0265319_10333072 216
198 3300028573 Ga0265334_10005644 Ga0265334_100056445 216
199 3300028577 Ga0265318_10027063 Ga0265318_100270632 216
200 3300028800 Ga0265338_10005139 Ga0265338_100051395 216
201 3300028800 Ga0265338_10555399 Ga0265338_105553991 216
202 3300029957 Ga0265324_10001458 Ga0265324_100014588 216
203 3300031240 Ga0265320_10045521 Ga0265320_100455212 216
204 3300031241 Ga0265325_10013102 Ga0265325_100131024 216
205 3300031249 Ga0265339_10218628 Ga0265339_102186281 216
206 3300031344 Ga0265316_10060739 Ga0265316_100607392 216
207 3300031595 Ga0265313_10007064 Ga0265313_100070647 216
208 3300031595 Ga0265313_10036648 Ga0265313_100366481 216
209 3300031712 Ga0265342_10007265 Ga0265342_100072656 216
210 3300031712 Ga0265342_10126231 Ga0265342_101262312 216
211 3300032002 Ga0307416_100132571 Ga0307416_1001325713 216
212 3300032005 Ga0307411_10024475 Ga0307411_100244754 216
213 3300035091 Ga0373951_0002825 Ga0373951_0002825_1008_1661 216
214 3300037466 Ga0395898_0090934 Ga0395898_0090934_1870_2520 216
215 3300037471 Ga0395905_0006691 Ga0395905_0006691_7889_8539 216
216 3300038443 Ga0395901_0032746 Ga0395901_0032746_1397_2047 216
217 3300050511 nmdc:mga08y16_118907_c1 nmdc:mga08y16_118907_c1_195_848 216
218 3300005331 Ga0070670_100342424 Ga0070670_1003424242 217
219 3300005331 Ga0070670_100415678 Ga0070670_1004156782 217
220 3300005334 Ga0068869_100064337 Ga0068869_1000643371 217
221 3300005340 Ga0070689_100221422 Ga0070689_1002214222 217
222 3300005343 Ga0070687_100013187 Ga0070687_1000131872 217
223 3300005345 Ga0070692_10229866 Ga0070692_102298661 217
224 3300005347 Ga0070668_100040923 Ga0070668_1000409234 217
225 3300005354 Ga0070675_100114547 Ga0070675_1001145471 217
226 3300005356 Ga0070674_100186015 Ga0070674_1001860151 217
227 3300005365 Ga0070688_100197801 Ga0070688_1001978012 217
228 3300005367 Ga0070667_100323923 Ga0070667_1003239231 217
229 3300005457 Ga0070662_100416561 Ga0070662_1004165611 217
230 3300005530 Ga0070679_100021305 Ga0070679_1000213054 217
231 3300005543 Ga0070672_100264950 Ga0070672_1002649502 217
232 3300005544 Ga0070686_100032483 Ga0070686_1000324832 217
233 3300005563 Ga0068855_100070903 Ga0068855_1000709033 217
234 3300005616 Ga0068852_100254969 Ga0068852_1002549691 217
235 3300005718 Ga0068866_10028826 Ga0068866_100288261 217
236 3300005840 Ga0068870_10030740 Ga0068870_100307402 217
237 3300005841 Ga0068863_100023675 Ga0068863_1000236753 217
238 3300005841 Ga0068863_100244957 Ga0068863_1002449571 217
239 3300005843 Ga0068860_100066906 Ga0068860_1000669063 217
240 3300005843 Ga0068860_100152529 Ga0068860_1001525293 217
241 3300006358 Ga0068871_100249592 Ga0068871_1002495922 217
242 3300006880 Ga0075429_100578461 Ga0075429_1005784612 217
243 3300006881 Ga0068865_100064548 Ga0068865_1000645483 217
244 3300007076 Ga0075435_100184432 Ga0075435_1001844322 217
245 3300009094 Ga0111539_10370318 Ga0111539_103703182 217
246 3300009148 Ga0105243_10244150 Ga0105243_102441502 217
247 3300010375 Ga0105239_10306295 Ga0105239_103062952 217
248 3300011119 Ga0105246_10287215 Ga0105246_102872152 217
249 3300013104 Ga0157370_10627896 Ga0157370_106278961 217
250 3300013297 Ga0157378_10192629 Ga0157378_101926292 217
251 3300014325 Ga0163163_10761328 Ga0163163_107613281 217
252 3300014325 Ga0163163_11323906 Ga0163163_113239061 217
253 3300014745 Ga0157377_10404554 Ga0157377_104045541 217
254 3300014968 Ga0157379_10470306 Ga0157379_104703062 217
255 3300021388 Ga0213875_10033007 Ga0213875_100330072 217
256 3300025893 Ga0207682_10001086 Ga0207682_100010864 217
257 3300025901 Ga0207688_10035432 Ga0207688_100354323 217
258 3300025909 Ga0207705_10433939 Ga0207705_104339391 217
259 3300025916 Ga0207663_10596215 Ga0207663_105962151 217
260 3300025918 Ga0207662_10007644 Ga0207662_100076444 217
261 3300025921 Ga0207652_10137449 Ga0207652_101374492 217
262 3300025923 Ga0207681_10093563 Ga0207681_100935633 217
263 3300025925 Ga0207650_10179206 Ga0207650_101792062 217
264 3300025926 Ga0207659_10070196 Ga0207659_100701962 217
265 3300025933 Ga0207706_10011714 Ga0207706_100117146 217
266 3300025935 Ga0207709_10032848 Ga0207709_100328483 217
267 3300025940 Ga0207691_10032086 Ga0207691_100320863 217
268 3300025940 Ga0207691_10159286 Ga0207691_101592863 217
269 3300025941 Ga0207711_10113877 Ga0207711_101138772 217
270 3300025942 Ga0207689_10006304 Ga0207689_100063043 217
271 3300025986 Ga0207658_10109329 Ga0207658_101093294 217
272 3300026035 Ga0207703_10247367 Ga0207703_102473672 217
273 3300026067 Ga0207678_10463677 Ga0207678_104636771 217
274 3300026075 Ga0207708_10054476 Ga0207708_100544762 217
275 3300026088 Ga0207641_10157229 Ga0207641_101572292 217
276 3300026088 Ga0207641_10305588 Ga0207641_103055882 217
277 3300026088 Ga0207641_10490742 Ga0207641_104907422 217
278 3300026089 Ga0207648_10006669 Ga0207648_100066693 217
279 3300026095 Ga0207676_10593490 Ga0207676_105934901 217
280 3300026116 Ga0207674_10816621 Ga0207674_108166212 217
281 3300026118 Ga0207675_100147653 Ga0207675_1001476532 217
282 3300026118 Ga0207675_100153873 Ga0207675_1001538732 217
283 3300026142 Ga0207698_10142910 Ga0207698_101429102 217
284 3300028577 Ga0265318_10004953 Ga0265318_100049534 217
285 3300031238 Ga0265332_10002166 Ga0265332_100021666 217
286 3300031239 Ga0265328_10000823 Ga0265328_100008234 217
287 3300031240 Ga0265320_10022549 Ga0265320_100225492 217
288 3300031249 Ga0265339_10025138 Ga0265339_100251382 217
289 3300031250 Ga0265331_10003621 Ga0265331_100036214 217
290 3300031595 Ga0265313_10042815 Ga0265313_100428151 217
291 3300031616 Ga0307508_10016045 Ga0307508_100160457 217
292 3300031711 Ga0265314_10008321 Ga0265314_100083216 217
293 3300031712 Ga0265342_10027177 Ga0265342_100271774 217
294 3300031731 Ga0307405_10011980 Ga0307405_100119805 217
295 3300031824 Ga0307413_10000331 Ga0307413_1000033113 217
296 3300031852 Ga0307410_10001187 Ga0307410_100011872 217
297 3300031903 Ga0307407_10000688 Ga0307407_100006883 217
298 3300031911 Ga0307412_10005960 Ga0307412_100059605 217
299 3300031995 Ga0307409_100018960 Ga0307409_1000189606 217
300 3300032002 Ga0307416_100024711 Ga0307416_1000247112 217
301 3300032005 Ga0307411_10002915 Ga0307411_100029156 217
302 3300032126 Ga0307415_100007250 Ga0307415_1000072504 217
303 3300037312 Ga0395899_0008555 Ga0395899_0008555_788_1456 217
304 3300037418 Ga0395900_0012827 Ga0395900_0012827_1561_2229 217
305 3300037471 Ga0395905_0021739 Ga0395905_0021739_4960_5628 217
306 3300037853 Ga0436364_1255504 Ga0436364_1255504_5754_6413 217
307 3300039437 Ga0436365_0152357 Ga0436365_0152357_33_713 217
308 3300044901 Ga0466960_0271607 Ga0466960_0271607_232_912 217
309 3300046683 Ga0495658_0078243 Ga0495658_0078243_1055_1714 217
310 3300046684 Ga0495669_0175562 Ga0495669_0175562_255_914 217
311 3300048911 Ga0496108_0129780 Ga0496108_0129780_624_1283 217
312 3300048917 Ga0496114_0000008 Ga0496114_0000008_261246_261905 217
313 3300049571 Ga0501034_0223118 Ga0501034_0223118_204_860 217
314 3300049583 Ga0501067_0018589 Ga0501067_0018589_663_1319 217
315 3300049586 Ga0501070_0053497 Ga0501070_0053497_500_1159 217
316 3300049588 Ga0501072_0372458 Ga0501072_0372458_314_970 217
317 3300049589 Ga0501073_0022971 Ga0501073_0022971_582_1238 217
318 3300049590 Ga0501074_0117005 Ga0501074_0117005_865_1521 217
319 3300049591 Ga0501075_0240583 Ga0501075_0240583_169_828 217
320 3300049741 Ga0501079_0073700 Ga0501079_0073700_1855_2514 217
321 3300049742 Ga0501080_0008196 Ga0501080_0008196_2009_2665 217
322 3300049742 Ga0501080_0029693 Ga0501080_0029693_515_1174 217
323 3300049743 Ga0501081_0132048 Ga0501081_0132048_618_1277 217
324 3300049744 Ga0501083_0060027 Ga0501083_0060027_530_1186 217
325 3300049744 Ga0501083_0258397 Ga0501083_0258397_410_1069 217
326 3300049822 Ga0501035_0236322 Ga0501035_0236322_681_1337 217
327 3300050512 nmdc:mga0n895_518272_c1 nmdc:mga0n895_518272_c1_151_819 217
328 3300050513 nmdc:mga0rr50_197659_c1 nmdc:mga0rr50_197659_c1_357_1019 217
329 3300050513 nmdc:mga0rr50_625464_c1 nmdc:mga0rr50_625464_c1_159_812 217
330 3300050513 nmdc:mga0rr50_792059_c1 nmdc:mga0rr50_792059_c1_78_746 217
331 3300050514 nmdc:mga08x19_2557_c1 nmdc:mga08x19_2557_c1_88_756 217
332 3300054114 Ga0501084_0434847 Ga0501084_0434847_145_801 217
333 3300005530 Ga0070679_100017076 Ga0070679_1000170763 218
334 3300005539 Ga0068853_100017949 Ga0068853_1000179493 218
335 3300013104 Ga0157370_10007970 Ga0157370_100079703 218
336 3300013307 Ga0157372_10008534 Ga0157372_100085347 218
337 3300025912 Ga0207707_10030601 Ga0207707_100306013 218
338 3300025913 Ga0207695_10117630 Ga0207695_101176303 218
339 3300025921 Ga0207652_10019793 Ga0207652_100197933 218
340 3300026041 Ga0207639_10013104 Ga0207639_100131042 218
341 3300026041 Ga0207639_10067519 Ga0207639_100675192 218
342 3300014325 Ga0163163_10019701 Ga0163163_100197018 219
343 3300031995 Ga0307409_100014585 Ga0307409_1000145856 219
344 3300032002 Ga0307416_100085719 Ga0307416_1000857192 219
345 3300032126 Ga0307415_100034938 Ga0307415_1000349383 219
346 3300045051 Ga0451576_0000071 Ga0451576_0000071_230363_231025 220
347 3300044693 Ga0466961_0497282 Ga0466961_0497282_13_699 221
348 3300045976 Ga0466967_0611593 Ga0466967_0611593_62_748 221
349 3300039437 Ga0436365_1023130 Ga0436365_1023130_129_818 222
350 3300003323 rootH1_10017327 rootH1_100173275 223
351 3300005459 Ga0068867_100726215 Ga0068867_1007262152 223
352 3300014325 Ga0163163_10029469 Ga0163163_100294692 223
353 3300026116 Ga0207674_10374774 Ga0207674_103747743 223
354 3300028556 Ga0265337_1010486 Ga0265337_10104862 223
355 3300028563 Ga0265319_1004138 Ga0265319_10041382 223
356 3300028563 Ga0265319_1017475 Ga0265319_10174752 223
357 3300028577 Ga0265318_10001535 Ga0265318_100015353 223
358 3300028654 Ga0265322_10011938 Ga0265322_100119382 223
359 3300028800 Ga0265338_10008849 Ga0265338_1000884911 223
360 3300031238 Ga0265332_10021357 Ga0265332_100213572 223
361 3300031239 Ga0265328_10020399 Ga0265328_100203992 223
362 3300031240 Ga0265320_10000134 Ga0265320_1000013419 223
363 3300031240 Ga0265320_10000388 Ga0265320_1000038820 223
364 3300031240 Ga0265320_10008359 Ga0265320_100083594 223
365 3300031240 Ga0265320_10022881 Ga0265320_100228812 223
366 3300031240 Ga0265320_10026053 Ga0265320_100260532 223
367 3300031241 Ga0265325_10033537 Ga0265325_100335372 223
368 3300031251 Ga0265327_10001596 Ga0265327_100015967 223
369 3300031251 Ga0265327_10021261 Ga0265327_100212612 223
370 3300031344 Ga0265316_10063265 Ga0265316_100632652 223
371 3300031595 Ga0265313_10004375 Ga0265313_100043751 223
372 3300031595 Ga0265313_10021217 Ga0265313_100212172 223
373 3300031711 Ga0265314_10003289 Ga0265314_100032893 223
374 3300031712 Ga0265342_10117651 Ga0265342_101176512 223
375 3300032126 Ga0307415_100319957 Ga0307415_1003199571 223
376 3300044712 Ga0453684_0029956 Ga0453684_0029956_5046_5717 223
377 3300045051 Ga0451576_0315958 Ga0451576_0315958_814_1485 223

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00484

Pro_CA

Carbonic anhydrase

63

215

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
4wam-assembly1.cif.gz_B-2 h. influenzae beta-carbonic anhydrase variant w39v/g41a/p48s/a49p 0.9772 35 216
4wak-assembly1.cif.gz_A-2 h. influenzae beta-carbonic anhydrase variant w39v/g41a 0.9694 35 216
4waj-assembly1.cif.gz_A-2 h. influenzae beta-carbonic anhydase variant p48s/a49p 0.9683 33 216
4wam-assembly1.cif.gz_A-2 h. influenzae beta-carbonic anhydrase variant w39v/g41a/p48s/a49p 0.9671 35 216
4wak-assembly1.cif.gz_B-2 h. influenzae beta-carbonic anhydrase variant w39v/g41a 0.964 35 214
ID Description Score Start End Superfamily
4wamA00 Alpha Beta;3-Layer(aba) Sandwich;Beta-carbonic Anhydrase; Chain A;Carbonic anhydrase 0.9671 35 216 3.40.1050.10
1ddzB02 Alpha Beta;3-Layer(aba) Sandwich;Beta-carbonic Anhydrase; Chain A;Carbonic anhydrase 0.9528 33 220 3.40.1050.10
2a8cA00 Alpha Beta;3-Layer(aba) Sandwich;Beta-carbonic Anhydrase; Chain A;Carbonic anhydrase 0.9332 1 216 3.40.1050.10
4wamA00 Alpha Beta;3-Layer(aba) Sandwich;Beta-carbonic Anhydrase; Chain A;Carbonic anhydrase 0.9248 35 216 3.40.1050.10
af_A4HSV2_69_305_3.40.1050.10 Alpha Beta;3-Layer(aba) Sandwich;Beta-carbonic Anhydrase; Chain A;Carbonic anhydrase 0.9184 1 219 3.40.1050.10
ID Description Score Start End GO Terms
AF-A0A080M7H3-F1-model_v4 Carbonic anhydrase (EC 4.2.1.1) (Carbonate dehydratase) 0.9905 47 215 GO:0004089
GO:0008270
GO:0015976
AF-A0A3L7X137-F1-model_v4 carbonic anhydrase (EC 4.2.1.1) 0.9874 89 211 GO:0004089
GO:0008270
GO:0015976
AF-A0A7V7ZFG5-F1-model_v4 carbonic anhydrase (EC 4.2.1.1) 0.9852 19 216 GO:0004089
GO:0008270
GO:0015976
AF-A0A080M7H3-F1-model_v4 Carbonic anhydrase (EC 4.2.1.1) (Carbonate dehydratase) 0.9847 47 215 GO:0004089
GO:0008270
GO:0015976
AF-A0A1J5PFM1-F1-model_v4 carbonic anhydrase (EC 4.2.1.1) 0.9838 22 215 GO:0004089
GO:0008270
GO:0015976

Feature Viewer

pLDDT pTM Quality
93.3 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map