F427737

General Info

Members Datasets Scaffolds Average Seq Length
377 226 360 264

Family's Representative Sequence

Representative Sequence 3300031548|Ga0307408_100022320|Ga0307408_1000223201
Length 284
Sequence MRSLLQSLPRWPTSQSDEGAAARARAMRGSQVTIKTPAQQDQMRTAGRLAAEVLDMIGPYVVPGVTTDELNARCHEYIVNVQHAVPAPLNYRGFPKSICTSVNHVVCHGIPSPDKRLKQGDIVNVDVTVIKDGWHGDTSRMFAVGKIAPAAQRLIEVTHEAMWIGIRQVRPGAHLGDIGAAIQGFVEPQHLSIVREYCGHGIGQIFHEDPQVLHYGERGQGLQLQAGMTFTVEPMVNAGKRHVRLLPDGWTVITKDHSLSAQWEHTVLVTDTGYEVLTLGAAER

Samples

Sample ID Description Type Environment
1 2524023250 Niveispirillum irakense DSM 11586 Isolate Unclassified
2 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
3 2643221563 Sphingopyxis sp. Root154 Isolate Unclassified
4 2643221608 Sphingopyxis sp. Root214 Isolate Unclassified
5 2738543024 Aminobacter sp. AP02 Isolate Unclassified
6 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
7 2848297114 Croceibacterium ferulae EGI 63111 Isolate Unclassified
8 2919688452 Pararheinheimera soli 4138 Isolate Unclassified
9 2928027323 Sphingomonas sp. 1185 Isolate Unclassified
10 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
11 2984555340 Sphingomonas sp. SORGH_AS789 Isolate Aerial Root
12 2984564862 Sphingomonas sp. SORGH_AS870 Isolate Aerial Root
13 2993356040 Sphingomonas sp. SORGH_AS742 Isolate Aerial Root
14 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
15 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
16 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
17 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
18 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
19 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
20 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
21 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
22 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
23 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
24 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
25 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
26 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
27 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
28 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
29 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
30 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
31 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
32 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
33 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
34 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
35 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
36 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
37 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
38 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
39 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
40 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
41 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
42 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
43 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
44 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
45 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
46 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
47 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
48 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
49 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
50 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
51 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
52 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
53 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
54 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
55 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
59 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
60 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
61 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
62 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
63 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
64 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
65 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
66 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
67 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
68 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
69 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
70 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
71 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
72 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
74 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
75 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
76 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
77 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
78 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
79 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
82 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
84 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
86 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
87 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
88 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
89 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
90 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
91 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
94 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
95 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
96 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
97 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
98 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
99 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
100 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
101 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
102 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
103 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
104 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
105 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
107 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
108 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
109 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
111 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
151 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
155 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
156 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
157 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
158 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
159 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
160 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
161 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
162 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
163 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
164 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
165 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
166 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
167 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
168 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
169 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
170 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
171 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
172 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
173 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
174 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
175 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
176 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
177 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
178 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
179 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
180 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
181 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
182 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
183 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
184 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
185 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
186 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
187 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
188 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
189 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
190 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
191 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
192 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
193 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
194 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
195 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
196 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
197 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
198 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
199 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
204 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
205 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
206 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
207 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
208 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
210 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
211 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
212 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
213 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
214 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
215 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
216 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
217 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
218 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
219 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
220 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
221 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
222 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
223 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
224 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
225 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere
226 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.49
Metatranscriptomes 0
Isolates 4.51

Biome Distribution

Category Percentage (%)
Aerial Root 0.8
Bulb 0
Endosphere 11.67
Nodule 0.27
Rhizoplane 4.77
Rhizosphere 74.8
Stem 0
Stem Tuber 0
Unclassified 7.69

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24034J26672_10020052 3300002239 Bacteria 1046
2 JGI25150J39212_1000657 3300002774 Bacteria 12838
3 JGI25151J46595_10017862 3300003187 Bacteria 3063
4 JGI25153J46596_10000266 3300003215 Bacteria 41550
5 Ga0055526_1004679 3300003771 Bacteria 8128
6 Ga0055537_1000644 3300003773 Bacteria 18527
7 Ga0055536_1002000 3300003781 Bacteria 11700
8 Ga0055536_1019792 3300003781 Bacteria 2103
9 Ga0055530_10006500 3300003791 Bacteria 5203
10 Ga0055540_1000692 3300003792 Bacteria 23249
11 Ga0055531_10018902 3300003794 Bacteria 2819
12 Ga0055531_10023520 3300003794 Bacteria 2306
13 Ga0065165_1002485 3300005262 Bacteria 15496
14 Ga0065712_10079281 3300005290 Bacteria 3237
15 Ga0065715_10170161 3300005293 Bacteria 1545
16 Ga0070658_10270535 3300005327 Bacteria 1445
17 Ga0070658_10496681 3300005327 Bacteria 1054
18 Ga0070676_10017125 3300005328 Bacteria 4009
19 Ga0070690_100001101 3300005330 Bacteria 13893
20 Ga0070670_100014711 3300005331 Bacteria 6720
21 Ga0070670_100031964 3300005331 Bacteria 4531
22 Ga0070670_100052190 3300005331 Bacteria 3512
23 Ga0070666_10023869 3300005335 Bacteria 3982
24 Ga0068868_100298075 3300005338 Bacteria 1369
25 Ga0070689_100003117 3300005340 Bacteria 10950
26 Ga0070687_100165691 3300005343 Bacteria 1311
27 Ga0070661_100020141 3300005344 Bacteria 4755
28 Ga0070668_100011367 3300005347 Bacteria 6631
29 Ga0070668_100050367 3300005347 Bacteria 3206
30 Ga0070669_100026983 3300005353 Bacteria 4134
31 Ga0070675_100002544 3300005354 Bacteria 13645
32 Ga0070671_100141131 3300005355 Bacteria 2033
33 Ga0070671_100479997 3300005355 Bacteria 1068
34 Ga0070671_100584987 3300005355 Bacteria 964
35 Ga0070673_100002381 3300005364 Bacteria 11450
36 Ga0070688_100128443 3300005365 Bacteria 1707
37 Ga0070659_100270605 3300005366 Bacteria 1411
38 Ga0070667_100000303 3300005367 Bacteria 54861
39 Ga0070667_100032837 3300005367 Bacteria 4331
40 Ga0070711_100036332 3300005439 Bacteria 3301
41 Ga0070705_100002488 3300005440 Bacteria 9262
42 Ga0070700_100030565 3300005441 Bacteria 3220
43 Ga0070700_100076012 3300005441 Bacteria 2156
44 Ga0070663_100009366 3300005455 Bacteria 6062
45 Ga0070663_100034379 3300005455 Bacteria 3510
46 Ga0070662_100048567 3300005457 Bacteria 3057
47 Ga0070684_100040844 3300005535 Bacteria 3996
48 Ga0068853_100000225 3300005539 Bacteria 40087
49 Ga0070672_100083355 3300005543 Bacteria 2566
50 Ga0070686_100007446 3300005544 Bacteria 6110
51 Ga0070693_100028877 3300005547 Bacteria 3020
52 Ga0070665_100000326 3300005548 Bacteria 73416
53 Ga0070665_100000400 3300005548 Bacteria 63418
54 Ga0070665_100003179 3300005548 Bacteria 17679
55 Ga0070665_100014780 3300005548 Bacteria 7835
56 Ga0070665_100017613 3300005548 Bacteria 7176
57 Ga0070665_100046081 3300005548 Bacteria 4380
58 Ga0070665_100181246 3300005548 Bacteria 2107
59 Ga0070665_100598364 3300005548 Bacteria 1116
60 Ga0068855_100002951 3300005563 Bacteria 20789
61 Ga0068855_100112943 3300005563 Bacteria 3117
62 Ga0068855_100115526 3300005563 Bacteria 3076
63 Ga0068855_100121121 3300005563 Bacteria 2994
64 Ga0070664_100005455 3300005564 Bacteria 10212
65 Ga0070664_100024228 3300005564 Bacteria 5019
66 Ga0068857_100117486 3300005577 Bacteria 2393
67 Ga0068857_100143889 3300005577 Bacteria 2156
68 Ga0068854_100003017 3300005578 Bacteria 10457
69 Ga0068854_100066850 3300005578 Bacteria 2617
70 Ga0068856_100096284 3300005614 Bacteria 2948
71 Ga0068856_100247609 3300005614 Bacteria 1797
72 Ga0068856_100419949 3300005614 Bacteria 1357
73 Ga0068852_100330634 3300005616 Bacteria 1483
74 Ga0068852_100734741 3300005616 Bacteria 999
75 Ga0068859_100011511 3300005617 Bacteria 8893
76 Ga0068859_100025994 3300005617 Bacteria 5873
77 Ga0068864_100002045 3300005618 Bacteria 16656
78 Ga0068864_100053643 3300005618 Bacteria 3479
79 Ga0068864_100089020 3300005618 Bacteria 2720
80 Ga0068861_100003958 3300005719 Bacteria 9913
81 Ga0068851_10010768 3300005834 Bacteria 4274
82 Ga0068870_10114097 3300005840 Bacteria 1547
83 Ga0068863_100008893 3300005841 Bacteria 9808
84 Ga0068863_100009193 3300005841 Bacteria 9641
85 Ga0068863_100024096 3300005841 Bacteria 5806
86 Ga0068863_100040983 3300005841 Bacteria 4402
87 Ga0068863_100066650 3300005841 Bacteria 3405
88 Ga0068858_100014299 3300005842 Bacteria 7484
89 Ga0068860_100144830 3300005843 Bacteria 2285
90 Ga0068862_100001783 3300005844 Bacteria 19471
91 Ga0068862_100012697 3300005844 Bacteria 6971
92 Ga0068862_100057246 3300005844 Bacteria 3342
93 Ga0075364_10080980 3300006051 Bacteria 2147
94 Ga0097621_100097093 3300006237 Bacteria 2473
95 Ga0068871_100171723 3300006358 Bacteria 1859
96 Ga0068871_100349461 3300006358 Bacteria 1308
97 Ga0075428_100004741 3300006844 Bacteria 15060
98 Ga0075428_100034538 3300006844 Bacteria 5577
99 Ga0075428_100332763 3300006844 Bacteria 1631
100 Ga0075430_100001035 3300006846 Bacteria 21980
101 Ga0075431_100001329 3300006847 Bacteria 22603
102 Ga0075431_100016999 3300006847 Bacteria 7387
103 Ga0075433_10224430 3300006852 Bacteria 1668
104 Ga0075429_100010536 3300006880 Bacteria 7994
105 Ga0075429_100021524 3300006880 Bacteria 5589
106 Ga0075429_100116248 3300006880 Bacteria 2338
107 Ga0068865_100020055 3300006881 Bacteria 4334
108 Ga0068865_100166600 3300006881 Bacteria 1685
109 Ga0097620_100011511 3300006931 Bacteria 8893
110 Ga0097620_100025994 3300006931 Bacteria 5873
111 Ga0105240_10063836 3300009093 Bacteria 4579
112 Ga0105240_10139368 3300009093 Bacteria 2901
113 Ga0105240_10438436 3300009093 Bacteria 1464
114 Ga0111539_10002957 3300009094 Bacteria 22547
115 Ga0111539_10017857 3300009094 Bacteria 8786
116 Ga0111539_10433220 3300009094 Bacteria 1531
117 Ga0111539_10475573 3300009094 Bacteria 1455
118 Ga0105245_10217010 3300009098 Bacteria 1844
119 Ga0114129_10003545 3300009147 Bacteria 21966
120 Ga0105241_10099084 3300009174 Bacteria 2314
121 Ga0105248_10001975 3300009177 Bacteria 22803
122 Ga0105248_10002211 3300009177 Bacteria 21553
123 Ga0105237_10000968 3300009545 Bacteria 38642
124 Ga0105237_10124006 3300009545 Bacteria 2578
125 Ga0105237_10212698 3300009545 Bacteria 1933
126 Ga0105238_10029286 3300009551 Bacteria 5610
127 Ga0105238_10216261 3300009551 Bacteria 1892
128 Ga0105249_10001182 3300009553 Bacteria 23117
129 Ga0105249_10093282 3300009553 Bacteria 2820
130 Ga0105249_10152618 3300009553 Bacteria 2225
131 Ga0105249_10250440 3300009553 Bacteria 1756
132 Ga0105249_10251435 3300009553 Bacteria 1752
133 Ga0105249_10376903 3300009553 Bacteria 1444
134 Ga0105239_10000113 3300010375 Bacteria 114562
135 Ga0105239_10016190 3300010375 Bacteria 8249
136 Ga0105239_10055103 3300010375 Bacteria 4361
137 Ga0105239_10171386 3300010375 Bacteria 2427
138 Ga0105239_10380126 3300010375 Bacteria 1596
139 Ga0157373_10179753 3300013100 Bacteria 1489
140 Ga0163162_10000016 3300013306 Bacteria 250836
141 Ga0163162_10087377 3300013306 Bacteria 3196
142 Ga0163162_10172118 3300013306 Bacteria 2290
143 Ga0157372_10000781 3300013307 Bacteria 34471
144 Ga0157372_10214907 3300013307 Bacteria 2228
145 Ga0157375_10108346 3300013308 Bacteria 2873
146 Ga0163163_10009573 3300014325 Bacteria 8659
147 Ga0163163_10299149 3300014325 Bacteria 1662
148 Ga0157380_10233803 3300014326 Bacteria 1652
149 Ga0157380_10294515 3300014326 Bacteria 1492
150 Ga0157377_10007402 3300014745 Bacteria 5299
151 Ga0157376_10085409 3300014969 Bacteria 2719
152 Ga0157376_10275335 3300014969 Bacteria 1583
153 Ga0207425_1000114 3300025245 Bacteria 77043
154 Ga0209129_1004131 3300025258 Bacteria 5885
155 Ga0209233_1000586 3300025261 Bacteria 19261
156 Ga0209565_1000298 3300025263 Bacteria 47155
157 Ga0209565_1010678 3300025263 Bacteria 2270
158 Ga0209673_1012044 3300025273 Bacteria 3515
159 Ga0209675_1000188 3300025291 Bacteria 68178
160 Ga0209676_1000449 3300025292 Bacteria 69842
161 Ga0209676_1007714 3300025292 Bacteria 4975
162 Ga0209676_1011139 3300025292 Bacteria 3659
163 Ga0209676_1012999 3300025292 Bacteria 3229
164 Ga0209025_1001326 3300025294 Bacteria 33497
165 Ga0209564_1001139 3300025295 Bacteria 31226
166 Ga0209564_1012171 3300025295 Bacteria 3774
167 Ga0209758_1000004 3300025297 Bacteria 1375322
168 Ga0209050_1000001 3300025298 Bacteria 3563507
169 Ga0209050_1009719 3300025298 Bacteria 4872
170 Ga0209050_1021756 3300025298 Bacteria 2324
171 Ga0207426_1018235 3300025302 Bacteria 2477
172 Ga0209051_1000336 3300025303 Bacteria 70491
173 Ga0209051_1015674 3300025303 Bacteria 3474
174 Ga0209257_1001103 3300025304 Bacteria 35112
175 Ga0209257_1001896 3300025304 Bacteria 22606
176 Ga0207656_10005324 3300025321 Bacteria 4540
177 Ga0207642_10049609 3300025899 Bacteria 1888
178 Ga0207680_10070144 3300025903 Bacteria 2168
179 Ga0207645_10017057 3300025907 Bacteria 4798
180 Ga0207643_10026164 3300025908 Bacteria 3229
181 Ga0207654_10054405 3300025911 Bacteria 2313
182 Ga0207654_10112115 3300025911 Bacteria 1699
183 Ga0207695_10013640 3300025913 Bacteria 9678
184 Ga0207695_10105731 3300025913 Bacteria 2802
185 Ga0207695_10176441 3300025913 Bacteria 2059
186 Ga0207671_10000896 3300025914 Bacteria 37668
187 Ga0207671_10058739 3300025914 Bacteria 2852
188 Ga0207671_10060093 3300025914 Bacteria 2820
189 Ga0207671_10180258 3300025914 Bacteria 1644
190 Ga0207662_10016328 3300025918 Bacteria 4189
191 Ga0207649_10133819 3300025920 Bacteria 1688
192 Ga0207681_10326829 3300025923 Bacteria 1221
193 Ga0207694_10003288 3300025924 Bacteria 12865
194 Ga0207650_10009143 3300025925 Bacteria 6772
195 Ga0207650_10039002 3300025925 Bacteria 3471
196 Ga0207650_10141207 3300025925 Bacteria 1894
197 Ga0207659_10003526 3300025926 Bacteria 9406
198 Ga0207644_10100012 3300025931 Bacteria 2177
199 Ga0207644_10175429 3300025931 Bacteria 1676
200 Ga0207706_10004186 3300025933 Bacteria 13585
201 Ga0207706_10021988 3300025933 Bacteria 5725
202 Ga0207706_10267118 3300025933 Bacteria 1493
203 Ga0207670_10010732 3300025936 Bacteria 5287
204 Ga0207704_10003187 3300025938 Bacteria 7427
205 Ga0207704_10135694 3300025938 Bacteria 1712
206 Ga0207711_10001554 3300025941 Bacteria 21233
207 Ga0207679_10006303 3300025945 Bacteria 7490
208 Ga0207679_10153363 3300025945 Bacteria 1878
209 Ga0207667_10123577 3300025949 Bacteria 2666
210 Ga0207712_10000340 3300025961 Bacteria 42379
211 Ga0207712_10000806 3300025961 Bacteria 23077
212 Ga0207712_10008158 3300025961 Bacteria 6618
213 Ga0207712_10342676 3300025961 Bacteria 1240
214 Ga0207668_10020554 3300025972 Bacteria 4197
215 Ga0207668_10035084 3300025972 Bacteria 3336
216 Ga0207668_10288457 3300025972 Bacteria 1349
217 Ga0207640_10001768 3300025981 Bacteria 11602
218 Ga0207640_10048749 3300025981 Bacteria 2740
219 Ga0207658_10001292 3300025986 Bacteria 19812
220 Ga0207658_10006324 3300025986 Bacteria 8089
221 Ga0207658_10038243 3300025986 Bacteria 3454
222 Ga0207658_10744512 3300025986 Bacteria 887
223 Ga0207677_10097503 3300026023 Bacteria 2154
224 Ga0207703_10028781 3300026035 Bacteria 4383
225 Ga0207639_10000208 3300026041 Bacteria 44428
226 Ga0207639_10000399 3300026041 Bacteria 29931
227 Ga0207639_10000826 3300026041 Bacteria 21061
228 Ga0207639_10075663 3300026041 Bacteria 2648
229 Ga0207678_10001518 3300026067 Bacteria 21263
230 Ga0207678_10068698 3300026067 Bacteria 3039
231 Ga0207678_10094348 3300026067 Bacteria 2557
232 Ga0207708_10023747 3300026075 Bacteria 4635
233 Ga0207702_10020837 3300026078 Bacteria 5423
234 Ga0207702_10078643 3300026078 Bacteria 2856
235 Ga0207702_10275314 3300026078 Bacteria 1589
236 Ga0207641_10012412 3300026088 Bacteria 6985
237 Ga0207641_10022262 3300026088 Bacteria 5215
238 Ga0207641_10026894 3300026088 Bacteria 4750
239 Ga0207648_10030484 3300026089 Bacteria 4777
240 Ga0207676_10354244 3300026095 Bacteria 1358
241 Ga0207674_10008676 3300026116 Bacteria 11703
242 Ga0207674_10197152 3300026116 Bacteria 1963
243 Ga0207674_10313610 3300026116 Bacteria 1517
244 Ga0207675_100008590 3300026118 Bacteria 9605
245 Ga0207698_10117545 3300026142 Bacteria 2243
246 Ga0207698_10129007 3300026142 Bacteria 2157
247 Ga0207698_10437980 3300026142 Bacteria 1258
248 Ga0207428_10009891 3300027907 Bacteria 8542
249 Ga0207428_10079815 3300027907 Bacteria 2557
250 Ga0268266_10000001 3300028379 Bacteria 4040580
251 Ga0268266_10000013 3300028379 Bacteria 649715
252 Ga0268266_10001830 3300028379 Bacteria 24038
253 Ga0268266_10019174 3300028379 Bacteria 5825
254 Ga0268266_10456797 3300028379 Bacteria 1215
255 Ga0268265_10000072 3300028380 Bacteria 130716
256 Ga0268265_10000229 3300028380 Bacteria 64020
257 Ga0268265_10002881 3300028380 Bacteria 12635
258 Ga0268264_10015787 3300028381 Bacteria 6183
259 Ga0265320_10000820 3300031240 Bacteria 23443
260 Ga0307408_100022320 3300031548 Bacteria 4299
261 Ga0307408_100145328 3300031548 Bacteria 1866
262 Ga0307408_100163010 3300031548 Bacteria 1772
263 Ga0265314_10010203 3300031711 Bacteria 7865
264 Ga0307406_10376010 3300031901 Bacteria 1118
265 Ga0307412_10009187 3300031911 Bacteria 5666
266 Ga0307412_10093313 3300031911 Bacteria 2111
267 Ga0307416_100121976 3300032002 Bacteria 2325
268 Ga0307414_10000295 3300032004 Bacteria 29114
269 Ga0307414_10036729 3300032004 Bacteria 3274
270 Ga0307414_10109822 3300032004 Bacteria 2096
271 Ga0307411_10013325 3300032005 Bacteria 4533
272 Ga0307411_10110132 3300032005 Bacteria 1968
273 Ga0373958_0045601 3300034819 Bacteria 911
274 Ga0373962_0043822 3300035242 Bacteria 1269
275 Ga0316574_0006915 3300035398 Bacteria 6175
276 Ga0316574_0039996 3300035398 Bacteria 2886
277 Ga0373947_0197150 3300035725 Bacteria 1316
278 Ga0316584_0039566 3300036712 Bacteria 3510
279 Ga0451802_0543464 3300041460 Bacteria 2889
280 Ga0451806_458150 3300041462 Bacteria 1486
281 Ga0451804_1176550 3300041463 Bacteria 1214
282 Ga0451807_1685120 3300041486 Bacteria 2426
283 Ga0451845_0787150 3300041501 Bacteria 2768
284 Ga0451853_0865586 3300041512 Bacteria 1112
285 Ga0439442_015725 3300042002 Bacteria 1560
286 Ga0451576_0010540 3300045051 Bacteria 10593
287 Ga0451576_0285224 3300045051 Bacteria 1726
288 Ga0495607_0013766 3300046501 Bacteria 5288
289 Ga0495633_0027467 3300046558 Bacteria 2782
290 Ga0495668_0000001 3300046616 Bacteria 1013420
291 Ga0495625_0105619 3300046660 Bacteria 1929
292 Ga0495669_0040173 3300046684 Bacteria 2074
293 Ga0495670_0243112 3300046691 Bacteria 958
294 Ga0495686_0000701 3300047472 Bacteria 45238
295 Ga0495686_0038287 3300047472 Bacteria 3067
296 Ga0496102_0130381 3300048905 Bacteria 2353
297 Ga0496106_0016626 3300048909 Bacteria 5444
298 Ga0496108_0044772 3300048911 Bacteria 3695
299 Ga0496108_0064201 3300048911 Bacteria 3093
300 Ga0496109_0015838 3300048912 Bacteria 6583
301 Ga0496109_0039704 3300048912 Bacteria 4261
302 Ga0496110_0027397 3300048913 Bacteria 4885
303 Ga0496110_0135338 3300048913 Bacteria 2226
304 Ga0496111_0136530 3300048914 Bacteria 1817
305 Ga0496112_0048604 3300048915 Bacteria 4159
306 Ga0496112_0273864 3300048915 Bacteria 1636
307 Ga0496113_0068146 3300048916 Bacteria 2700
308 Ga0496114_0154213 3300048917 Bacteria 1994
309 Ga0496117_0039896 3300048920 Bacteria 3460
310 Ga0496118_0000081 3300048921 Bacteria 188525
311 Ga0496118_0001948 3300048921 Bacteria 29244
312 Ga0496121_0000079 3300048924 Bacteria 232653
313 Ga0496122_0003679 3300048925 Bacteria 19880
314 Ga0496123_0002416 3300048926 Bacteria 23301
315 Ga0496123_0007194 3300048926 Bacteria 10562
316 Ga0496123_0035336 3300048926 Bacteria 3562
317 Ga0496124_0002507 3300048927 Bacteria 23886
318 Ga0496124_0006038 3300048927 Bacteria 13346
319 Ga0496124_0009995 3300048927 Bacteria 9688
320 Ga0496124_0015968 3300048927 Bacteria 7166
321 Ga0496124_0037592 3300048927 Bacteria 4209
322 Ga0496124_0252029 3300048927 Bacteria 1305
323 Ga0496125_0033394 3300048928 Bacteria 4554
324 Ga0496125_0208324 3300048928 Bacteria 1272
325 Ga0496126_0002328 3300048929 Bacteria 26027
326 Ga0496126_0419394 3300048929 Bacteria 1082
327 Ga0501032_0102689 3300049569 Bacteria 1894
328 Ga0501038_0094476 3300049574 Bacteria 2499
329 Ga0501039_0107415 3300049575 Bacteria 2180
330 Ga0501047_0138838 3300049581 Bacteria 2309
331 Ga0501073_0287574 3300049589 Bacteria 1134
332 Ga0501223_000084 3300049663 Bacteria 28507
333 Ga0501249_000182 3300049679 Bacteria 19079
334 Ga0501225_0000044 3300049705 Bacteria 41695
335 Ga0501268_011721 3300049765 Bacteria 1389
336 Ga0501035_0094287 3300049822 Bacteria 2632
337 Ga0501044_0078961 3300049823 Bacteria 3335
338 Ga0501044_0141485 3300049823 Bacteria 2394
339 nmdc:mga05p37_14747_c1 3300050507 Bacteria 9387
340 nmdc:mga09592_2206_c1 3300050508 Bacteria 15670
341 nmdc:mga09592_226444_c1 3300050508 Bacteria 1620
342 nmdc:mga09592_574240_c1 3300050508 Bacteria 967
343 nmdc:mga0qj67_236762_c1 3300050509 Bacteria 1481
344 nmdc:mga0qj67_8382_c1 3300050509 Bacteria 7664
345 nmdc:mga06r32_1282_c1 3300050510 Bacteria 22617
346 nmdc:mga06r32_1635_c1 3300050510 Bacteria 20215
347 nmdc:mga06r32_236384_c1 3300050510 Bacteria 1815
348 nmdc:mga08y16_13656_c1 3300050511 Bacteria 8551
349 nmdc:mga08y16_17997_c1 3300050511 Bacteria 7442
350 nmdc:mga0a205_327652_c1 3300050515 Bacteria 1401
351 nmdc:mga0a205_375615_c1 3300050515 Bacteria 1287
352 Ga0500610_0014317 3300053079 Bacteria 3717
353 Ga0500643_000924 3300053087 Bacteria 18433
354 Ga0500651_0000268 3300053093 Bacteria 30966
355 Ga0500651_0015113 3300053093 Bacteria 4734
356 Ga0500597_044561 3300053120 Bacteria 1874
357 Ga0500559_0037830 3300053136 Bacteria 2093
358 Ga0500588_0041140 3300053146 Bacteria 1393
359 Ga0500624_000068 3300053157 Bacteria 61139
360 Ga0466962_0219693 3300061719 Bacteria 931

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035725 Ga0373947_0197150 Ga0373947_0197150_12_707 227
2 3300048917 Ga0496114_0154213 Ga0496114_0154213_20_748 242
3 3300006051 Ga0075364_10080980 Ga0075364_100809801 248
4 iso_pu_bacteria 2928027323 2928029164 250
5 iso_pu_bacteria 2984555340 2984555394 250
6 iso_pu_bacteria 2984564862 2984566468 250
7 iso_pu_bacteria 2993356040 2993357507 250
8 3300035398 Ga0316574_0006915 Ga0316574_0006915_1844_2608 251
9 3300036712 Ga0316584_0039566 Ga0316584_0039566_1088_1852 251
10 iso_pu_bacteria 2928526807 2928527212 251
11 3300002774 JGI25150J39212_1000657 JGI25150J39212_100065711 252
12 3300003187 JGI25151J46595_10017862 JGI25151J46595_100178623 252
13 3300003215 JGI25153J46596_10000266 JGI25153J46596_1000026614 252
14 3300003771 Ga0055526_1004679 Ga0055526_10046792 252
15 3300003773 Ga0055537_1000644 Ga0055537_100064413 252
16 3300003781 Ga0055536_1019792 Ga0055536_10197921 252
17 3300003791 Ga0055530_10006500 Ga0055530_100065004 252
18 3300003792 Ga0055540_1000692 Ga0055540_100069221 252
19 3300003794 Ga0055531_10018902 Ga0055531_100189022 252
20 3300003794 Ga0055531_10023520 Ga0055531_100235202 252
21 3300005290 Ga0065712_10079281 Ga0065712_100792813 252
22 3300005293 Ga0065715_10170161 Ga0065715_101701612 252
23 3300005327 Ga0070658_10270535 Ga0070658_102705351 252
24 3300005328 Ga0070676_10017125 Ga0070676_100171251 252
25 3300005330 Ga0070690_100001101 Ga0070690_1000011017 252
26 3300005331 Ga0070670_100031964 Ga0070670_1000319641 252
27 3300005331 Ga0070670_100052190 Ga0070670_1000521901 252
28 3300005335 Ga0070666_10023869 Ga0070666_100238692 252
29 3300005338 Ga0068868_100298075 Ga0068868_1002980752 252
30 3300005340 Ga0070689_100003117 Ga0070689_1000031172 252
31 3300005343 Ga0070687_100165691 Ga0070687_1001656911 252
32 3300005344 Ga0070661_100020141 Ga0070661_1000201412 252
33 3300005347 Ga0070668_100011367 Ga0070668_1000113677 252
34 3300005347 Ga0070668_100050367 Ga0070668_1000503672 252
35 3300005353 Ga0070669_100026983 Ga0070669_1000269832 252
36 3300005354 Ga0070675_100002544 Ga0070675_1000025448 252
37 3300005355 Ga0070671_100141131 Ga0070671_1001411312 252
38 3300005364 Ga0070673_100002381 Ga0070673_1000023819 252
39 3300005365 Ga0070688_100128443 Ga0070688_1001284431 252
40 3300005366 Ga0070659_100270605 Ga0070659_1002706051 252
41 3300005367 Ga0070667_100032837 Ga0070667_1000328372 252
42 3300005439 Ga0070711_100036332 Ga0070711_1000363323 252
43 3300005440 Ga0070705_100002488 Ga0070705_1000024882 252
44 3300005441 Ga0070700_100030565 Ga0070700_1000305652 252
45 3300005441 Ga0070700_100076012 Ga0070700_1000760121 252
46 3300005455 Ga0070663_100034379 Ga0070663_1000343793 252
47 3300005457 Ga0070662_100048567 Ga0070662_1000485672 252
48 3300005535 Ga0070684_100040844 Ga0070684_1000408442 252
49 3300005539 Ga0068853_100000225 Ga0068853_10000022521 252
50 3300005543 Ga0070672_100083355 Ga0070672_1000833552 252
51 3300005544 Ga0070686_100007446 Ga0070686_1000074463 252
52 3300005547 Ga0070693_100028877 Ga0070693_1000288772 252
53 3300005548 Ga0070665_100000326 Ga0070665_10000032626 252
54 3300005548 Ga0070665_100000400 Ga0070665_10000040051 252
55 3300005548 Ga0070665_100003179 Ga0070665_1000031797 252
56 3300005548 Ga0070665_100014780 Ga0070665_1000147804 252
57 3300005548 Ga0070665_100017613 Ga0070665_1000176136 252
58 3300005548 Ga0070665_100046081 Ga0070665_1000460813 252
59 3300005548 Ga0070665_100181246 Ga0070665_1001812464 252
60 3300005548 Ga0070665_100598364 Ga0070665_1005983641 252
61 3300005563 Ga0068855_100002951 Ga0068855_10000295122 252
62 3300005563 Ga0068855_100112943 Ga0068855_1001129432 252
63 3300005563 Ga0068855_100115526 Ga0068855_1001155262 252
64 3300005563 Ga0068855_100121121 Ga0068855_1001211212 252
65 3300005564 Ga0070664_100005455 Ga0070664_10000545510 252
66 3300005564 Ga0070664_100024228 Ga0070664_1000242285 252
67 3300005577 Ga0068857_100143889 Ga0068857_1001438892 252
68 3300005578 Ga0068854_100003017 Ga0068854_1000030174 252
69 3300005614 Ga0068856_100096284 Ga0068856_1000962843 252
70 3300005614 Ga0068856_100247609 Ga0068856_1002476092 252
71 3300005614 Ga0068856_100419949 Ga0068856_1004199491 252
72 3300005616 Ga0068852_100330634 Ga0068852_1003306342 252
73 3300005616 Ga0068852_100734741 Ga0068852_1007347412 252
74 3300005617 Ga0068859_100011511 Ga0068859_1000115112 252
75 3300005617 Ga0068859_100025994 Ga0068859_1000259944 252
76 3300005618 Ga0068864_100002045 Ga0068864_10000204510 252
77 3300005618 Ga0068864_100089020 Ga0068864_1000890203 252
78 3300005719 Ga0068861_100003958 Ga0068861_1000039589 252
79 3300005834 Ga0068851_10010768 Ga0068851_100107683 252
80 3300005840 Ga0068870_10114097 Ga0068870_101140972 252
81 3300005841 Ga0068863_100008893 Ga0068863_1000088932 252
82 3300005841 Ga0068863_100009193 Ga0068863_1000091932 252
83 3300005841 Ga0068863_100040983 Ga0068863_1000409832 252
84 3300005841 Ga0068863_100066650 Ga0068863_1000666502 252
85 3300005842 Ga0068858_100014299 Ga0068858_1000142992 252
86 3300005843 Ga0068860_100144830 Ga0068860_1001448302 252
87 3300005844 Ga0068862_100001783 Ga0068862_1000017833 252
88 3300005844 Ga0068862_100012697 Ga0068862_1000126972 252
89 3300005844 Ga0068862_100057246 Ga0068862_1000572464 252
90 3300006237 Ga0097621_100097093 Ga0097621_1000970932 252
91 3300006358 Ga0068871_100171723 Ga0068871_1001717232 252
92 3300006358 Ga0068871_100349461 Ga0068871_1003494611 252
93 3300006844 Ga0075428_100004741 Ga0075428_10000474115 252
94 3300006844 Ga0075428_100034538 Ga0075428_1000345381 252
95 3300006844 Ga0075428_100332763 Ga0075428_1003327631 252
96 3300006846 Ga0075430_100001035 Ga0075430_10000103521 252
97 3300006847 Ga0075431_100001329 Ga0075431_1000013292 252
98 3300006847 Ga0075431_100016999 Ga0075431_1000169996 252
99 3300006852 Ga0075433_10224430 Ga0075433_102244302 252
100 3300006880 Ga0075429_100010536 Ga0075429_1000105362 252
101 3300006880 Ga0075429_100021524 Ga0075429_1000215244 252
102 3300006880 Ga0075429_100116248 Ga0075429_1001162482 252
103 3300006881 Ga0068865_100020055 Ga0068865_1000200552 252
104 3300006881 Ga0068865_100166600 Ga0068865_1001666002 252
105 3300006931 Ga0097620_100011511 Ga0097620_1000115112 252
106 3300006931 Ga0097620_100025994 Ga0097620_1000259944 252
107 3300009093 Ga0105240_10438436 Ga0105240_104384362 252
108 3300009094 Ga0111539_10002957 Ga0111539_100029571 252
109 3300009094 Ga0111539_10017857 Ga0111539_100178572 252
110 3300009094 Ga0111539_10433220 Ga0111539_104332201 252
111 3300009094 Ga0111539_10475573 Ga0111539_104755732 252
112 3300009098 Ga0105245_10217010 Ga0105245_102170102 252
113 3300009147 Ga0114129_10003545 Ga0114129_100035452 252
114 3300009174 Ga0105241_10099084 Ga0105241_100990842 252
115 3300009177 Ga0105248_10002211 Ga0105248_1000221117 252
116 3300009545 Ga0105237_10124006 Ga0105237_101240062 252
117 3300009545 Ga0105237_10212698 Ga0105237_102126982 252
118 3300009551 Ga0105238_10029286 Ga0105238_100292864 252
119 3300009553 Ga0105249_10093282 Ga0105249_100932822 252
120 3300009553 Ga0105249_10152618 Ga0105249_101526182 252
121 3300009553 Ga0105249_10250440 Ga0105249_102504402 252
122 3300009553 Ga0105249_10376903 Ga0105249_103769032 252
123 3300010375 Ga0105239_10016190 Ga0105239_100161907 252
124 3300010375 Ga0105239_10055103 Ga0105239_100551034 252
125 3300010375 Ga0105239_10171386 Ga0105239_101713862 252
126 3300010375 Ga0105239_10380126 Ga0105239_103801262 252
127 3300013100 Ga0157373_10179753 Ga0157373_101797531 252
128 3300013306 Ga0163162_10000016 Ga0163162_1000001694 252
129 3300013306 Ga0163162_10172118 Ga0163162_101721182 252
130 3300013307 Ga0157372_10000781 Ga0157372_1000078122 252
131 3300013307 Ga0157372_10214907 Ga0157372_102149072 252
132 3300013308 Ga0157375_10108346 Ga0157375_101083462 252
133 3300014325 Ga0163163_10009573 Ga0163163_100095738 252
134 3300014325 Ga0163163_10299149 Ga0163163_102991492 252
135 3300014326 Ga0157380_10233803 Ga0157380_102338032 252
136 3300014745 Ga0157377_10007402 Ga0157377_100074024 252
137 3300014969 Ga0157376_10085409 Ga0157376_100854092 252
138 3300014969 Ga0157376_10275335 Ga0157376_102753352 252
139 3300025245 Ga0207425_1000114 Ga0207425_10001143 252
140 3300025258 Ga0209129_1004131 Ga0209129_10041313 252
141 3300025261 Ga0209233_1000586 Ga0209233_10005863 252
142 3300025263 Ga0209565_1000298 Ga0209565_100029814 252
143 3300025263 Ga0209565_1010678 Ga0209565_10106782 252
144 3300025273 Ga0209673_1012044 Ga0209673_10120444 252
145 3300025292 Ga0209676_1007714 Ga0209676_10077144 252
146 3300025292 Ga0209676_1011139 Ga0209676_10111393 252
147 3300025294 Ga0209025_1001326 Ga0209025_10013263 252
148 3300025295 Ga0209564_1001139 Ga0209564_10011392 252
149 3300025295 Ga0209564_1012171 Ga0209564_10121713 252
150 3300025297 Ga0209758_1000004 Ga0209758_10000041254 252
151 3300025298 Ga0209050_1000001 Ga0209050_10000013257 252
152 3300025298 Ga0209050_1009719 Ga0209050_10097193 252
153 3300025298 Ga0209050_1021756 Ga0209050_10217562 252
154 3300025302 Ga0207426_1018235 Ga0207426_10182352 252
155 3300025303 Ga0209051_1000336 Ga0209051_100033625 252
156 3300025303 Ga0209051_1015674 Ga0209051_10156743 252
157 3300025304 Ga0209257_1001103 Ga0209257_100110314 252
158 3300025304 Ga0209257_1001896 Ga0209257_100189610 252
159 3300025321 Ga0207656_10005324 Ga0207656_100053241 252
160 3300025899 Ga0207642_10049609 Ga0207642_100496091 252
161 3300025903 Ga0207680_10070144 Ga0207680_100701443 252
162 3300025907 Ga0207645_10017057 Ga0207645_100170572 252
163 3300025908 Ga0207643_10026164 Ga0207643_100261643 252
164 3300025911 Ga0207654_10054405 Ga0207654_100544052 252
165 3300025911 Ga0207654_10112115 Ga0207654_101121152 252
166 3300025913 Ga0207695_10105731 Ga0207695_101057312 252
167 3300025914 Ga0207671_10060093 Ga0207671_100600933 252
168 3300025914 Ga0207671_10180258 Ga0207671_101802582 252
169 3300025918 Ga0207662_10016328 Ga0207662_100163282 252
170 3300025920 Ga0207649_10133819 Ga0207649_101338192 252
171 3300025923 Ga0207681_10326829 Ga0207681_103268291 252
172 3300025924 Ga0207694_10003288 Ga0207694_100032889 252
173 3300025925 Ga0207650_10039002 Ga0207650_100390022 252
174 3300025925 Ga0207650_10141207 Ga0207650_101412072 252
175 3300025926 Ga0207659_10003526 Ga0207659_100035263 252
176 3300025931 Ga0207644_10175429 Ga0207644_101754292 252
177 3300025933 Ga0207706_10004186 Ga0207706_1000418610 252
178 3300025933 Ga0207706_10021988 Ga0207706_100219883 252
179 3300025933 Ga0207706_10267118 Ga0207706_102671182 252
180 3300025936 Ga0207670_10010732 Ga0207670_100107323 252
181 3300025938 Ga0207704_10003187 Ga0207704_100031874 252
182 3300025938 Ga0207704_10135694 Ga0207704_101356942 252
183 3300025945 Ga0207679_10006303 Ga0207679_100063034 252
184 3300025945 Ga0207679_10153363 Ga0207679_101533632 252
185 3300025949 Ga0207667_10123577 Ga0207667_101235772 252
186 3300025961 Ga0207712_10000340 Ga0207712_1000034017 252
187 3300025961 Ga0207712_10008158 Ga0207712_100081582 252
188 3300025961 Ga0207712_10342676 Ga0207712_103426762 252
189 3300025972 Ga0207668_10020554 Ga0207668_100205542 252
190 3300025972 Ga0207668_10035084 Ga0207668_100350842 252
191 3300025972 Ga0207668_10288457 Ga0207668_102884571 252
192 3300025981 Ga0207640_10001768 Ga0207640_100017684 252
193 3300025986 Ga0207658_10006324 Ga0207658_100063242 252
194 3300025986 Ga0207658_10038243 Ga0207658_100382433 252
195 3300025986 Ga0207658_10744512 Ga0207658_107445121 252
196 3300026023 Ga0207677_10097503 Ga0207677_100975032 252
197 3300026035 Ga0207703_10028781 Ga0207703_100287812 252
198 3300026041 Ga0207639_10000208 Ga0207639_1000020825 252
199 3300026041 Ga0207639_10000399 Ga0207639_1000039921 252
200 3300026041 Ga0207639_10000826 Ga0207639_1000082624 252
201 3300026041 Ga0207639_10075663 Ga0207639_100756632 252
202 3300026067 Ga0207678_10068698 Ga0207678_100686982 252
203 3300026067 Ga0207678_10094348 Ga0207678_100943484 252
204 3300026075 Ga0207708_10023747 Ga0207708_100237472 252
205 3300026078 Ga0207702_10020837 Ga0207702_100208372 252
206 3300026078 Ga0207702_10078643 Ga0207702_100786432 252
207 3300026078 Ga0207702_10275314 Ga0207702_102753142 252
208 3300026088 Ga0207641_10022262 Ga0207641_100222623 252
209 3300026088 Ga0207641_10026894 Ga0207641_100268944 252
210 3300026089 Ga0207648_10030484 Ga0207648_100304843 252
211 3300026116 Ga0207674_10008676 Ga0207674_100086762 252
212 3300026116 Ga0207674_10313610 Ga0207674_103136102 252
213 3300026118 Ga0207675_100008590 Ga0207675_1000085902 252
214 3300026142 Ga0207698_10117545 Ga0207698_101175452 252
215 3300026142 Ga0207698_10129007 Ga0207698_101290072 252
216 3300026142 Ga0207698_10437980 Ga0207698_104379802 252
217 3300027907 Ga0207428_10009891 Ga0207428_100098917 252
218 3300027907 Ga0207428_10079815 Ga0207428_100798151 252
219 3300028379 Ga0268266_10000001 Ga0268266_10000001882 252
220 3300028379 Ga0268266_10000013 Ga0268266_1000001333 252
221 3300028379 Ga0268266_10001830 Ga0268266_100018303 252
222 3300028379 Ga0268266_10019174 Ga0268266_100191742 252
223 3300028379 Ga0268266_10456797 Ga0268266_104567972 252
224 3300028380 Ga0268265_10000072 Ga0268265_100000723 252
225 3300028380 Ga0268265_10000229 Ga0268265_1000022915 252
226 3300028380 Ga0268265_10002881 Ga0268265_1000288110 252
227 3300028381 Ga0268264_10015787 Ga0268264_100157877 252
228 3300031548 Ga0307408_100022320 Ga0307408_1000223201 252
229 3300031548 Ga0307408_100145328 Ga0307408_1001453282 252
230 3300031548 Ga0307408_100163010 Ga0307408_1001630102 252
231 3300031901 Ga0307406_10376010 Ga0307406_103760101 252
232 3300032002 Ga0307416_100121976 Ga0307416_1001219762 252
233 3300032004 Ga0307414_10000295 Ga0307414_100002955 252
234 3300032005 Ga0307411_10013325 Ga0307411_100133251 252
235 3300032005 Ga0307411_10110132 Ga0307411_101101322 252
236 3300034819 Ga0373958_0045601 Ga0373958_0045601_35_880 252
237 3300035242 Ga0373962_0043822 Ga0373962_0043822_32_877 252
238 3300035398 Ga0316574_0039996 Ga0316574_0039996_1550_2332 252
239 3300041460 Ga0451802_0543464 Ga0451802_0543464_1552_2319 252
240 3300041462 Ga0451806_458150 Ga0451806_458150_392_1150 252
241 3300041463 Ga0451804_1176550 Ga0451804_1176550_440_1198 252
242 3300041486 Ga0451807_1685120 Ga0451807_1685120_620_1378 252
243 3300041501 Ga0451845_0787150 Ga0451845_0787150_1399_2157 252
244 3300041512 Ga0451853_0865586 Ga0451853_0865586_310_1068 252
245 3300042002 Ga0439442_015725 Ga0439442_015725_225_1001 252
246 3300045051 Ga0451576_0010540 Ga0451576_0010540_9451_10296 252
247 3300046660 Ga0495625_0105619 Ga0495625_0105619_928_1686 252
248 3300046684 Ga0495669_0040173 Ga0495669_0040173_940_1785 252
249 3300046691 Ga0495670_0243112 Ga0495670_0243112_44_802 252
250 3300048909 Ga0496106_0016626 Ga0496106_0016626_2736_3581 252
251 3300048911 Ga0496108_0044772 Ga0496108_0044772_804_1649 252
252 3300048912 Ga0496109_0039704 Ga0496109_0039704_256_1101 252
253 3300048913 Ga0496110_0027397 Ga0496110_0027397_831_1676 252
254 3300048915 Ga0496112_0048604 Ga0496112_0048604_1637_2482 252
255 3300048916 Ga0496113_0068146 Ga0496113_0068146_1479_2324 252
256 3300048920 Ga0496117_0039896 Ga0496117_0039896_2077_2844 252
257 3300048921 Ga0496118_0000081 Ga0496118_0000081_29467_30234 252
258 3300048921 Ga0496118_0001948 Ga0496118_0001948_23237_24004 252
259 3300048927 Ga0496124_0037592 Ga0496124_0037592_849_1607 252
260 3300049589 Ga0501073_0287574 Ga0501073_0287574_351_1118 252
261 3300049679 Ga0501249_000182 Ga0501249_000182_16224_16982 252
262 3300049765 Ga0501268_011721 Ga0501268_011721_434_1279 252
263 3300049823 Ga0501044_0078961 Ga0501044_0078961_2043_2810 252
264 3300050507 nmdc:mga05p37_14747_c1 nmdc:mga05p37_14747_c1_773_1618 252
265 3300050508 nmdc:mga09592_2206_c1 nmdc:mga09592_2206_c1_3654_4502 252
266 3300050508 nmdc:mga09592_226444_c1 nmdc:mga09592_226444_c1_58_903 252
267 3300050508 nmdc:mga09592_574240_c1 nmdc:mga09592_574240_c1_87_935 252
268 3300050509 nmdc:mga0qj67_236762_c1 nmdc:mga0qj67_236762_c1_403_1251 252
269 3300050509 nmdc:mga0qj67_8382_c1 nmdc:mga0qj67_8382_c1_844_1689 252
270 3300050510 nmdc:mga06r32_1282_c1 nmdc:mga06r32_1282_c1_310_1158 252
271 3300050510 nmdc:mga06r32_1635_c1 nmdc:mga06r32_1635_c1_4153_4998 252
272 3300050510 nmdc:mga06r32_236384_c1 nmdc:mga06r32_236384_c1_307_1152 252
273 3300050511 nmdc:mga08y16_13656_c1 nmdc:mga08y16_13656_c1_7765_8541 252
274 3300050511 nmdc:mga08y16_17997_c1 nmdc:mga08y16_17997_c1_6310_7158 252
275 3300050515 nmdc:mga0a205_327652_c1 nmdc:mga0a205_327652_c1_25_873 252
276 3300050515 nmdc:mga0a205_375615_c1 nmdc:mga0a205_375615_c1_104_949 252
277 3300053079 Ga0500610_0014317 Ga0500610_0014317_946_1713 252
278 3300053087 Ga0500643_000924 Ga0500643_000924_10730_11488 252
279 3300053093 Ga0500651_0000268 Ga0500651_0000268_20739_21506 252
280 3300053093 Ga0500651_0015113 Ga0500651_0015113_3150_3917 252
281 3300053136 Ga0500559_0037830 Ga0500559_0037830_1183_1950 252
282 3300053146 Ga0500588_0041140 Ga0500588_0041140_378_1145 252
283 3300061719 Ga0466962_0219693 Ga0466962_0219693_20_778 252
284 iso_pu_bacteria 2524023250 2524609539 252
285 3300005367 Ga0070667_100000303 Ga0070667_10000030333 253
286 3300005455 Ga0070663_100009366 Ga0070663_1000093662 253
287 3300009093 Ga0105240_10139368 Ga0105240_101393682 253
288 3300009177 Ga0105248_10001975 Ga0105248_100019754 253
289 3300009545 Ga0105237_10000968 Ga0105237_1000096815 253
290 3300009553 Ga0105249_10001182 Ga0105249_1000118216 253
291 3300014326 Ga0157380_10294515 Ga0157380_102945152 253
292 3300025913 Ga0207695_10176441 Ga0207695_101764413 253
293 3300025914 Ga0207671_10000896 Ga0207671_100008963 253
294 3300025941 Ga0207711_10001554 Ga0207711_1000155415 253
295 3300025961 Ga0207712_10000806 Ga0207712_1000080616 253
296 3300025986 Ga0207658_10001292 Ga0207658_100012922 253
297 3300026067 Ga0207678_10001518 Ga0207678_1000151814 253
298 3300047472 Ga0495686_0038287 Ga0495686_0038287_792_1562 253
299 3300048925 Ga0496122_0003679 Ga0496122_0003679_18558_19328 253
300 3300048926 Ga0496123_0002416 Ga0496123_0002416_18473_19243 253
301 3300048927 Ga0496124_0252029 Ga0496124_0252029_302_1192 253
302 3300053120 Ga0500597_044561 Ga0500597_044561_716_1486 253
303 iso_pu_bacteria 8054302542 8054304462 253
304 3300005327 Ga0070658_10496681 Ga0070658_104966812 254
305 iso_pu_bacteria 2599185354 2600201888 254
306 3300005577 Ga0068857_100117486 Ga0068857_1001174862 255
307 3300005578 Ga0068854_100066850 Ga0068854_1000668506 255
308 3300025914 Ga0207671_10058739 Ga0207671_100587396 255
309 3300025981 Ga0207640_10048749 Ga0207640_100487496 255
310 3300026116 Ga0207674_10197152 Ga0207674_101971522 255
311 3300048926 Ga0496123_0007194 Ga0496123_0007194_8989_9756 255
312 3300048926 Ga0496123_0035336 Ga0496123_0035336_850_1617 255
313 3300048927 Ga0496124_0002507 Ga0496124_0002507_14285_15052 255
314 3300048927 Ga0496124_0009995 Ga0496124_0009995_677_1444 255
315 3300048927 Ga0496124_0015968 Ga0496124_0015968_6108_6875 255
316 3300048928 Ga0496125_0033394 Ga0496125_0033394_2606_3400 255
317 3300048928 Ga0496125_0208324 Ga0496125_0208324_284_1051 255
318 iso_pu_bacteria 2643221563 2643835959 255
319 iso_pu_bacteria 2643221608 2644056884 255
320 iso_pu_bacteria 2738543024 2739310551 255
321 iso_pu_bacteria 2751185897 2753767542 255
322 iso_pu_bacteria 2848297114 2848298270 255
323 iso_pu_bacteria 2996310559 2996315007 255
324 iso_pu_bacteria 8057101203 8057102464 255
325 iso_pu_bacteria 8002285264 8002287469 256
326 iso_pu_bacteria 2919688452 2919692217 258
327 3300002239 JGI24034J26672_10020052 JGI24034J26672_100200521 259
328 3300003781 Ga0055536_1002000 Ga0055536_100200011 259
329 3300005262 Ga0065165_1002485 Ga0065165_10024856 259
330 3300005331 Ga0070670_100014711 Ga0070670_1000147112 259
331 3300005355 Ga0070671_100479997 Ga0070671_1004799971 259
332 3300005355 Ga0070671_100584987 Ga0070671_1005849872 259
333 3300005618 Ga0068864_100053643 Ga0068864_1000536433 259
334 3300005841 Ga0068863_100024096 Ga0068863_1000240968 259
335 3300009093 Ga0105240_10063836 Ga0105240_100638363 259
336 3300009551 Ga0105238_10216261 Ga0105238_102162613 259
337 3300009553 Ga0105249_10251435 Ga0105249_102514353 259
338 3300010375 Ga0105239_10000113 Ga0105239_1000011388 259
339 3300013306 Ga0163162_10087377 Ga0163162_100873772 259
340 3300025291 Ga0209675_1000188 Ga0209675_100018840 259
341 3300025292 Ga0209676_1000449 Ga0209676_100044975 259
342 3300025292 Ga0209676_1012999 Ga0209676_10129992 259
343 3300025913 Ga0207695_10013640 Ga0207695_1001364013 259
344 3300025925 Ga0207650_10009143 Ga0207650_100091436 259
345 3300025931 Ga0207644_10100012 Ga0207644_101000122 259
346 3300026088 Ga0207641_10012412 Ga0207641_100124124 259
347 3300026095 Ga0207676_10354244 Ga0207676_103542442 259
348 3300031240 Ga0265320_10000820 Ga0265320_1000082014 259
349 3300031711 Ga0265314_10010203 Ga0265314_100102037 259
350 3300031911 Ga0307412_10009187 Ga0307412_100091871 259
351 3300031911 Ga0307412_10093313 Ga0307412_100933131 259
352 3300032004 Ga0307414_10036729 Ga0307414_100367294 259
353 3300032004 Ga0307414_10109822 Ga0307414_101098223 259
354 3300045051 Ga0451576_0285224 Ga0451576_0285224_906_1685 259
355 3300046501 Ga0495607_0013766 Ga0495607_0013766_832_1644 259
356 3300046558 Ga0495633_0027467 Ga0495633_0027467_63_842 259
357 3300046616 Ga0495668_0000001 Ga0495668_0000001_563655_564434 259
358 3300047472 Ga0495686_0000701 Ga0495686_0000701_188_973 259
359 3300048905 Ga0496102_0130381 Ga0496102_0130381_1419_2198 259
360 3300048911 Ga0496108_0064201 Ga0496108_0064201_640_1419 259
361 3300048912 Ga0496109_0015838 Ga0496109_0015838_5642_6421 259
362 3300048913 Ga0496110_0135338 Ga0496110_0135338_1274_2053 259
363 3300048914 Ga0496111_0136530 Ga0496111_0136530_498_1277 259
364 3300048915 Ga0496112_0273864 Ga0496112_0273864_63_842 259
365 3300048924 Ga0496121_0000079 Ga0496121_0000079_104127_104957 259
366 3300048927 Ga0496124_0006038 Ga0496124_0006038_1117_1899 259
367 3300048929 Ga0496126_0002328 Ga0496126_0002328_9706_10536 259
368 3300048929 Ga0496126_0419394 Ga0496126_0419394_126_908 259
369 3300049569 Ga0501032_0102689 Ga0501032_0102689_403_1182 259
370 3300049574 Ga0501038_0094476 Ga0501038_0094476_1130_1909 259
371 3300049575 Ga0501039_0107415 Ga0501039_0107415_1346_2125 259
372 3300049581 Ga0501047_0138838 Ga0501047_0138838_227_1006 259
373 3300049663 Ga0501223_000084 Ga0501223_000084_8494_9273 259
374 3300049705 Ga0501225_0000044 Ga0501225_0000044_3991_4770 259
375 3300049822 Ga0501035_0094287 Ga0501035_0094287_1288_2067 259
376 3300049823 Ga0501044_0141485 Ga0501044_0141485_212_991 259
377 3300053157 Ga0500624_000068 Ga0500624_000068_27924_28703 259

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00557

Peptidase_M24

Metallopeptidase family M24

41

271

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
4juq-assembly1.cif.gz_A pseudomonas aeruginosa metap t2n mutant, in mn form 0.986 1 253
3mr1-assembly2.cif.gz_B crystal structure of methionine aminopeptidase from rickettsia prowazekii 0.9754 1 247
6mrf-assembly1.cif.gz_A crystal structure of a methionine aminopeptidase metap from acinetobacter baumannii 0.975 1 252
3tb5-assembly2.cif.gz_B crystal structure of the enterococcus faecalis methionine aminopeptidase apo form 0.9734 1 254
1o0x-assembly1.cif.gz_A crystal structure of methionine aminopeptidase (tm1478) from thermotoga maritima at 1.90 a resolution 0.9712 1 246
ID Description Score Start End Superfamily
4juqD00 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.9874 1 253 3.90.230.10
af_I1J6Q1_1_201_3.90.230.10 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.9713 48 247 3.90.230.10
1o0xA00 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.9712 1 246 3.90.230.10
af_P9WK19_6_284_3.90.230.10 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.9702 2 247 3.90.230.10
4iecA01 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.9694 1 246 3.90.230.10
ID Description Score Start End GO Terms
AF-A0A6G8DHF1-F1-model_v4 Methionine aminopeptidase (MAP) (MetAP) (EC 3.4.11.18) (Peptidase M) 0.9919 1 251 GO:0004239
GO:0005829
GO:0006508
GO:0046872
GO:0070006
AF-A0A354IRQ9-F1-model_v4 Type I methionyl aminopeptidase (EC 3.4.11.18) 0.9913 1 166 GO:0004239
GO:0005829
GO:0070006
AF-A0A4Q6F1R4-F1-model_v4 deleted 0.9885 34 247
AF-A0A3B9AWZ8-F1-model_v4 deleted 0.9882 69 252
AF-A0A654A2Y2-F1-model_v4 deleted 0.988 1 198

Feature Viewer

pLDDT pTM Quality
93.75 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map